ELF>0@0'@8 @ccppp!!ppp %%%`&&& $$Std Ptd!!!$J$JQtdRtd%%%@y@yGNUGNUwL UtO hn $Q!x`|<ҤB^??R. - lB   8 *     E  `mb ve -=  Zb 8u ` "  K q w X[j  8\ t n , T [?F"y {U5 [ $ s - %  M & J _7  k @sA j!S  0}p   +M% Q  g]}@    04D&P   g    "('kSC[LTycaw  L  %Sez R   `N4a  1 4w P m c__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizestrrchr__stack_chk_failstrlenstrncmpstrcmplstat64__isoc99_sscanffopen64strstr__getdelimfclose__errno_locationstrerrorusleepmemcpystrdupdm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroymemccpydm_event_get_registered_devicedm_event_handler_get_event_maskdm_event_handler_get_dso__assert_failstrncpycallocstrcasecmpmemset__ctype_b_locgetenvctime_rcloselogopenlogunamefcntl64stdinselabel_closepthread_mutex_lockpthread_mutex_unlockstdoutsetlinebufgetpagesizeio_destroyio_submitio_geteventsmalloclseek64strchrfputc__fprintf_chkstrspnstrcspnmemmove__ctype_toupper_locstrtodstrtollfgetsumasksd_id128_get_machine_app_specificopendirreaddir64closediralphasort64scandir64setlocaleudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_device_unrefudev_enumerate_unrefmkdirlocaltimestrftimerename__snprintf_chk__memcpy_chk__sprintf_chk__ctype_tolower_locmemcmpunlinkctimegetpidfputsfflushfilenofsyncstrtouldirfdunlinkatflockstrtoludev_device_new_from_devnumudev_device_get_is_initializedreadlinkfstat64ioctludev_device_get_property_valuedirname__xpg_basenameblkid_new_probe_from_filenameblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_do_safeprobeblkid_probe_lookup_valueblkid_free_probestrtoullblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_do_probeblkid_probe_step_backsetmntentgetmntentendmntentreallocferror__vfprintf_chk__vsnprintf_chkgetcstderrfeoffwriteversionsort64accessfdopenrand_r__strncpy_chksd_journal_printv_with_location__vsyslog_chkabortsnprintfio_setupposix_memalignsysconfdup2qsortgetrlimit64mallinfo2mlockallmlockmunlockallmunlocksysinfoforkwait4execvpwaitpidsigprocmasksigactionsigaddsetsigismembersigdelsetudev_newudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefudev_unrefgetprioritysetprioritylockf64sd_bus_open_systemsd_bus_call_methodsd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefsd_bus_error_has_namestrncasecmplocaltime_rmktimememchrsymlinkrmdirputchar__printf_chkoptargoptindgetopt_longnanosleepsetsidlvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_exitlvm2_initlvm2_runsetenvsd_journal_send_with_locationlvm2_init_threaded__fdelt_chkselectmknodgeteuid__isoc99_fscanfsemctlsemgetsemopclock_gettimegmtime_rstrnduprewindmalloptsyscallsetvbufnl_langinfotmpfile64pipesigfillsetgethostnameprlimit64dm_event_unregister_handlerdm_event_register_handlerstrcpyisspacesocketconnectselabel_lookupsetfscreateconfreeconis_selinux_enabledselabel_openchownlibdevmapper-event.so.1.02libdevmapper.so.1.02libsystemd.so.0libblkid.so.1libaio.so.1libselinux.so.1libudev.so.1libc.so.6liblvm2cmd.so.2.03BaseLIBAIO_0.4LIBAIO_0.1LIBSELINUX_1.0LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_2.17BLKID_2.15GLIBC_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.33GLIBC_2.3GLIBC_2.17GLIBC_2.7GLIBC_2.3.4GLIBC_2.2.5                    o 0t0 q0 {   !   Q Pb b b b   # a @A ' A 2 A =  H S ^ ii i s ~ ii  ii ti ui  %%`%p%%%%uX%F$%x%t%u%u0%H%P%%w%%u %8%p% %%H= (%u`%Hx%L%p%N%u% P%h%w%Ф%v%@%v%p(%@%X%(Hh%9v%%v%1v%0%G%7v0%pH%>v%Hv%%ev% { %H8%HnH%>Cp%@%v%ȫ%v%v%(%v8%v`%x%v%%v%>C % %vP %h % wx %%w % % %>w % !%Fw!%>w@!%8X!%Qh!%\x!%_!%Tw!%!%!%^w"%uH"%pw"%w"%"%w #%X8#%wp#% #%w#%#%w#%w$%($%w`$%x$%w$%˄$%$% x%%%%%xP%%(h%%8x%%x%%Ox%%@&%@x@&%X&%0&%P&%hx&%`&%x0'%H'%x'%x'%@'%x (%8(%xp(%P(%(%(%x)%8()%x`)%x)%y)%)%y)%.y*%*%P*%h*%@*%h*%Iy*%+%@+%X+%ayh+%r!+%H+%vy+%y+%+%y,%r!0,%8H,%y,%p,%y,%(,%y -%8-%yH-%p-%-%y-%(-%.%(.%y`.%Hx.%z.%.%#z.%ǥ!/%/%6z(/%RzP/%h/%Zz/%/%hz/%0/%P0%}z@0%X0%z0%0%z0%0%z01%H1%z1%H1%z1%1%{ 2%82%{p2%2%2{2%H2%G{3%x(3%`{`3%x3%q{3%3%{4%P4%{P4%ph4%{4%4%{4%5%{@5%X5%{5%p5%{5%˄5%5%|06%H6%R6%6%|6% 6%%|6%6| 7% 87%B|H7% p7% 7%S|7%8 7%` 7%8%H(8%i|`8%x8%p|8%H8%9%p9%w|P9%h9%|9%`9%|9%:%|@:%HX:%|:%x:%iw:%Lv :%:%0;%H;%|;%|;%;%p;%|;% <%8<%|H<%p<% <%w<%<%|<%<%=%(=%Y`=%Hx=%|=%0=%=%=%|>%>%}P>%(h>%}>%X>%!}>%?%'}@?%X?%,}h?%Ծ!?%p?%2}?%?%F}0@%H@%@%P@%M}@%O@%WU8A%^}A%o}A%}A%}A%}B%}(B%}8B%}HB%}`B%XxB%}B%}C%C%}hC%~C%~C%'~C%5~C%D%H~@D%XD%_~D%(D%k~D%{~D%~0E%`HE% E%~E%H E%~E%~F%~ F%!8F%~pF%%F%F%&F%-F%&F%FF%lF%]G%X)(G%(,`G%P,xG%vG%G%-G%H%hH%H%.H%H%.I%@I%/XI%I% 0I%I%uI%1I%J%2J%G0J%3HJ%XXJ%mhJ%J%85J%J%J%J%5J%ЀJ%K% K%68K%HK%7pK%7K%%K%9K%8K%<K%9L%09(L%Q`L%h9xL%hL%:L%L%L%M%;M%(M%Ձ8M%PM%P=hM%xM%M%*M%=M%=M%VM%nM%>N%N%7@N%?XN%hN%9N%h@N%N%9N%@N%O%ׂO%0O%@HO%XO%9O%PAO%O%AO%$O%5P%E P%B8P%RHP% {pP%BP%cP%FP%wQ%XG(Q%rHQ%`Q%(HxQ%Q%JQ%R%KR%PR%8MhR%R%OR%ƃR%PS%݃@S%QXS%hS%S%QS%S%pSS%0T%8THT%'T%TT%7T%HUT%X U%U8U%HpU%XU%dU%^U%zV%aV%@b(V%`V%bxV%V%xcV%V%˄W%eW%(W%ʄPW%ehW%τxW%@ZW%iW%W%W%HpX% X%i8X%p@X%8qXX%%X%xqX%CX%`sX%t0Y%tHY%_Y%vY%|Y%8xY% Z% z8Z%pZ%`{Z%ÅZ%~Z%Ѕ[%~([%ۅ`[%8x[%[%[%[%\%`\%#P\%hh\%\%؅\%3\%X]%I@]%X]%\]%]%w]%]%0^%PH^%X^%^%^%^%^%Q8_%_%_%Ɇ(`%ӆx`% L`%Qa%(a%Pa%Hha%a%ha%a%ua%Еb%@b%@Xb%b%hb%(b%b%;c%u0c%XHc%1Xc%!c%c%Ec%c%N d%8d%Upd%0d%ed%d%~d%e%X(e%8e%`e%xe%e%e%e%‡e%f%8f%؇(f%Pf%hf%xf%0f%f%f%f%ذg% g%@g%PXg%hg%g%g%%g%hg%Ȳg%6h%?0h%@Hh%GXh%h%h%Ph%Hh%h%}h%a i%8i%Hi%pi%i%i%8i%i%{i%j%(j%8j%`j%xj%j%j%Xj%j%Ɉk%k%Ј(k%ވPk%hhk%xk%k%k%k% k%Xl%l%%@l%Xl%5hl%l%`l%Cl%?l%l%Qm%0m%`Hm%_Xm%pm%m%am%m%xm% n%8n%pn%8n%‰n%n%ؾn%щn%(o%މ8o% `o%Hxo%o%Xo%xo% o%p%xp%(p%$Pp%hp% xp%p%p%Kp%Bp%Up%q%e@q%Xq%q%Xq%nq%q%x0r%Hr%r%Pr%r%Ps%] Xs%P hs%Щ xs% s% s% s% s% s%@ s%P t%Z t%P t%P 0t%0 8t% @t%` Ht% Pt%Ћ Xt%` `t% t% t% t% t%  t%0 t%@ t%p t% t% t% t% t%0 t% u%` u%s%@u%@s%pu%Pxu%u%Ju%u% u%u%fu%Kv%Pv% v%J(v%Xv%`v%fhv%Kv%@ v% v%0 v%P v%0 v%p v% v%p w% w% w% w% w% @w%0 Pw%P Xw% `w%P hw%p xw% w% w%p w% w% w%PJw%Xx%`Jx%Lx%j8x%d@x%eHx%Jx%pJx%^x%Jx%@rx%gx%dx%@fx%Kxy%y%}y%y%y%z%z%z%z%|z%P{%Ph{%%P{%.P{%JP{%VP{%_P{%mP{%xg|%~P(|%P@|%PX|%Pp|%g|%P|%g|%g|%P|%P}%P}%P0}%PH}%Q`}%Qx}%h}%/Q}%KQ}%WQ}%hQ}%Q~%Q ~%Q8~%QP~%8hh~%Q~%Q~%Q~%Q~%u~%pf~%f%f%g(%ǎ@%ӎX%܎p%܎%ӎ%%0%H%`%x%%%'(%@%X%p%.%:%%Ё%B%L%%T0%hH%`%x%%%%̏؂%܏%% %%%؆%% %`! %0(%P'0%08%@%1H%2P%7X%`%h% %B%@E%O%д%%%0%%ȇ%Ї%؇%%%@% %M(%M0%@%0P%0Ј%؈% %P%%%0%@%B%A %(%0%@%MP%`%лp%0%&%%H%p!%N %pS %pS %U %U % %U %pS %U Ȋ%pS Њ%pS ؊%pS %N %pS % % % %Y %0Z %Y %V (%pS 0%pS 8%pS @%N H%U P%U X%x `%V h%pS p%U x%pS %pS %V %Z % V %N %l %0V %X %X ȋ%`W Ћ%pS ؋%pS %@V %Z %PV %m %N %`V %W %PX %W (%pS 0%pS 8%pV @%V H% P%V X%V `%T h%X p%pS x%V %pS %pS %V %[ %V %`[ % [ %[ %] Ȍ%@Y Ќ%pS ،%pS %pS %pS %\ %pS %`\ % \ %pS %\ %pS (%pS 0%pS 8%pS @%V H%] P%W X%`] `% ] h%U p%pS x%pS %pS %pS %pS %pS %pS %pS %pS %pS %pS ȍ%pS Ѝ%pS ؍%pS %pS %pS %K%%% % (%0%$8%0@%<H%DP%LX%Y`%bh%qp%x%%%%%%%%%% Ȏ%Ў%+؎%8%E%O%\% % % (%p 8% H% P% X%p `%p h% p% x%@ % % Џ%( %4 %L 0%L P%X p%X %d %d А%p %p %| 0%| P% p% % % Б% % % 0% P% p% % % В%$ %$ %$ 0%< P%H p%T %` %l Г%x %x % 0% P% p% % % Д% % % 0% P% p% % % Е% % % 0% P% p%, %, %8 Ж%8 %u%%u%u%8%u@%uH%h%up%ux%%u%u%ȗ%uؗ% % %u%%u %=(%0%H%=`%h%p%%%˄%( %3Ș%(И%4ؘ% %3%%Ծ!%x (%@%)H%P%?h%)p% x%O% % %Oș%0 Й% ؙ%O% % %O(%0 0% 8%OX% `% h%O%0 % %O% % Ț%O%0 %%y%O(% @%H%yP%Oh%0 p%x%O% %%Oț%0 %%%O%  %(%0%OH%0 P%VX%Ox% %V%O%0 %Ȝ%JМ%Y؜%O% %%J%Y%O8%0 @%H%bP%mX%Ox% %%b%m%O%0 %!ȝ%O% %!%O%0  %(%0%OH% `%h%p%O%0 %%~ %OȞ% %%~ %O%0  %>(%6!0%E8%OX% `%>h%6!p%Ex%O%0 %r%6!%y%O؟% %r%6!%y%O%0  %b(%6!0%i8%OX% `%bh%6!p%ix%O%0 %6!%OȠ% Р%6!ؠ%O%0 %s%%O(% @%sH%P%Oh%0 %a%%O% %aȡ%С%O%0 %V%O%  %V(%OH%0 P%ZX%Ox% %Z%O%0 %MȢ%SТ%O% %M%S%O(%0 @%CH%QP%Oh% %C%Q%O%0 %!ȣ%8 %%Ծ!%x % %)(%0%?H%)P%FX%Ox% %F%O%0 %%Oؤ% %%O%0 %;%O8% @%;H%Oh%0 p%EVx%O% %EV%Oȥ%0 Х%0إ%O% %0%O(%0 0%u8%OX% `%uh%O%0 % %+> %OȦ% % %+> %O%0 %U%O8% @%UH%Oh%0 p%EVx%O% %EV%Oȧ%0 Ч%Cا%O% %C%O(%0 @%H%~ P%X%%%D%pi%E%K%D%M%% %Z % 8%0Z @%P H%@ %Q%%(ة%%%! %@%Y P% X%М `% h% p%Pz x% %`| % % %Y % %| % z 0%p 8%` @% H% P% X% `%0 %8 %@%%-% %%%%uȫ%%Ы%Ч%ث%u%%%%%u%%%p%%u(%`%0%@%8%uH%0%P%%X%uh%%p%%x%u%%%%%u%%%`%%uȬ%P%Ь%0%ج%u% %%%%u%%%Х%%u(%%0%%8%uH%%P%p%X%uh%`%p%@%x%u%0%%%%u%%%%%uȭ%Ф%Э%%ح%u%%%%%u%p%%P%%u(%@%0% %8%uH%%P%%X%uh%%p%%x%u%%%%%u%`%%@%%uȮ% %Ю%%خ%u%%%%%u%%%%%u(%p%0%P%8%uH%@%P% %X%uh%%p%%x%u%%%%%u%%%%%uȯ%`%Я%@%د%u% %%%%u%%%Р%%u(%%0%%8%uH%%P%`%X%uh%P%p% %x%u%%%%%u%П%%%%uȰ%%а%`%ذ%u%P%% %%u%%%%%u(%%0%%8%uH%%P%`%X%uh%@%p% %x%u%%%%%u%%%%%uȱ%%б%%ر%u%p%%@%%u%0%%%%u(%%0%%8%uH%%P%%X%uh%p%p%P%x%u%@%% %%u%%%%%uȲ%%в%%ز%u%%%p%%u%`%%@%%u(% %0%%8%uH%%P%%X%uh%%p%%x%u%%%`%%u%P%%0%%uȳ% %г%%س%u%%%Й%%u%%%%%u(%%0%p%8%uH%`%P%@%X%uh% %p%%x%u%%%%%u%%%%%uȴ%%д%`%ش%u%@%% %%u%%%%%u(%%0%O8%uH%З%P%OX%uh%%p%%x%u%%%p%%u%`%%@%%uȵ%0%е%%ص%u%%%%%up% x%ж% ض%.0%` 8%P.% %.%@ %.P% X%.%h %%i %p%G x%8/й%`j ع%x/0%0k 8%/%PH %%c %P%H X%/%pI %0%@S %80p%S x%`0м% ؼ%00%l 8%%%m %0%g %0P% X%1% %(1% %`1p%, x%1п% # ؿ%=0%@ 8%1%01 %Z% %2P% X%@2% & %2% %2p% x%3% %@30%  8%3%` %3% %4P%1 X%@4% 2 %4%2 %4p% = x%t%@? %0%@ 8%5% %85% %x5P% X%5% %6% %@6p% x%x6%p %60% 8%7% %P7% %7P% X%7%p %(8%0 %p% x%8% %80%A 8%8%B %9%P %(9P% X%P9%pT %%2 %p% x%9%P %90%0- 8%:%a %%@L %P%`M X%@:%N %h:%O % p%: x%:%0: %:0%: 8% ;%p; %p;%p; %p;P%r X%'% s %;%`s %Np%s x%b%s %s0% t 8%%`t %%` %;P%p X%% %<% o %p% x%@<%0R %x<0%J 8%% K %<%@ %<P% X%=%3 %@=%# %x=p%4 x%=%t %0%t 8%% u %=%`u %0P% X%=%` %I%@ %p%9 x% >% %[0% 8%a% %v%P( %P>P% ) X%>%0 %%! %>p%' x%%8 %?0%@' 8%@?% %=% %x?P% X%?% %?%`- %?p%`- x% @%0 %0%9 8%P@%: %@%! %@P%! X%A%0 %%C %8Ap%@^ x%%@_ %`A0%` 8%I%` %%P %[P%0 X%=%@` %%`D %p%D x%%E %A0%F 8%4%` %J%G %`P% g X%x%P$ %A%( %Ap% x%B% %B0% 8%8B% %`B%+ %BP%`- X%?%`- %B%`- %Bp%`- x% C%`- %0%@0 8%XC%0 %%`1 %P%`- X%C%0 %%` %Cp%`/ x%C%/ % D0%* 8%PD%) %D%0 %DP%` X%%- %E%- %(Ep%4 x%XE%5 %E0%. 8%%P7 %E%@6 %EP%@. X%(F%+ %PF%+ %Fp%`% x%F%03 %(G0%P 8%hG% %G% %GP%P X%G% % H% / %pHp%$ x%H%p- %H0%% 8%(I%/ %PI%0 %P%P X%xI% %I%` %@Jp%P x%J% %J0%P4 8%K%p %@K% %pKP&U X&K&V &K&W &Kp&\ x& L&Z &HL0&u 8&pL&X &&p[ &LP&0\ X&L& v &L&v &Mp& w x& &w &8M0& x 8&pM&x &M& y &MP&y X&M&d &0N&p] &XNp&`- x&N&`- &"& &N& &NP &P X &@ &`-  &\p &P x &q &P &{0 &P 8 & &P & &P &P &P X & &P & &P  &p & x & & & H&ƒP&X&Y h&p&,x& Y &0&,&0Y &K&,&0Y &PO&,&0Y &h&x&@Y &|&x&PY (&0&8&`Y H&P&X&pY h&up&u&&&Y &u&u&&l!&Y &u&u&!&0&& &F$(&88& H&uP&p`& p&ux&8& &u&& &u&u&&u&u&&v&(& 8&!t@&P&`&Nh& vx&`g&t&)v&P&Av&&&t&Kv&&iv&H&h(&sv0&8@& P&(X&}vh&x&v&&PF&v&v&g&v&v& h&v&&y&t &0&j@&+H&(X&0Lh&vp&v& P&t&w&P&&X&`&w&&L&$w& &0&-w8&H&X&&`&p&`&2w&8&h&9w&p&&!&&@I&Cw&&0 &Lw(&Uw8&H&owP&`&p&swx&zw&_&w&w&@`&w&@&k&N&&`&gs&(&p8&w@&ОP&4`&wh&x&&w& &&w&@&P&w&p&@i&&&w&(& x0&@&0/P&xX&h&x&x&& &&x&&&/x&=x&p9&Yx&H&T&ix &qx0&l@&xH&xX&{h&xp&&&4&x&&x&x&&x&&&x&x & 0&x8&H&&P0&x&&8&`P&&8&(&p&&`&H&&@&( &h&&&H@&&x&y &` &6y &H &8!& !&!&Qy"&X"& "&P"&0#&x#&#&$&P$&$&$&P(%&p%&p%&@&&(H&&&&8&&P '&h'&h'&'&p@(&(&jy(&P)&`)&)&)&8*&*&8*&P+&X+&`+&+&0,&{yx,&@,&-&P-&-&@-&(.&0p.&.&h/&H/&@/&/& 0&h0&0&0&`@1&(1&1&`2&`2&H2&2&883&x3&(3&(4&X4&P4&4&x5&5&6&@P6&(6&6&((7&p7&7&H8&HH8&8&8&H 9&h9&h 9& 9& @:&p :& :&;&@`;&y;&h;&X8<&<&<&=&X=&=&=&`0>&x>&>&X?&P?&x?&!?&y(@&H$p@&jy@&P&A&`)HA&)A&)A&* B&*hB&+B&,B&0-@C&h.C&.C& /D&`0`D&0D&1D&p18E&yE&2E&5F&6XF&P6F&6F&60G&7xG&`7G&8H&9K&x;@L&DL&FL&@GM&G`M&HM&(IM&jy8N&JN&LN&0MO&MXO&PNO&hOO&OxP& PP&QPQ&yQ&QQ&RpR&0SR&SHS&SS&VS&0W T&0WhT&hWT&x_T&y@U&`U&8cU&pcV&c`V&@eV&eV&f8W& mW&mW&nX&oX&0oX&r0Y&sxY&`tY&tPZ&uZ&vZ&vp[&w[&@x\&{H\&(\& ]&Єh]&]&]&@^&^&p`_&_&x_&8`&ؑ`&8`&ha&za&zb&z0b& Xb&zb& b&b&z c&0Hc&"zpc&pc&%zc&@gd&@g`d&@gd&@ge&e&@ge&,ze&f&Fz@f&hf&Mzf&f&xf&g&Vz0g&Xg&qzg&@g&zg&g&{z h&Hh&zph& h&zh&@h&zi&8i&z`i&i&zi&i&zj&`(j&zPj&pxj&zj&j&zj&pk&z@k& hk&WUk&@gk&k&l&Ж0l&`Xl&0l&l&zl&l&{ m&Hm&!{pm&pm&{m&m&?Kn&p8n&h`n&Pgn&6{n&n&A{o& (o&N{Po&xo&b{o&@o&o&0p&@p&hp&p&Pp&y{(q&l8q&`Hq&Xq&0hq&Pxq&0q&Pq&0q&q&0q&lq&`q&lq&q&$r&p r&lr&r&$pr&xr&r&r&Ps&Phs&%Ps&.Ps&JPs&VPs&_Ps&mPs&xgt&~P(t&P@t&PXt&Ppt&gt&Pt&gt&gt&Pt&Pu&Pu&P0u&PHu&Q`u&Qxu&hu&/Qu&KQu&WQu&hQu&Qv&Q v&Q8v&QPv&8hhv&Qv&Qv&Qv&Qv&uv&v&Pw&pw&P(w& 8w&Hw&Xw&@hw&xw&Pw&w&w&w&t w& w&PLx&Mx&D(x&E8x&IHx&@DXx&0Ehx&0Exx&0Nx&x&x&x&px&px&x&x&y&0y&`(y&`8y&@Hy&@Xy&hy&xy&oy&oy&py&0ny&0ny&y&0y&0y& z& @z& @(z&pJ8z&lHz&@LXz&lhz&Pxz&qz&@lz&plz&oz&z&z&0z&0z&p{&d{&\({&`g8{&`gH{&`gX{&`gh{&`gx{&`g{&`g&(& ; &? &ȁ&uЁ&u&> &> &!&> &@ &@ (&8&@ @&3P&"@ X&th&3@ p&)!&D@ &ku&V@ &gu&a@ &OȂ&j@ Ђ& &|@ &> &HQ &@ (&P^ 0&@ @&^ H&@ X&^ `&@ p&_ x&m&@_ &@ &p_ &&_ &@ Ѓ&_ ؃&l&` &@ &8` &/ &h` 8&&&&u &&P&X&0&u@&@&H&@&P&P&X&P&`&`&h&`&p&&&&&&0 & &(& &0&0&8&0&p&&&u&u(&(&0&(&H&H&P&H&X&X&`&X&h&h&p&h&&&&&H&u&&&&&&&&&&ȸ&&и&и&ظ&и&&&&&&u& r&H&&&& &&&&&0&0&8&0&H&u&&&&&&&&&&ȼ&&м&м&ؼ&м&&&&&&u@&@&H&@&`&Ev h&Kv p&ux&Ov &Xv &I&\v &fv &ʏ&jv &tv &&xv Ƚ&v н&ؽ&v &v &!&v && &v &v &v &v (&v 0&'w 8&v @&v H&DP&v X&v `&'h&v p&v x&Q&v &v &$r&v &w &o!&v &v &k Ⱦ&Ov о&Xv ؾ&I&\v &fv &ʏ&jv &tv &&xv &v &(&v 0&v 8&!@&v H&w P& X&v `& w h&v p& w x&w &>&&w &%w &:&&(&u8&uh&h&p&h&&&&&&&&&&&&&&&F&O&P&Z&]ȏ&_Џ&؏&&&X&`&h&p&x&&&&& & & & & &Ȉ&Ј&؈&&&&&&&&& &(&0&8&@&H& P&!X&"`&#h&$p&%x&&&'&(&)&*&+&,&-&.&/ȉ&0Љ&1؉&2&3&4&5&6&7&8&9&: &;(&<0&=8&>@&?H&@P&AX&B`&Ch&Dp&Ex&G&H&I&J&K&L&M&N&Q&RȊ&SЊ&T؊&U&V&W&X&Y&Z&[&\&^ &`(&a0&b8&c@&dH&eP&fX&g`&hh&ip&jx&k&l&m&n&o&p&q&r&s&tȋ&uЋ&v؋&w&x&y&z&{&|&}&~& &(&0&8&@&H&P&X&`&h&p&x&&&&&&&&&&Ȍ&Ќ&،&&&&&&&&& &(&0&8&@&H&P&X&`&h&p&x&&&&&&&&&&ȍ&Ѝ&؍&&&&&&&&& &(&0&8&@&H&P&X&`&h&p&x&&&&&&&&&&Ȏ&Ў&؎&&&&&&&&& &(&0&8&@&H&P&X&`&h&p&x&&&&HH%HtH5"%%#%hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhq% %D% %D% %D% %D%} %D%u %D%m %D%e %D%] %D%U %D%M %D%E %D%= %D%5 %D%- %D%% %D% %D% %D% %D% %D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%}%D%u%D%m%D%e%D%]%D%U%D%M%D%E%D%=%D%5%D%-%D%%%D%%D%%D% %D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%}%D%u%D%m%D%e%D%]%D%U%D%M%D%E%D%=%D%5%D%-%D%%%D%%D%%D% %D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%}%D%u%D%m%D%e%D%]%D%U%D%M%D%E%D%=%D%5%D%-%D%%%D%%D%%D% %D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%}%D%u%D%m%D%e%D%]%D%U%D%M%D%E%D%=%D%5%D%-%D%%%D%%D%%D% %D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%}%D%u%D%m%D%e%D%]%D%U%D%M%D%E%D%=%D%5%D%-%D%%%D%%D%%D% %D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%}%D%u%D%m%D%e%D%]%D%U%D%M%D%E%D%=%D%5%D%-%D%%%D%%D%%D% %D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%%D%}%D%u%D%m%D%e%DH% HN`LO1ɺIH51H%H %L H% %L H%h H% %T H%p H% H% %T H% %L H% H% H% H% H% H% H% H% H% %L %L H% H%P H% H% H% H% H% H% %L H% %L H% %L H% H% %T H% H% H% H%X H% H% H% % H% H% %( H% % H% H%` H%h H%h H% H% H% H% H% %T H% %( H% % H%X %T H% H% H% H% H% H% H% H% H% H% H% % H%X H% % H% H% H% % %( H% H% % H% L% H% l\L]1ɺIH51%L %L H% L$% H% H% %T %T %T H% %L % H% H% %L %L %L %8 %L %( %P %P H% %L H% H% H% H% H% %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L HD$`HD$hHD$`%L H% % H%0 H% H% H%0 % %< %L % %L % H% %L %( 1L %8 %L %L %L H% H% HD$ H% H% H% H% H% %d L,% H% H% H% H% H% H% H%h H% %H H%h H% H% H% %L H%X H%X H% %< %@ %D %p H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% %T H%X % H% %H H% H% H% H% H%0 H%  H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% %` %0 H% % H% %Y %X % H% % H% H%0 H% H% H% H% H% % H% H% H% % % H% H% H% %L H% H% H% H% H% %L H%X H% H% H% H% H% H% H% H% %L % H% H% H% H% %L H% H% %L % H% H%h H% H% H%h H% H% H% H% L% H% H% H% H% H%h H% H% H% H% H% H% %  H% H% H% H% H% H% H% H% H% %L H% H% 1QfH% % H% %L H% H% H,% %  %L H% H% H% H% HD$ HD$(HD$ H% H% H% H$H% H% H% H% H% H% %L H% H% H% %L H% H%` H%` f.D6%P6%tD %%AVAUATUSEt!Lm\a H5\3%螰H=?6%HtH=v6%H#6%HtL5*6%H-3%HH6%LH9m^1L%I9L9\L%H%H9t=L->9DHIs e1MLq%HXZH9uLiLL\1@%F%[5%]A\A]A^LfUH=?Ht .8H=wo$HHtH5fHsu E$]H5HTtH5zuHAu$]$]DH=#%H#%H9tH$Ht H="%H5"%H)HH?HHHtHU$HtfD="%u+UH=2$Ht H=Nx#id}"%]wAWAVAUATUSHdH%(H$1HHLL9HD$1Ld$@H$L5DHCA龀LHPPL@H1HLPIH/LHHPLL赸Lt~ɿu]LH-z膗1L`1ɺ Hy1H$dH+%(H[]A\A]A^A_fDH4$L輗LueDH-f$LL蟵Uf.L1ɺ H-1HA軖T$uSHL93f.1Lj1ɺ H5h1D$ uH/LHD$SLD$HtQLHPL*LD$LDžLD$0H|$AE7H-XfD$LLLD$bLD$L1ɺ G\ uAATUSHt[]A\HGPHL iHLFt[]A\H][]A\ff.@AWIAVAUIATUSHHFH@ H@`HtH|$H|$AIEtnLHI9t[Il$HHŰH9t,LHH|$pH|$AHH9uIEM$$HI9uHHt @\AUL1ۅuA9]LH@IHЃ8uHHPHHH9ufH6H9tF 9rF$9sLH|$H|$AuL1ɺM1H5GfDH-1ɺ_1LtHL`11<HwHD[]A\A]A^A_DAዀHFH@ H@`HH|$LH|$AL1CH5{LK11H5RfAWAVIAUATAUH-%SHH8HFPH|$ HHt$DE1HD$IIcHH H r#HHzLHH1IPH5m1L#Lc Y^MIGHD$(kfI\$<@HD$L|$HH@PLHHuB;G$uE1HD[]A\A]A^A_DHIE1E1j11HjjH tHL5Z0L3LI1HEPHH8? HHE1E[tE1HAH% uHEPHUH1H;H6IHH;1H HHHE1E1LAWH hHjATAɕ H H;腼HH HhXhḺ1ɺ1LfDL1ɺ 1H5Dz跴L1ɺ1LE1藴efL\1ɺ 1H5oDL41ɺH5TIAWLAVAUATIUSHH(HLD$I9t"H1fHI9u$uE1H(D[]A\A]A^A_DHE1E11j1LjjH tLL5y-LLI1rID$PHH8ɕ IHjI$I9uH@LH@(HD$w_IT$HI}IID$PLLD$H貼LD$HI0I}LLB H;HD$H1LͰAWLL$ LֹLi.袲MAL$LAt$SHL$0HT$8 H Lpt:I}轹yI9wyLQAM1ɺ2LֿLLݮ1ɺ1LE1I}HL1ɺ1LƱL1ɺ)1H5蠱Lj1ɺ,1H5}gAWAVAUATIUHSHhdH%(HD$XHGPHH8袓 L1ɺHHH`]H; IиHfLH@I$H;: LJHHHt$ jE11jE1ɿ jj H 1ɺMILaHt_Dt$ EHctH;˷HD$XdH+%(oHhD[]A\A]A^A_DI$L1ɺGH5)1H;oL۬1ɺH5٬1E1{fDHL=ܭ!*RLIL1讯IUH!LrHT$MH5YLŅtBHX1AVL 2LLbML5sXZ'fDHT$LD$H;HrLHI$HHT$HJHPHRHHtSH9HfH*HfH*^Y ,DhLAzrDL5"@1ɺ`LL-UL=r1fHʃfHH H*XQfHփfHH H*XMCAUATUHSH $dH%(HD$HGPH8u(E1HD$dH+%(HD[]A\A]HHE1E1j11HjjYH tHEPHL-1LLLuH1(XZHHAąt$H$AHPH8HR@HWEfL1ɺ1LӬ!)fAWAVAUATUSHHdH%(HD$1HGPHH8g$u3E1HD$dH+%(6HD[]A\A]A^A_f.HHE1E1j11Hjj!H tHL-j&LLI,1HH|AąL4$IFLx0LL`HCPLHHx膳Ht)LLHAHEI> @HE1L1LE4E1`fDL$1ɺ01L;AUATUHSHdH%(HD$1HGPHH8$u'E1HD$dH+%(HD[]A\A]fHHE1E1j11HjjH tHL-~$L3LI\1wHHAąt%H$AHPH8HRH許OL 1ɺ`1L#*yfAWAVAUATUSHHdH%(HD$1HGPHH8$u3E1HD$dH+%(>HD[]A\A]A^A_f.HHE1E1j11HjjqH tHL-N#L+LIs1GHHAąL4$IFLx8MtXL8L`HCPLHHxѰHt,LLHAHEI><HEL1ɺ}1LE1訨fDLl1ɺw1L胨ٽfATUHSHGPH88$u41E1L.H5-D[]A\DHIE1E1j11HjjH tHEPHH8Q HHHTHE[H;H LHHjE1E11j1jjq H HHHx`xL HE`HHkAąAH"kH;芮D[]A\fHE1e!L1IH51@1E1L1ɺH5ĦD[]A\@L1ɺH51E1蔦]LT1ɺ1H5wg(sAąL1ɺ1H5A1ff.AWAVAUATIUHSHhdH%(HD$XHGXH-H2HEPHH88 L1ɺHHEHQH;HH LdHHHt$ jE1E1j1ҿ jjQ H IHD$ LD$)iH;葬D$iHH9HHhHEXH2H;LzI1H5Ĥ1HT$XdH+%(Hh[]A\A]A^A_HL=LILJ1fIUH9HjHT$H'H5ĂH訹AƅHT$LD$H;HrL4H; ϫHNf@I$HHHT$HPH@L@gf.Ll1ɺH51H;תLC1ɺ1H5?V1HLIPH-¬H1UL LLLfXZ_fD1ɺLL轢Lf1Hr0HJ HzLBM $HHH9fHfH*HfH*^Y,AADpHMI9MfI*HWfH*^YG,=DAAHuWEqLeI$1L1Le胡LkeAAHB(HtH9HmfH*H=fH*^YD,EVADDD@HMAA@H1MIfII I*XHHfHH H*XLAfHL H*XcIIfIAM I*XdAAMAA?HȃfHH H*XHƒfHH H*X~AAff.fAWAVAUAATIԺUHSHhdH%(HD$XHGPHH8ρ L+1ɺ(HH8HHfH@HI$dKH;HHf LқHHHt$ jE11AUE1ɿ jj H 1ɺILHt[Dt$ EHbH;HD$XdH+%(8HhD[]A\A]A^A_ÐI$L41ɺH5Y1GH;蟥L 1ɺ-H5 1E1fDHL= QLIL1ޝIUHLrHT$MH5ޛL ŅtBH 1AVL LL}LeaXZ'fDHT$LD$H;HrL_7HI$HHD$HB@8t.HBLAa|L5Z@Hp HxHtZ1HtSH9HNfH*HfH*^Y,ȅ9DΉJHPI $H@HHtOH9HfH*HxvfH*^Y,DiLA`{f1ɺ&LL͘L_HЃfHH H*XuHƃfHH H*XIHfHH H*XHfHH H*X-覰fDAWAVAUIATUHSHXdH%(HD$HHGPHH8r} HHH>GIE[H;LH3 HHHt$jE1E1j1ҿ jj H IHDt$EunLv^H;ޡHD$HdH+%(HXD[]A\A]A^A_HaHEP5$L0E1DDHL=aL:LI1ID$HHx LpLHLL$MH5L LL$Mt*L1LLL$H5ؗLL$AHLL$HL׸PLL$1L=L%]XZfDHpEHE1E1jH1HjLHD$(P9 H 0L$H LIL1識L\Lq1ɺV1H5mE1聘@LD1ɺR1H5@E1TLH5;1)E1HeHMLWPL1ɺ1H5ߕϗ%f.1ɺE1L}H5螗@ATIUHSHWXHGPH HHH8y HLHHHQ t-LHH: AtXH;xD[]A\Lܓ1ɺH5L1ɺ1H5E1͖L1ɺH5詖1E1Lg1ɺH5e|D[]A\@AWAVAUIATUHSHHHWXHGPDfH HH8Hx HIIEPL8L蟋H1HtLL5CEL1HLAF AŅt4AFAEI>DcHD[]A\A]A^A_f11LhH5LK11H5G^@L$1ɺ1H5 E14tff.@AUATIUHSHW tAHD[]A\A]I<$H(IHtH tLHH-HHLNSIH1膔It$XLZIT$AądL31ɺ1HJHDAVAUIATIUSHGPL0L覉H1HtLL[D]A\A]A^@11LXH5oL;11H57N@1E1L1ɺH5 $[D]A\A]A^AWAVAUATUSHHD%׿$dH%(HD$81ELHHE1L-L9L|$ M6I9txI~ tDt$M^H;EH֐LHT$ HLHT$I1L>RCM6Y^I9ufH1ELL(XZHD$8dH+%(utHHD[]A\A]A^A_HE1E11jLLjjL\$(H L\$t1|$A=q$HPئAWAVAUATUSH8D%7$dH%(HD$(1EHLHE1L5I9t^IfHL9tHH{O tDԽ$HsH}EuL1ɺ1LʐHL9ufH1E%LL蓐XZHD$(dH+%(uRH8D[]A\A]A^A_HE1E1Lj1jj>H [L$1A芥f.HdH%(HD$1D$F@t!HF H@XHt51HT$Ѕt(D$t!HT$dH+%(u4H1L7H5}蔏1ff.UHSH85M$dH%(HD$(HGPH8u\HH HL%SI1H5X1ZHT$(dH+%(uSH8[]fDHHE1E1j1HjjH A$Eu $jHe ff.fATUSH@dH%(HD$8HGX@ H%HH/HCP'$L H:HE1E1jH1HjLHD$P0. H tX$tqHYuH= H-AątnAHD$8dH+%(H@D[]A\L|1ɺH5u葍HAtHy@HLߋ IH5$19H]`{3 HfDH@#HH#CXJf.UHSHHH9t9HCHxHGX@u uHuHCHxuHH9u1H[]DHCHxLP IH571LHCH@H[]ff.fAWAAVEAUIATUHSHHzIHHHtbL*HtHLbLLuKDLDL՚HL[]A\A]A^A_1HpHHDL<1ɺ[1H58OLE1脙fL 1ɺU1H5DL1ɺX1H5DL1ɺO1H5ϊ%f.ATUSHH $H1dH%(H$1Ho8/HH`HL$1IHLۇuF1ҹHLTHtGLH$dH+%(ukHĠ[]A\HLEufDƄ$fD1ҾHnH`HHJL$c@AVAUATIUSAHIHHIL5I}HH踜 L$1ɺHHt`A1LLHHt71HtYAuvHF[D]A\A]A^f.L1ɺ1E1H5̈[D]A\A]A^H(t A%ALd1ɺ1H5`E1ta1L21ɺH50G[D]A\A]A^ff.AWfAVIAUATAUSHH|$L$dH%(H$1)$D$\D$XDŽ$)$)$)$)$)$Ht BIՉ$R$ED$L$u $$D$IFXH.r H/2IIH9ǸHDH H@@] EL?HL RL(PH51軆Y^D$H$dH+%( D$H[]A\A]A^A_@1L#2H5&\$D$L1ɺ1H5)D$k@HH9AUt AF\ ( EtL IHtxAF\uqA AEuLa HsH|$D1_D$LO1ɺKH5HdAED$HMIHD$(I9tQMtLIHtKHHH9t8Ht3H@@t)H|$1D ML9|$(B1EHL4$HD$0IDML|$L-HD$ HHEHD$&$$.AnL1ۅt#H@IHЃ8PA9^LwIHt7HT$ DLu#1ɺLL܀D$HIHt7HT$ DLu#1ɺLLD$HIHt1DLpIFHP€AF1 H@ H@pHEiInpHD$\D$X/IHH莖 HHA11LHH1HJH!D\$\ED$XH<$1ɺLIL߁1袂fM6L;t$( L4$DL$HED$ELEH>L -LDH1ɺPLH51-^_D$mfDL`HqL ЃDHp1DL1ɺxLL~āD$HoLZ12H5V茁 HL$\HT$XLHT$8HHL$ЅZT$\udL$XtdH<$1ɺLIL11#~fD1ɺLL}D$HXD$XIFHP Hzx5=g$HHHh0H<$HD1ɺLSIL1U茀IFD$AXAYH@ H@xEH1LЅ$uH$@^L|$@11Dd$LLd$8fIFHt$LLD$\H@ PpD$\(H<$,H1ɺt$ILS1LA_XS$uM$D$ވ gA/ $uU$'D t4L0|1ɺ1LL|$@Dd$L=D$HL|12H5|~InD\$HL|$@Dd$LE(DT$XED$D$H @H蠕HD$0Ht6H讎IHXHNHHt$0HHeHD$0HȎHD$X职\$\bD$X^HD$0H{8r$H,$HH|HHE<1ɺLSIL"}t$81}5Y$ZYIFH@tIVpHt$01A LAHD$XHD$8HD$\HD$1ɺLL-zL|$@Dd$LK}D$HL z1ɺm1H5zL4$}MLy1ɺL%y1L|IG@@I&H1ɺPL LL{@AUIFPD=v$H8E>HE1E11j1Ljj^H IIL8H9D$HH-yL4$MMELd$Hp1DL4I9SLM6MLx1ɺL%x1L{HIFPH8$HL$`HE1E1jLjj肸H \$hLHLSI8D$\%IFPHSyLHHx7HIq1ED$HbAEPL9L?IH5w1zD$ML~w1ɺIpHH H$H߅$(1ɺLL!wIzD$HMLw1ɺ#Lv1ɺ&H5vzQI~IH1ɺPL {Lߚ1ɺ[HLvyD$HEL4$M_ML4$IGHP HtHHtwLHLH1ɺSILL L%v1ɺg1H5!v8yD$HML;|$(NfHX(H<$Q1ɺLIL1xD$#/ff.@AUHǰATUSHL'I9AD$L1)fDI$HtH؃8tkA9l$LH@I$HH؃8uHx£AŅu1Lu1ɺ H5uxHD[]A\A]@HxAŅu1Lt1ɺ H5twHD[]A\A]fHA[D]A\A]ff.UHH dH%(HD$1HD$6.HD$H9t HuPHt$HtHD$HT$dH+%(u-H ]HL$H1H:1gATUHHdH%(HD$1HGPH$L -HL#tGHH1HAątdAHD$dH+%(HD]A\HALAo IH51s1Fv@HH<$L wHHtpIHu 1UL H5ruXZOHAWAVAUATIUHHSHdH%(H$1jID$X@u uLHH[Lg,D=P$fIID$X)D$`)D$pHH,)D$PH+D$pT$lEKHjHHLHJfÀ`MeXA'IIAIH9u?HH9dHPHzyL= L`IHUqHD$H1btHt$1L'q1ɺ Ct1[LHHoLHdH LDSI1H5psX1ZH$dH+%(HĘ[]A\A]A^A_I IEPH HILD$ fLd$ LLNDt$ Ey1LHNLTR\$ rIEPHLT- LInHoHD$L$Ht$1LI 1rHL$ HE1E1j1LHjjvH L$ tD$$u T$81LLd$P H5φHp LLH=LLHu"Ht$Ln11s qL!f! =$f1LݔH5}n1qIEPHxMeXAIIffMeXrHIUXHH!H9MH"H!EVLEt|E1+IHtH|"u0AE;fLsLDH@IHH|GYttLC L-IDD $ELAE]aLl$xL$ht$p|$lHrL=oDD$PL5oL%uHLDLLDLDEHDCAWLoAVIX ATHlSHHD$01oD $H EHt$Lpl11_ o#DLL 1ɺIH?lHD$H1LoLHHHHD$L4$L9*IMHD$fHD$I^I9IfM?M9IwHHuLk1ɺ1H52nnL& L]IMeXLD$hLl$xDM6L9t$:IEPLLH$HXM9t+MfDM6M9tIvHtuH$HH$H9D$uL.Ht$1LmI1mH9HhAuIHB[7 HJjL̑HD$H1UmLLl1ɺI IH5j1$m6Ht$Li1ɺo lH=Hob1HHtLHL$hvL+1H5llL LHI#EXIUXL$4H"r0H!r)H%r@u|$huHH H9LYHt$LkIg 1kLh1ɺH5:kkATIH5kUHHHdH%(HD$81賏 Lk"fHLHHH$HD$(D$D$HT$8dH+%(uHH]A\莀ff.ATIH5kUHHHdH%(HD$81# L!fHLHHD$HH$HD$(D$5HT$8dH+%(uHH]A\ATAUHHHHdH%(HD$81T!>$fH$HD$(D$D$tHHHAH='jHD$8dH+%(u HHD]A\^ff.ATAUHHHHdH%(HD$81 fHD$(HD$HH${$D$tHH7AH=iHHD$8dH+%(u HHD]A\~AV11LWiAUL-fL5 $ATUHSHLi=$uK ~IHH UtpI|$PL5$PL菾L,1HLH~HuHu[]A\A]A^D[]A\A]A^DLhH5h$hLe1ɺ1H5hh^$L1Ld1ɺh[1]A\A]A^fD+fATL%$USH$HteI9tQLH~fID$\IT$TH1L1H u#HVHFI3T$dI3D$lH u L[]A\@M$$I9uE1L[]A\@HI9tIt$HH|tM$$I9uE1ŐAUfATUHSH8dH%(HD$(1D$ )$)D$HDooVHH) $)T$wHD`DXH=a$DHމHHL`MHtMl$HHL|u"HD$(dH+%(H8L[]A\A]UIL1AU>H5f1IfHavHD`DH=$DHHHHtCL`Mt:IT$TID$\H3$H3D$H u"IT$dID$lH3T$H3D$H CDE16Ht5$tQ1HIHtπIL011ZH5eE1kefDHxuHD`DH=ʳ$DHHHYL`MLA${IP1L_H5Yed$H5e_H=v_lAVAUATUHHHtHH9HGPHLeHMtH5_LlHEH9ELL5$znLDhDDLLHHt H;hLeTL=nH=$LPHUHEH}HHBHnHmHmHmHH]A\A]A^m@H]A\A]A^@HWHPHHH?LmLLPZLDAUATUHwhHt)L-ȫ$MtLL\mLLPHuPHRHuXH~HP LeXI|$LHP L mH]A\A]lff.fAW@L=2]AVLG^LAUIATUSHHdH%(H$81\H=$H$HH9t,f.HGHCHplHHf$HH9uH=G$HP$H 9$HJ$HH8$HH9u +fDHHWHPHlHHH$H9uH$LH$Hۈ$VAąII9LAH$H9uR@L1L]Aw[H$8dH+%(-&HHD[]A\A]A^A_ù@uLMH$L\H$H$H$H$H$H$H$1ZID$tD$|HD$PH$H$H$H$H$DŽ$DŽ$HD$fHD$H$H$Ht$HL#HH9E1Lt$MMLd$"DH A$IELLI9^IMHCLHoouH HCHAHH$$H$L#HCH$H(H$L$E111LLL$L$pL9$ILL2L$11LLL$L$$L9$ILLD2hHHCHBHH$#H$HSL#HCH$LH(H$fMLt$1L莾f1Ҿ(LHD$)$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$)$)$ 3H|$H$H;D$s1M1LԃLWHD$HXhIP HC8H\$(HD$H%H9uHt$(L芿HH; H$0HmHqgHD$L$L;d$)D$4D$@Ll$8IIl$P HE8H%H9HLIHt L$HL;mLf1ۀ$$0 M$$L;d$tDL$@Ll$8EmDD$4E_H|$H\$HHt H9tLHL H$L1ɺH$0Lz}P1AU0V^_HD$HMHXhHL$H9;HHt H9L $H1ɺzLAULO}1UkZYHt:H$HL$HHm H$H$HPHHH$H$Ht$H9t5HL$f.H9tHPHHH9uHWHPHLeHtHHt H9L $HL|1ɺAUL1T]A\H|$1HLIHPc`H$L|LeH;l$u|4@LHH1L1AUTHUHEHLHBHdIAZ1A[HLHPc`L;d$L"|I$IH]HtHHt H9sL $kxL$L$0LLLD$ XiLD$ HEH|$HH9HHHD$HHH;D$H@=N$LHLCzQ1P1AULL$XYSH 1HLc0Hu8L8HHML$Lii3@HtkH9tfHL$(HPHtpHHthH9tcLHH11LRLyRD$DAZA[HDl$Hl$f.HL$(Ht$HuL a$HL$H91HH9uMLrx1Lo1$RL$H|$H\$IH[hHC8H%H9L;d$;Hl$1&@HHM$$I9IIt$HF8H%H9t1ҹLtu1LZH$HmH$Ht$H9kH1fDHH9uHHAHBHH$H$HH$HAH$HHAH$HHHH9HBH@LMPLy1PY^H$ Hl$(fo$fo$H$$(fo$)$0fo$fo$$$,)$@fo$fo$)$Pf$$.)$`$)$p)$)$HD$H |$HHH|$!fDHEH{H9rHPH\$(HTHHHH9?LHRLu1ɺLH$8P1@OD$P[]H#H9HHH\$(HHHH9LHHL1APLuQ1AUND$`H HHHt H9L {$H1LAU1LvN^_H|$3HD$HhhH9#HHt H9 L 7{$H1ɺLAULv1$N%dZYHt5H$HXH$H$HPHHH$H$HL$f.HPHHH9H9uHtHEHt H9VL zz$HLv1LAU1gMA\XH|$1HLIHPe`HHt H9L z$HLu1LAU1McA[]Ht5H$HXH$H$HPHHH$H$HL$H9!H @H9HPHHH9uHWHPH\H$/MLQx1Ls1CLHD$(HD$L y$H y$L x$H x$H$H@hHtHHt H9+Hx$H&MLPL,u1@KH$L$HhhXZL;d$JL$Lt$8>HwHGH3rH3BH LrPHzXMtf@HD$(D$|HD$ D${H|$8H=H|$8HމD$D,H|$PHD$X軐H|$PHމD$\誐|$D$`|$D$dt$4|$D$hmt$@|$D$lmMD$pH[RLDHH0H9'HPHEHH9HpHID$LsAUL$PL1QL$0QRL$\bQL$@Q@VLJHD$hH@H=HHEHH~H9uHpHD$ H ցHHEHEHAH98HPMHLkuLDHID$WVLL1Q@RhAVpIHH$H0HH9HPHEH$HH9HpHID$LsQ@RLn1WVLt$pH$H0HVJHWJHEHHH9 HxD$\H /JHJHEHMHH9HqIL$RLrtWPL1@VLWHH Dt$hHIHAEHDHH]H9THxDl$dH IHEHDHMHH9HqIL$RLIyWPL1@VLGH D\$pHIHIEHDHHH9HxDT$lH HHHEHDHMH^H9UHqIL$RLq~WPL1@VL!GDL$xH HZHHcHEHDHHH9HxDD$DH 'HH0HEHDHMHH9HqIL$RLHWPL1@VLFH|$@H VH|$(~Vt$t:|${H%(HM$$L;d$ I\$H9tHE8H$HHHHH L$ HC8T$4IHIH D ‰L$T$@`u HDŽ$H$H`]HDŽ$HDŽ$ID$LHD$ LLHD$HH$H$OIHtaHEHjH9aHpLZ$HH*H9!HpLeZ$HD$ fƄ$H$)$)$oHq$L)$AoV)$I9tBII0MA0I9t&HQH7HGH32H3BH H L9uM Hsq$I9uD$|E1HD$(HD$ D${H5 q$^@H=p$@H5p$@H=p$_@H5p$@H=p$@H5p$-@H=p$@H5p$k@Hyp$9@Hip$@H5Yp$@H5Ip$@H9p$@H$H$D$|D$tu[L$DT$XHCD$DtHHCH5o$@H5o$@HHb!aH|$8HT$(蜪T$(H|$8HHD$ 膪H|$ HD$(H|$ LWD${D$|H|$(H/LWD$tH$L$Lt$8H H@hH9 HtHUHt H96H n$HtHHt H9Hn$Q@LPM1LlAH$ZYHt$@HPHHH9H9uHtHEHt H9 HJn$HMPLkL12AHt$H$PA\A]Hl$I9I1ۋKL=1ɺ,1L@`HQHPHH$ H$HH$HAH$HH$VHtAH$H$HShHP( H$H$HPHHH$Ht$H$\HHt H9Hl$HHt H9aHl$RML h1PL1?AXAYHHl$L;d$H|$HD$HXhHu HHi H9` LHHLg1ɺAUUH=Yl$HRl$MHH9t)HGHCH@OHH&l$HH9uHl$H$HXjHHl$Hk$"H$L$H;$H$L$H-@H;$H$H$H=k$H$L$L-T;H$H$Hek$H^k$H9=LJIع@zL10>HE1HHHtHmL90HEHt HHtH9uL j$LJI@L1=HsL)HL91HCHt HHtH9uL j$M1ɺFLw=HCHHHH9LJH1Lh1UHL/=HH%j$AZA[H9$HC@HLoo)$)$ 脕 NHCHeL i$kH|$txHD$HXhHyHHmH9dLHHLe1LAU1f<AYAZH|$1HLIHPc`H$LeH;l$u{@LHHLd1LAU1;HUHEHLHBHKI_1AXHLHPc`I$L;d$1IH]HtHHt H9tL }h$lD$XHL$HH$H9H$H<H9H$H9L$HHH;HiMLVd1@#L;L$L;d$hHHEHt H9%H5g$1M@LL'e:H$ZYH;D$Ht$fDH9HPHHH9uHQHPHH$H$HH$HAH$HH$Ht$(1L8tHD$(LHp8oHHH$0APHD$(HD$zD$|D${jHBHJHBLHH@HP|H$H9L$H*$$H2:ʃ@D$lDt$pH:ED\$lEHH9f.He$-HH9KLd$L$0ffIFhHHH1H9(HBQIL9d1PTL18AXAYHH|e$H9L%$fHCƄ$P)$0)$@MtoLA)moA)uEHLDpD薱DLLƻHHtLpMgIFhH|$@Ho)$o)$ W 1ɺRLLl47Hqd$H$H$HH9HGHCH`GHHH9uHtHEHt H9Hd$HM@LPL+b16[]HHEHH9H@HMPLWaqHpL1M@La6H$^_Ht$H9fDH@LH7LHWH@"LHLHLHL c$L c$H5b$L1M@La`5H$^_H;D$:Hb$HWHPHELeHMDl$pEhDT$dEtWDL$hH{6E DD$dEu?HH^6H $H55H=5BJ|$hu|$\t(|$`H06|$\uHH6|$`uH6DAVAUATUSHHHF\HVTLfTH3EH3UIHH {TL-*$<fLCTAD$AD$ oMKToUAT$DLHLP賸AŅH[HHtH54HBtJL 5MtZIFhHtJHHtBH9t=LJ>IT$ID$H3UH3EH 8A[]DA\A]A^L `$AT#1L`S@H543XZfDM1L_H53i3[D]A\A]A^DLpCLLP"ff.fAWHBAVAUATIUHSHH(L*HD$MpL=s3LLiALsPMtHHCHSH9ufHH9t(@ tI~HHLALK`L}@MtI~HLLL$GLL$tuHL$LMLHssAąuTM@1L^H52%2H(D[]A\A]A^A_LK`L}@LsPwLsPHT$LHAąYEPu H}XU`+ut&9s ƃvƃLcPMA$HuX}T9^HKhA$AƄ$A$I$HLMI9MHHLf^@VWPAURL=H11L0HE@H0LuHL]8LU0HD$HCPHPPD1҃t~HpHHChAH2H 2HDHXHHLH9CLIL\$1LY^@LT$RVL30AYHCPAZLT$L\$DPPMLMt'LLLD$L\$cEL\$LD$LL\$?HSPH|$HT$DHT$L\$HHHChHJHHFHH:H91LJASL]1Q@LZ/_AXMHCPLMtLLLD$DLD$t}L-?HSPLHT$CHT$HHHChHJHHHHzH9qLJAVLLq]1Q@.Y^H|$HHCPLMt LCtwL>H|$LsP(CIHHChINHHHHH9LJt$ 1LQL ]@ .XZMD$0HhMD$0HMMD$8HHH9tFDHqHHpHI|$0It$8LHqIL$8HHHIT$8HH9uAo@LvPM1LZ,H5-_-HC`Lh8Ll$MDI$E$H9uA9tHKhHtL Mt I9H Y$PM1APLZVH5_-WRQ1,H0AƄ$E1MdfD]TEfDD={$EDMI1L*YH5,Y,/@HKhA$A$I$HLMI9MHHLX@VWPAUR fAƄ$HKhHtnLMtfI9taMHHLX@AVH5,WP1AUR+H0kIIzL iX$b@L YX$L IX$@L 9X$@L )X$@L X$#@L X$ϷMLYL*MLWL1*LL$LLY*MLXL*@AULoATIUSHHoHt=H]L9t4fH}W:HUHEHHHBH=:HI9uIl$@Ml$Ml$Ml$@Ht7H]L9t.H}:HUHEHHHBH9HI9uMl$HMl$@H[]A\A]ATUHH9HD`DH=w$DHJHHtbHPHtYBduBHkV$H dV$L+H9ufDHH9t@H;PuL+HL]A\ËzdH]A\HL\+L]A\fDHL.+L]A\fDff.ff.HI11L*H5d(Hf.W8G878AWAVAUATUHSHL/HGMHF8IH$Lt$I9t#L~(HI~(LE=Aąt>M6L;4$uH|$tyH$AHEIHEIH(I;Hs1MLSH5b'XHE HZPhHD[]A\A]A^A_ff.@AUATUHSHHH87H;L`L.IHtLHH?IL-w1ɺE1L~L&H;HHHjAątHA[D]A\A]IL1LHu&HD[]A\A]AWf1AVAUATL%ULH1SHHxdH%(HD$h1Ll$0)L$@Ht$HLHD$ HD$)L$0)L$PcSHLHT$ H`AąL}Ld$ IPLHLpME11L1H AąL%Rf11LL)T$@)T$0H\$H)T$PRHPLHT$H`AąHULd$HzPLHT$KHT$HMLxM@HpH5Hj^AąLuXHEHLLhHhXoAąL1fLLxLHDžxL={HLLHDžH)XH1)D$@)D$0H\$H)D$PQHt LLHY^AąL%"f11LL)D$@)D$0H\$H)D$PiQHt LLH^AąL%~f11LL)D$@)D$0H\$H)D$PQHt$LHH]AąbL%~f11LL)D$@)D$0H\$H)D$PPHt$LHHX]AąAL%P~f11LL)D$@)D$0H\$H)D$PhPHt$LHH]Aą L%Wf11LL)D$@)D$0H\$H)D$PPHt$LHH \Aą L%QWf11LL)D$@)D$0H\$H)D$POHt$LHH[Aą@L%Wf11LL)D$@)D$0H\$H)D$PcOHt$LHH\[AąL%}f11LL)D$@)D$0H\$H)D$P OHt$LHH[AąL%hVf11LL)D$@)D$0H\$H)D$PNHt$LHHZAą{L%^|f11LL)D$@)D$0H\$H)D$P^NHt$LHHWZAąL5|f1LL1)D$@AH\$H)D$0)D$PNHLLH:[HT$(H5{H[hLl$0Li0L`HELH@PHx(HHtLLH9HHLl$(L$0L`HELH@PHx'HHtLLH8HHAJ@HEL -"HPHHCHtLHLR6H5Bz1|^_HD$hdH+%(HxD[]A\A]A^A_@HEL !HPHHCHtLHLjR3H5y1E1 AXAYHEL m!HPHHCHtLHLR?DL1ɺ<1H5ky(fHSIOHH !HtHQML>P9OfDHEL HPHHCHtLHLRBfL1ɺP1H5xf.HEL m HPHHCHtLHLʃRI;f.HJHHSH) HtHQML6PEoHEL HPHHCHtLHLRVHEL HPHHCHtLHLjR\HEL HPHHCHtLHL4Rb]HEL YHPHHCHtLHLRh'HEL #HPHHCHtLHLȂRnHEL HPHHCHtLHLRtHEL HPHHCHtLHL\RzHEL HPHHCHtLHL&ROHEL KHPHHCHtLHLRHEL HPHHCHtLHLRHEL HPHHCHtLHLR1H5uE1+XZHEL HPHHCHtLHL6R_H{aLIHEQpH$0@ATUHH56vSHhHHHPH1&fHH5HH@HPH1Aą pH5uH1Aą1" @: +HHH H5(vH1<AąAHH5#vH1AąLJ1ɺ1H5!t]$L$1ɺ1H5s7D[]A\AL11ɺH5sD[]A\@HH5tH1pAą5fH5tH11AąLb1ɺ1H59su9HH5ptH1Aą/H5ZtH1AąfH5(tH1AąfH5tH1YAąfA[]DA\fHxH5FsH1AąM?HH5,sH1AąMHH5sH1AąML1ɺ1H5qf.H5sH1YAąfH5sH1)AąLZ1ɺ1H51qm1L,1ɺ1H5q?f.L1ɺ1H5pf.L1ɺ1H5pf.L1ɺ1H5spsf.Ll1ɺ1H5CpCf.L<1ɺ1H5pOf.L 1ɺ1H5of.L1ɺ1H5of.L1ɺ1H5of.L|1ɺ1H5SoSf.ATUHH5zSHHHH@HPH1 rHH5qH1 AąHH5#sH1 AąH5pH1} Aą:H5yoH1[ AąpHH5pH18 AąHHt HPHH5pH1 Aą $Lt HHA'fDL1ɺ1H5oD[]A\AL11ɺH5loD[]A\@Lt1ɺ1H5?oD1LJ1ɺH5o_D[]A\L1ɺ1H5n/Cf.H5\oH1 AąhfH5@oH1i Aą^fH5'oH19 AąjLj1ɺ1H55n}H5nH1 Aą.L 1ɺ1H5m3GfDH5nH1 AąL 1ɺ1H5mfDL 1ɺ1H5wmf.H5mH1/ Aą1L` 1ɺ1H5+msfDH5wmH1 AąthfDH5\mH1 Aąt^fDL 1ɺ1H5lL 1ɺ1H5ylL 1ɺ1H5SlLb 1ɺ1H5-luL< 1ɺ1H5lOcf.H(dH%(HD$<$t $$t HT$dH+%(H(HL$ LL$G$LD$H5iJ,$tT$ t$|$v $~$1Lt H50il1U#H(dH%(HD$$;$t Ύ$Ď$tHT$dH+%(uvH(HL$ LL$$LD$H5dIx$tT$ t|$w1LwtH5ij 1z#DAUL-ehATIUHSHHH9u 3HH9t(HsL"uHA[D]A\A]@LLH:Aąu1L t"H5g HD[]A\A]ÐAUL-cATIUHSHHH9u 3HH9t(HsL4"uHA[D]A\A]@LLHAąu1LsH5'io HD[]A\A]ÐAUL-ATIUHSHHH9u 3HH9t(HsL!uHA[D]A\A]@LLHAąu1L=sH5Qf HD[]A\A]ÐAVAUATUSI@@ &IH1LHHp LW1ɺ IHLMt'1LH L$1ɺ$IHHHH|$0 D uHHMHD$0A<$H8HwHhH|$0ZL1ɺH5ph7$L1ɺ01H5Jg [1]A\A]A^Lr1H5g\ 1[]A\A]A^ÐL r(DL[HhHH8M1LqH5g%7$=Lg1H5g6$fDHD$0A}H8uqHwHuPH|$0oYLc1ɺH54g6$fL<1ɺ1H5g~6$fLZHEPHHuM1L&qH5f46$LoHD$0poooDǀBff.AW?AVAUATUSHXH$LD$(Ht$0HD$8dH%(HD$HI@L|p@HD$(HhD%x$EuHD$(gx$HD$(D$L|$@L5e$LhI$I$HD$ H9#fDuL1ۅuf;]LH@HHЃ8uH@LLLhID$PHIU@H[D\$@IE@EH5HH)H9 LjLaH1ɺBAUI1LdH5dD$AYAZ;]LADHmH;l$  $#T$$ LALd1ɺQIH5d1mIE@HtgHHt_H9tZLjL莀H1AUI1LFdEH5&dD$,_AXgL-2$@L-2$HD$(HH@Ln1ɺOH5s`LHH1ǃE1HD$(H|$0HcHHhHHH'HD$(H|$0HTHhHIHHD$(H|$8 H$DpoHHHD$8DDA>H8HwHH|$8TL1ɺH5eb1$Lt1ɺb1H5K_1&LlD1H5#__1HT$HdH+%(BHX[]A\A]A^A_Ë#HH@Ll1ɺIH5^LHH1ǃLBUHHHM1LymH5ia0$L}LlLIH5a1sL?1ɺUL,1ɺ1H5an0$H}LlIH5aa1 L1ɺX]HD$8;H8HwHuPH|$8RL1ɺH5i`/$H|L+lIH5`1xLD1ɺ[HSHEPHHoIٹ1LlH5_U/$xHL$(oxo)$o(o8oHHHXLMLH>LL`HD$8LHH8L HHtLLHfHHD$(HHLLhL`HD$8LHH8 HHtLLHHHPbfAWf1AVAULATL%ULHSHHxdH%(HD$h1Lt$01)D$@AEHt$HLAE AE0HD$(HD$ HD$HD$)D$0)D$P-HKLHT$(H ;AąHULd$(HzPLHT$VHT$HLxME11L1HiAąnHH5=^H9Aą HT$H5]Hy:AąLd$LHLLHH5]H8AąHH5@ZH8Aą-HT$H5]H9AąLl$L9L`HELH@PHxHLLL%l]Hf1LHL1)D$@)D$0H\$H)D$P%,IHtPLHT$ H]9AąHULd$ HzPLHT$訑HT$HLhML%3f11LL)D$@)D$0H\$H)D$P+HtLH H7AąL%\f11LL)D$@)D$0H\$H)D$PO+Ht$LHHH7AąL%I\f11LL)D$@)D$0H\$H)D$P*Ht$LHH6AąL%\f11LL)D$@)D$0H\$H)D$P*Ht$LHH6AąqL%[f11LL)D$@)D$0H\$H)D$PJ*Ht$LHHC6AąPL%Wf11LL)D$@)D$0H\$H)D$P)Ht$LHH5Aą/L%![f11LL)D$@)D$0H\$H)D$P)Ht$LH H5Aą L%Zf11LL)D$@)D$0H\$H)D$PE)HcHEL}XLHHXMtIMXHLMAąAPf.HEL HPHHCHtLHL_R;1H5W<XZHD$hdH+%(HxD[]A\A]A^A_@HEL }HPHHCHtLHL*_R8H5W1E1AXAYHEL -HPHHCHtLHLeRF;f.LL1ɺA1H5W_ f.HJHHSHHtHQML>dP>?fDHEL HPHHCHtLHLjeRZfHEL MHPHHCHtLHLdRNf.HEL HPHHCHtLHL*dRKf.HEL HPHHCHtLHLjdRUf.HEL HPHHCHtLHLdR_f.HEL MHDžHPHHCHtLHLdRbHEL HPHHCHtLHLdRhLHHw2Aą@tHEL HPHHCHtLHL eRpHEL wHPHHCHtLHLeRwHEL AHPHHCHtLHLdR}OHEL HPHHCHtLHLdRHEL HPHHCHtLHLrdRH{ >LRdIHEWpHH{=L*dIHEVpHL1ɺ1H5ySH{HT$=HT$ML4crHkPH{e=LcIHEQpH USHHHPDHEtLtTH[]@ǃHH{epH1ɿjI1H5tPLcdL^_uǃLH]JH{HpHj1UILc1H5PXZH[]H-XHPHoH1ɺ]UILbH5O1HAYAZff.@ATUHSWTHLHPHtaH5p H1Aą5LXMt9I$H5NH6 NI|$tI1H1L!AD[]A\fH5}SH1AąYL@1ɺ1H5NS뷐~t)L1ɺ1H5NE1vH;(H5SH1AąL1ɺ1H5NN-H'L|1ɺ1H5Nf.H'k@ILna1E1H5MFAUIH5JRATUHHLH@HPH1HH5RLHPH1}AąDHEt)AD$w|DH5QL1HAąLHrAąAD]A\A]ALI11ɺH5L\D]A\A]H}lHLw`ATIE11H5LXDZ]A\A]@1L1ɺH5iLD]A\A]fDL1ɺ$1H59L!fL|1ɺ1H5Lf.AUATUSH8dH%(HD$(HHxHHHH5yPHHPH1AątqHH5&HH@HPH1Aątr`H@^AHD$(dH+%(H8D[]A\A]L1ɺ1H5KDL\1ɺ1H5JoDL41ɺ1H5JE1DbH5~OH1Aą(L1ɺ"1H5}JfDHH5 OH1iAąHHAąHH5OH10Aą%H H5NH1 AąH(H5NH1AąH0H5NH1AąH8Ht:I(LG AąLH5|NH1AąH@HI(LfG AąsLH56NH17AąLh1ɺ81H5H{fDL<1ɺ*1H5HOmf.L 1ɺ%1H5H=f.L1ɺ(1H5qH f.L1ɺ+1H5AHL1ɺ,1H5HL`1ɺ-1H5GsL:1ɺ11H5GMkL1ɺ71H5G'EL1ɺ21H5GWUSHHGH@ -HB^4HHGHsTH-'GH@PHDL ,Hxj;ZLLYI1ɺ?H1YDHEtLK1ɺC1H0LLPMtLK1ɺI1HHXHtHxHtE11HH1AHHL1[O1]fDH@H[]D@HH°H9H?1ɺFHILK1@ff.AWf1AVAUATL%ULHSHHHdH%(HD$8HGI1H@PLp)D$Ht$L)$)D$ BHtLHUTH>$AąL%f11LL)D$)$H\$)D$ Hf11LL)D$)$H\$)D$ Ht7H@ Ht.8MLY11H5IK$HEL HPHHCHtLHLXRDL%Cf11LL)D$)$H\$)D$ #Hf11LL)D$)$H\$)D$ Ht3H@ Ht*8taML7X11H5)I|$HEL HPHHCHtLHLXRfDLxA?tLLL`LHLLHHPfL11H?)D$)$H\$)D$ HH}HP}Hx tNHEL HPHHFHtLHLXR1H5BE1?XZ#1L#HXHAHD$8dH+%(uHHD[]A\A]A^A_fHEL ]HPHHCHtLHLRVRxH50B1Y^Hp>xHL<AąHEL HPHHCHtLHLVRf1ɺE1LH5AfHEL }HPHHFHtLHLVRf.HEL =HDžPHPHHCHtLHLWVR:f.AWf1AVAUATI1UHSHHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0Hf11HL)D$ )D$Hl$()D$0eHt7H@ Ht.8ILT11H5E$ID$L %HPHHEHtLHLbVR7DID$L HPHHEHtLHLURH5?1E18Y^HD$HdH+%(HXD[]A\A]A^A_HXM|$;EIPH"xfH%LpML=ٮ11LL)D$ )D$)D$0Hl$(fH11LL)D$ )D$Hl$()D$0Ht;H@ Ht28L h1ɺ1L SH5Dn$ID$L HPHHEHtLHLURID$L lHPHHEHtLHLAUR{fHUIOHH)HtHQILTP@fDHXIT$;8HzPHHT$vHT$HwLxMjHf11HL)D$ )D$Hl$()D$0HtGI$HHHE$HAAAuID$HhX;fDHLAŅLLPAŅLLYOAŅID$AHH99L,fID$HUHHHHHtHQLTE1P1H5<XZ@L1ɺ1H5q<f.HJHHUHIHtHQILSP`fDLt1ɺ1H5 <LfLL1ɺ1H5;_$DAWf1AVAUATL%&AULH1SHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0eHf11LL)D$ )D$H\$()D$05Ht7H@ Ht.8MLtO11H5f@ $HEL HPHHCHtLHLKSR7fDHEL HPHHCHtLHLRRH5:1 A\E1A]HD$HdH+%(HXD[]A\A]A^A_L`L}A<$5 $HEL rHPHHCHtLHLRRHEL 5HPHHCHtLHL"RRsfHSIOHHHtHQMLQP?fDL`L}A<$@IPLiqHHPHE111HAąL%f11Dž`LL)D$ )D$H\$()D$0A HLeH5=I|$HHHHH2I D$XfAąL%f11LL)D$ )D$H\$()D$0 Ht.LHHHAąiDHAL%$=f11LL)L$ )L$H\$()L$0l HsLHHAąH H5<HAą?H(H5<HAąTH0H5<HAąiL%<f11LL)T$ )T$H\$()T$0 HtbHE H@PHxH8HLHT$HAąH8Ht$7 AąL%;f11LL)D$ )D$H\$()D$0 HInX411LHA+AąAvLD1ɺ1H55WMfHSIOHHHtHQML6OPfDLH`HAą3HEL hHPHHCHtLHL=OR1H595XZL|1ɺ1H55f.IIH9HEHSHHHHHtHQLLE1PH541[]DHEL uHPHHCHtLHLNRHEL ?HPHHCHtLHL\NRLh1ɺ 1H53{qHEL HPHHCHtLHLNRvHEL HPHHCHtLHLNR@HEL wHPHHCHtLHLNR HE H@PHxH@HLHT$H^AąH@Ht$}4 AąH{ILOQIHEpHHEL HPHHCHtLLpNARRNH{LNASIHEpHJH{LNVIHEpHH{APIHEL)NpHH{pLQNWIHEpHRAWAVAUATIUHSH8D-W$dH%(HD$(1EtPMtW$W$G!A$D-W$HD$(dH+%(H8D[]A\A]A^A_@HL$$LL$cW$LD$ H5OHW$ DL$$D$ EAAH"L51D#W$Lu({ SD$$tD9DKE~H0I9D{D#V$u{ SD$$u9r uыD$ 9CwIL56L1iD =pV$f.HcHZHh L-o"HtZL=+0LuA>HmHt9}tL1L -_LlHmHuU$U$H8"L5^H-/҉U$tt"f.H0L9KtuAV1ɺHS1L ^LMY^]U$SU$뱐D$ 'T$L@L1H5'/-U$R\P1[]qHq"HLVu C T$H0I9uD$ 9CLK HLLL$ HCH rLLKHHDHPLL$1DpT$E D SDbT$AZA[DHLK1LSL ]1w_AXQLd1ɺWH5-yZ@L-"ff.@&$Hօtf.1ff.fAWAVAUATUSH(H$`HD$dH%(H$IHtIIPMB uQ1L KUH5/-1H$dH+%( H([]A\A]A^A_fIPH1IH-,LJLJHpHY1HJI$A$`A^YHHHD$H9ӺHD@^IMEu#ALBH[HHD$AHtl=D #EHt$|L@I|$D$|HHL$KLJHI1jI$1LHpHD$HI$M$ @^|I$0I$I$(MHH9 IT$fH L)$H$HDŽ$)$)$)$HDŽ$HRP)$)$oJhoBxI$8)$H)$HDo)$oZI$@)$H)$HD)$o")$ojHL)$HD$(HH$HCLjHD$@H1ɺHL1f.MuI$0TI|$ILHHI1o1I|$T$IHHT$ I1LGRh&AZA[;DL1ɺz1H1I@I|$Ht$HL$HT$'IHT$LnHI1RHt$ VHAWHL$(QH 1DI|$T$HHLGT$IR1HV_1AX@H1LHD$(HH1LHptHD$@HeE$`EmIXHPHD$8H|$ HHH.HH-HT$`HD$8H@HHKH("H\$PILd$HIHLl$XHLHDHD$0HL$hIM'ILd$0Lf.I4$IHHuMMuLd$HDI$ENTM$0M$(HD$0M$ HL$ H20HHEHD$ H|$HD$HHHKLL$LF13H5(*#L21ɺIAHFHL ESI}fDLl$XHt$81H\$PLd$HLbHD$8HAL|$0LhH\$0Ld$HLt$ Lt$hMI]MLMu;I4$IH'HuMmDI$ENTHD$8M$0M$(HD$0H>M$ HD$ H|$ H5 DL$HDL$HHHED$HD$A?A H?h LeEH5(1#ZYdf.1ɺHL}1fDLL$LD1"H50(#H9j@LDhH$hH|$1DL$H4DL$HHH HD$H8HD$@8Ld$@DL$HL[DL$HHHHHMI1L *H5}'#PL=)H|$ LL|$`A1ɺHLGo11ɺHL%M1HwHHH|$DL$@DL$@CL1ɺNH5&/#Ld$HLt$ H\$0I$A$`ENTM$0HD$0M$(M$ HPHD$ 1ɺHL^1IE H1ɺSLCHp1SL$FHD$XH HHH6L9bH fL9HH@HuI3L1ɺE1H5%#vHD$H8HD$(8tQLd$(DL$@LDL$@HH@Hu6MLJB1RH5@%#HwH@H|$DL$@/DL$@u2L"1ɺWH5$f#IEHBHD$H8HD$8twHt$DL$@cDL$@HHCPHu_LL$([1LAH5$#_MmHD$8LhL1ɺHwHsPH|$DL$TDL$-HD$0H|$8L(L0H HD$L8HCxHD$ DxHǃ|HD$Ht$81DL$HH8hDL$HHL`MtWL5A&EIE|ID$ Md$Mt+Ml$ I<$Mt>AEu6LtEAD9|sD|ILc@1sH5##L1ɺ`H5"Z#L1ɺnH5"5#HHD$ 0ff.@AWAVAUIATUSHZHBLx ME1HH-AMMtLA?u]MwHL^HLKtH5ML8uTMAMuHD[]A\A]A^A_DML@11H5 kH5k$Lu AH@H5T$LuA(@E1qH)1MAVL?1ɿH5XZME1L?H5W fH@HtfHFHt;tHvHu@HiHHtH閠fDHfDAUATL(UHSHL@Mt`L1 fHHGHt 8HGHHuDIIPHt :IPLHuH(I9t@H{Ht2HL9uH8L0L(H@HHbH9HE1HHqHt >HqIHu1HHJHt 9HJHHuH H L+IH9DH{ Ht rH8H HSHHC HHQH HVHH3HSHL"LH IMMLI9thIxH90kH8fHJHSHNH@HBH H L+IH9uH@H1@HHGHt8t?HGHHuH[1[L<]A\H5A]]DHGH#HBH@HGH@uH[]A\A]fDHGHHBH@HGӗ~fDHQMtIPLL@HAH@HAHHIPHtoHPH@H(I@L9u.fDHL9t L9@uHHPHQH HL9u@LHHHH@WH P$H5wH=AWAVAUATIUHպ@SHHH|$L$HLD$LL $dH%(H$1) !HyIHHIEHHIEHIEIEIE IE(IE IE0IE8IE0H$IE@4H= $LHP_BAƅLL1AƅI}HLL11XH5誽DHsPHL|$@^Ao$LAoL$D$`)D$@)L$PL|$ LDhD6H= $DLAHHGLxM:MoHHL3MWH$IIG@L{PIGLHCIGHHChI_HtHHt H9L #AT1L4U@H5A蔼XZH$dH+%( HD[]A\A]A^A_fDL-¼L%1ɺ;L>fLJfI}H'LL۸11RH5aWfAUL-@M1UL8dL1趻A[1A_HhTIHHPTH@\I3$I3D$H uIWdIGlI3T$I3D$H XHChHHHzH9qLJULm8LAVg1E1AYLAZ1ɺhL1gfL-RHL>8I1AV@rL_AXIHHZIGHHJIG MWHIG(IG IG0MWMWIG8IG0H$LT$0HD$pHP։T$(3T$(H|$H=LT$0HH[LXML\$(IL71IL@LT$L\$(LT$ISTIC\MCTI3D$I3$H uIPI@I3T$I3D$H RHt$H|$LT$(L\$0LD$8fL\$0H|$D$IL\$fT$L\$LT$(tF AƇAƃHG#HH 7#IIOL=)#LxH=#H #AIEH#IEL(L-#5HLT$H|$LHP=LT$AbIL.7L1mIHtLlHILAPL51AsHE1ATIHH !Lr@Ht$ H|$8@LT$ LT$L\$=LT$I1ɺAƇL1AƃL5t$ AV$萷YL5^1ɺL1qLT$9*"HLT$cH=$HPCHIH=$LHPt;LT$AILr5L1J@L #ILZ3BH51E1褶 1ɺLLU}L\$LT$$COCLgIGL3LKIzL2L1E1IL2uff.AUATUSHHt>Hu=L41ɺD1H5LL%譵HL[]A\A]HHH;LhLNIHBL1HH]HH0HHH^t LE1%@ALOAH Ht=H0LLBNuԀ.tπ_tʍqՁt HIufAA<$tU H5IL!1ɺUE1L3H5 wfMAILV311PH5E19@L31ɺI1H5]f.AWAVAUATUSH8H<$Ht$dH%(HD$(1HD$ HK>BH|$H5ByHHPE1Ll$H\$ H LH蝿HL|$ E7EtH@EwIEtIDA uA#tMtA<$u4ALuBHt<#uH<$LIiLL$L}211xH5k ӲH|$ Hu"HD$(dH+%(u[H8L[]A\A]A^A_Lg1ɺ1H5 zLD1ɺe1H5 E1TE18.1ɿH5 RLhPLL$1Y^Rff.@AW1ҾkAVAUATUSHHXdH%(HD$H1_l9H=%H\1ҾoH譞Py$S$S\1ҾiH߉5$x1ҾpH߉X#ڌ1ҾH߉&$Ōr1H߉$@HHHt1ҹH=S#H11ҾHoD p#dEuK1ҾnH߉-K#>1ҾlHA蜕HHD$HD$HDs$EEH=[D$Ay$HD$EIHt:H01HH!ILDNuHD$HD$EH5GcHL,HDHH$H$1ҾsHEuH߉$2HLx 1L% MtwL-~fDMMt\A?"MwLL3 H5y LtH5L  MMuDT1A1L0LTvHHU$wHHM$mH߉$-HHh E1Ht\L50MLV*1Lm1XHmHt#}uH}`@HmA HuD1H\$ D-G$H|$HHD$11IL+LD$8ۭHTH9M#H=$Ht(H$H=$$Ht&蠽H$H$H$$HD$HdH+%(HX[]A\A]A^A_fLy.1ɺ<1L#fDH5ILuEDHut1ML)1LѬXZrf.H5UL葺tMH5vL~ fDDe $ER $f#O@&fD1ҾjH豇@HQRH9:#=HSHv#H?H#H5]L豹~H5(L蚹@̀4f; fD{e $@L9+1ɺG1H5= WfH=# $HD$H|$HHD$!$HL5 $M1t$ DL$$LHH i^_JH= AL*H5 ^IH1H $H5LILt/ML8+11+H5fHc $HP $P@MLF*11H54 L ?1LE1L%gL6*1ɺH5ƩH5L蒷tH5Lu[L)1ɺ"1H5dH=m v $IHEH5TLu ML*1LY16L%pL)LӨi8貺}IHIHQH UHDAP4L QH5P1xH ʽf.AW1ҾAVAUATUHSH?H1ɺHHƩHH1ҾH藃HL-X1L51 1҈^H 1҈5H 1҈ 1ҾHtg1ҾHHGQLP)HIIDŽu-DӷHDX@II%%uAw@EtU@O+IaLH@8tHuL-O1ɺ1LL褦yfAwcILDIٹLQ(4H5cH1[]A\A]A^A_fL(!L-1L)ML1L()1HDžGH[]A\A]A^A_f.LGH[]A\A]A^A_DAwdIH;/fDU1ҾHSHuHH[]%D1ҾHHuVtH-L1H#H11LH1[]DHtHtNAWE1 H ;L"AVAUIATIUSHdH%(H$1Hl$@HPMHMLt$fDMM+If1HL1)D$ )D$HD$()D$0HHtHhHA$XL=3HmHH} uH]1;@HHHD$谴$H]HD$Ls MtvL+LL uMAuAI$I~ӸtGMvMuD$fDH5L詸 H[HtD$Ht$L{$L̟1ɺH5t_D$fDM`1H-@Lk%H螢Lj1ɺ1H聢H$dH+%($H[]A\A]A^A_ú LLmuCHkH'$맹kH-LH_I$Lz$tAADŽ$XIٹ1Lb$H5I象$%Lq1ɺH5膡ܶff.AULlBATUHSHH>uHNLHEL-$1IHpHL襞H}ϨIHL趛ID$HHH(H(>I$H0ID$H0L L0;H@AHD[]A\A]1E1LJ#H5QHD[]A\A]1L 1ɺH5E1HD[]A\A]fDH0AątQHA[D]A\A]D1L"H5T輟HD[]A\A]fDLt1ɺ1H5臟=,ff.fATUHHpu)1蝘H@HtYAHD]A\1H5Aąu1L1ɺH5HD]A\1E1L{H5Yff.@AULHATUSHHHI9t_Hf.HL9tHHs1HAąu1L-1ɺH5BHD[]A\A]@HA[D]A\A]ff.AT1ҾUHSHH8IHta1LHIMt []A\DƃL 1H5%荝[1]A\fDH}8BHHHxHHHǀ0H1H)8HHH8HHH H(H !f1Lʙ1ɺH5wߜ1HDž8Lzff.@AUATUHSHH>ty1͕IHtjH(L(I9u BHL9t:HSLHiu1ɺ E1LH5HL[]A\A]IL1H5DAULoxATUSHLgxM9t]H/H{H蔩t3I|$0Ht H~tM$$M9t)I\$(HHauHL[]A\A]HE1[L]A\A]AVAULoxATUSH_xI9tgHL5 HL9tPHS8IM1HH)Aąu1L̗1ɺpH5y[D]A\A]A^DA[]DA\A]A^ff.AWfIAVAUATUHSHdH%(HD$x1Hָ H|$ H\$HHD$HHP HD$PHLHD$XHX HD$`H2HD$hH HD$pD$(BIH@8IHH(HPIHIHCHt>LHuE1HD$xdH+%(HĈD[]A\A]A^A_LL% I$L|$MHHD$L5OH"$D,$HHD$O@AG 1LML*AD$1H|$ LpBIL9}HIHHX Lx(IGHHIT$H$ pEgH|$eHTH$H T$ID$0IT$<@H|$L|$HW"L%VHl$ nH_IHHCI](LIE CIEI` AIE0t HtIMLHoMM(1L1ɺ9LH ΗH"H9`H#赭HHmHHC@@HHHC(H9"HC PoLK(L%11LL#L@HAHHVHuHC HHHC(H%"HC nLK(L1L11ӖH?$ʬIHH诬IHH,LHIE(H IEHm"IE DnH|LID$(HID$H"ID$ h ID$0Ht IL$LHmgHAt$(MM(1ɺ~LH51ԕH#˫HXZH.HxHHHC(HHCH'"HC ^mLK(Le11H5QHRHHHHHHC(H HCHP"HC lLK(L11SH5ڔAL1L$誔H|$谤D$$L`11"H5sD$LrL.11mH5hAL 1ɺ1H5 E1G$L1L01D$L1L$7ѓD$$L11H5h褓D$Lg1ɺ|H5|6$L@11RH5 SD$yH $H5H=˓MLL1^b1LH5ܒLLL1'豒E1I1LH5:臒E1{1LH5]E1ILL#14E1[1LH5 E11fAUATUHSHdH%(H$1H1 Ll$AAL١H}HXHyH`HT$AHxLHHILHLHH) H)HHL$LoH}HXHHn%t$HA_tT$AuATfTcf[E18衢HL PHLPHeH5 P1qH H$dH+%(HĘD[]A\A]DL1HDžH5H$HxLHHILHLHH) H)HLQ1HDžH51虏'@T$AۉATTf.$ۉATTJATfT8蠤AUATUpH1Ҿzj1Ҿ}Hx|1Ҿ|HA|1Ҿ{HAsL1ɺHHDxDDHCvAą1ҾxH)jy1H|sHH|HwAąAD]A\A]L91ɺ1L%H5(LH1vLHE1A11uD]A\A]f.1LJ1ɺH5gύD]A\A]fDL1ɺ1E1H5/蜍D]A\A]L1ɺ1H5of.#SHuNH=財HH߾HHD1H#h[#f.H5#=##fAVAUATUHSH0HtHx̜H0fH@H8HtHx衜H8fH@=#tu1HH=#tHvHLHI9t"DHGHCHHG PhHHI9uH}xLexHI9t HGHCHHGPpHHI9uHHtHPHDžHHt豛HDžHHHHHH9tHRHPHHHH9uH@1Hu+f.HHGHt 8sHGHHuHHHtL Mt"I|$HtL HDž HG11'u ]8 tH11 ~6t.H=#H5$HDžG1违u 8 t1蟝~8HG7H/H}HtqH}HtcHGHtRHD #EDC#ER=#4N#PE#H=#HtdH#w#[Y#H=#@##Ht&XH#H#Ho#]#[]A\A]A^@D #Et#LHa H5o#|bH=#Ht{H=T#H#Ht还L5#H-#H&#L讠H9m|L%6L&1^L#Hŵ#L-H9t:fHIs LMe1I#HY^H9uLL1L i##Z#(DHGHHBH@HG_ofD胗!fDS{ fDL 1 H5=TH5#=#6#MfDHQLH#H5OH5u&HDžG1HP#H8谝KH;裝{ff.AW1ҾAVAUATUHSHdH%(H$1aE1HD%#{HHX L-'Hu6u@IL"1L1H[HD;:HkEtrHHt0|/)HuHH=H9HF0t5IL2 11H5 E1腅Hk#Ht$H躕ADžD$(%=@#HcH=<#HPH$HHT$IHHT$1HlH$I~HHH=@#H3#H[IH-#IFH"#L0L5#HA@Hf+8tH}1PI1LLL_XZPLk1H5',LK1L H5H$dH+%(HĸD[]A\A]A^A_Aء_]x1E1L H5)葃L E1rH5cZH $H5΃H=߃蚘f.AW1L^_AV1AUATL%ULHSH a#A##=#tud1HH=R#tHhlHLHI9t"DHGHCHHG PhHHI9uH}xH]xL/H9t!HGIEL(HGPpLMmH9uUMHHt,HDžHHHHHH9tHRHPHHHH9uH@1E1Hu (LHPHt :LhHMuH8HHtHvLMtMHHt$胾HDžXHDž`HDžHHt$AH@HD$Mt IEL@Ht)HVHHH[Mt,LHUHHHZHHt$HAƅptH5RH AƅHAƅ@Ht$HH@HMt IEL@HAƅhHAƅ%HuHp"HHHHg]H'hHHHHHHH]QHH}xHHHPHHHP(HHEpHHEhAƅnHAƅ}HlAƅHAƅHGHGH9}tHmAƅ]#tGHHtHPHDžHeAƅx #u#H=##Ht&_H#H#Hv#d#AfHPH#HQH@IH@ALz1ɺo1L}fDq fDL1 H5mz}LDz1ɺ1L[}HD[]A\A]A^A_fL z1ɺL1E1 }Ly1ɺ1L}Ly1ɺHLy1ɺ1L|[Ly1ɺ1L|9L`y1ɺ1Lw|1ɺhLL/yW|L#y1ɺLy1ɺ1L'|Lx1LE1|Lx1LE1{Lx1ɺLx1ɺ1L{LLsx1ɺ1L{*LQx1ɺ1Lh{E1HAH9uL]1ɺ1L7{HGHGDLw1ɺ1L{11LwOLz=#u~#Lw1ɺ1LzYoL{w1ɺ1Lz2f.fDH]@H}@H@H@fDfDfDAHH1EDɾ AA f H-AWwAAt H@1LZH5i$y1HDAWAVIAUATUSHHH9tGHIA @HH9t0H{L贎AąuCD9u5IAf.IAHD[]A\A]A^A_ÐHY(KLmMH@H HQLP1H5#xXZff.AUIATAUSHH_Hu2HKHkHGHEHt#HËD9uH[]A\A]HoDH?(Ht/D Lh H@H@HXHEH[]A\A]1Lt1ɺ[H5"w1fATHUHSHH;L`LHt&LHH踐HC[]A\f.HC1LH5Q"tw1ATL%CH$1UHpHLSLUHptLJH}HXH~HtsuK[]A\fDHG$HxLHHILHLHH) H)։H[]A\@G$tATfT1L] H5Q!tv[1]A\DBG$ۉATTMATL%#$1ULzHHpoSHpLHsL&H}HXH}HtsuO[]A\f.H$HxLHHILHLHH) H)H[]A\i$tATfTH IٹHyLPH5 1=uX1ZU@ $ۉATT9ATL%$1UL HH0nSHpLHgrLH}HXH|HtsuO[]A\f.Hi$HxLHHILHLHH) H)H[]A\)$tATfTH IٹH1LPH51sX1ZU@$ۉATT9ATL%#1UL= HHlSHpLH'qL覃H}HXHF{HtsuO[]A\f.H)#HxLHHILHLHH) H)H[]A\#tATfTH IٹHaLPH51rX1ZU@#ۉATT9II1HIxLIIǀHH)HHcI HЃ tCt?A@tAHH=tA uDADE1f.ATSHHH=ڿ#yIHt}HPHxHǀ1HHH)HID$ Md$AD$@ID$PID$XM$$ID$(ID$ IT$IT$I\$8HL[A\DL1H5',qf.'AUATLg USHHo H]I9t4IfDH}1AHUHEHHHBHՀHL9uH[]A\A]ff.fW0HGw8LO LG уO0HO(h@IHLt'HxXHPXtNHW HP`HW(HP`L LH`@HxxW0HPxt!HW HHW(HL LPSHy8uQA0uKq4HQ HA(HBHHAHQ HxHHpHtxHq HpPHq(HHPHHPP[D H]qL11H5oXCZ[D HdqL1Hq4uaHAA0uGHq HQ(HVH2HxHHQ HpHtsHq HpPHq(HHPHHPPHh<f.HqD 1LH5nXZHaH=@tlA'AtA uHfDAt1LQ1ɺH5H1nHHfDHdH%(HD$1HHT${ tD$HT$dH+%(u3HfD1Lj1ɺ H5mff.AVIAUATIHUHSH}K<4HIH{J<3LHA{uE1Et[D]A\A]A^Eu AuE[]A A\A]AAA^ADÐUHH(HGH9Gu"|H} u>H]|1ɿ1_LH5lH} ރt58~~H-1P1L zL~H5\alXHZ]f|fDAWAVAUATUSH8dH%(HD$(1LT$pDO0OI)MIHI ALcI MăuH#HtD9-#<@HE(HH9HSH HQH HxHPLSHHPfHSHPHHXHCCH6#C(C8CHBLs0S,1ELK@fS(HD$ Lc8Ld$ H} L|tA,HD$(dH+%(OH8D[]A\A]A^A_fDL1ɺ1H5jE1f.L1ɺH5jE1@L9KH9Hc C#L)1H5uHHHt#HH)LM9H5PH>LT$11ɺSLsATLL$ Ht$%jI9XZHt$LL$LT$I#HE(HSH HQH HH#HE1HCHZHSH51APLiYE1^oLT$H5{Q1P1SAPLLL$0Ht$(fiH Ht$LL$LT$Hc#HLP1jSSATiH0E1LT$H1ɺAS1L\$ SAPLLL$(hH Ld$LL$LT$$~f.AVE1@AUIATIUSHdH%(H$1ILHI|$ L|Hl$HLt(Uƅx H=wVAID$(HSHsHKHQH HHH HSHCHrH0I9tH]HEH{H;C u1ADH$dH+%(unH[]A\A]A^;|8yH-1PL 1LH5gggX1ZH 3H5gH=gu|ff.fAWAAVIAUATMUSLH(H|$uHD$H.H#IcLH L,<1H4$}HH9$L)H E1Hu$pHIL9H%#IK4pulH LHLAǃ}EH LHLAǃ}(H LHLAǃOAI|$E1fD/DEmuHxHuH}HE1fD/EAtHxHuA9eL$@1ҹLLvHuƄ$?!H$@1ҹHHHD$vHuƄ$?$AL$AH$AufDGHItA8tH$HD$HD$ HD$/fHK/H{M;A/M~/sHHt/LsIHtHt$LuADžuyHt$H|$su$L$8%=ZZfDE1H$H!dH+%(HX!D[]A\A]A^A_s8=q1M5PH H5 PL\1 _Y^fDA1H #HLlIAf.HLEtAAE?_s8p91L7\PH H5PLL$ 1^XZsff.fAWAVAAUIATIUSHI$I9uEDHI9t8HkLHsuEAHD[]A\A]A^A_@LnH=#LxLeHHLLHvH=ī#eHHH@f HH5  lu AL$`I$HkI9tHpHI<$ID$L#HCID$HI\$EHHmH=)#LHPsAąL1{H5߿\f1E1LH5\@HlH=#LPn9I$HtHLcHXI$G'RfAUATUSHHHw8dH%(H$1HH@HHH  qaH!lHDtRwIH/AHHH$dH+%(HĘD[]A\A]fD|$D-uH5HjAąuLl$LkH=z#!I I9IFH.cHH(@tD$@HLl$$L2kH= #!HbHHZ H9HF\tT$$qHA@ALqW11BH5ZHD$HyHHITHTHLH)H)ƒ1ƃL2L79rHT$$HyHHItHtHH)I)Ճ/1҉փMD5L79rHǃLV1ɺQ1H5YHǃƋD$AD-D)OT$$ATTAD-fD)'ATfT}nfDAUATUSHHnHLe MtHL[]A\A]fD}tIH~H@`IHtVHxHHǀ81HH)@HLe LI\$M,$H[]A\A]@E1|HE L1eH51TXCff.@AWAVAUATUHSHLodH%(H$1AEPH@H:H-L L0H1WLT1ɺi1HE1WH$dH+%( HĨD[]A\A]A^A_DI]HH{gAąD$L{%=t9M1H-LHWCJHD$pHT$hHL$0IUIECH HtjMOI]HsHjE1E11jHjjSH AċCH{1hHCfDM1LH5&AHVAlIH=&lIHLjIFHIE AE@11IE(1LIE IEIDžIEIEIEPIEXAE`M.MnMuMuLkiAąHsHL$0 jH-78MgLKHIHWH A9H o[HDHAPLFQP1UCH HLQ1ɺH5TY@HkE`tHEHxdH}dHdL|Q1ɺx1HCH5dTAiLrH5HRTLZdLRdLQ1ɺs1HCH5T{m1LH5SLc릃i1L H5S@AWAAVIAUATUSHQDI D9LcIHJ!DKLDL$ IHHDL$ A@t}MOHMLHUH LHDHHcRI<HcH)1PY^xTH[]A\A]A^A_DH1[]A\A]A^A_@Atp@ukHTL ItKDHAwH\!HLLLH5N1oRXA1Z^H)TMOI ff.@AWAVAUATUH-SHHc_(H4$dH%(H$1H HHD~\HBIԋP tMI t~HL-!D$HAL0fL$ft1f;H@Ɖt$@0uQ@)AH$dH+%(bHD[]A\A]A^A_HPtLMG8MtH $I<$1H]HHID@HH $I<$IH1]\fHHl$'HHA|"UAŅH $I<$IH1l]D$|$HAŅH $I<$IH1*]Dl$MIG@HH\$HHt$ E1HD$ Ht$_A9}{L$HT$HLt_$<#LBQH1QLEH $I<$MH=1\ID$@ tD|$ HS_A9|H\$T$HHE| AEAAA@Au~ID$xtC@@.RfLK1ɺ 1H5|Nf.IcV(HHtH $I<$1H[ID$H $I<$IH1[_DH $I<$IH11Z[.DH $I<$IH12[DH $I<$IHy1 [DH $I<$IH)1ZDIG@HifDL]L5OHID$xƄ$LO@L J1ɺ1H5MubDAWAVIAUATIUSHHLjHco(dH%(H$1D$ AE 2 AE7HTL=b!D$HAT RHDHAT :@tIEHtQIcT$(tFH5NL_HH;MHLH5L +P1[YZYfAH$dH+%(HD[]A\A]A^A_fDLdL=!IMAD$uLl$0A$ALᾀLLsEFA@t!A|$"Ht$'wGLsEFƄ$E1AtUHDHIl@HtBHDD$U[DD$~+HT$ H$HEFD$DHT$'H5MH M@ExL LLMDLV1RHQLWH;WH ADIE(rAEHLL=+!HLDIHL$ADL$HDD$HAT @t`IEHt IcT$(uLAEHDHADD$H{LcAfH;LH1VLk땐H5lKLQ]DL$HL$D$L=n]Lp)DL=)!@L$H=KL>DHKHHMfDD$LE1ɺ=H51IDL$fLHL$DL$HD$XH{HIjLD$DL$HL$McH{LHL$LDL$LD$€LD$DL$HL$MH5DL$LHL$_H{IUIt}DL$ttHCLkHL$HPHp0L2LH2Q H@0@8AE AEdD$LD1ɺ;HCDL$1ɺ\LDH@0@8DLlD1ɺWH5YDL$|GDL$h\ff.fAWAVAUATUHSHHH $dH%(HD$81B @LBt1AIMwL[HD$HHD$8#HD$0Ll$E1HD$HD$(IEA}HD$ &IEHD$I*fDx#LM~VLLHdZ#LgZIHuH} 1NIHf@$AGHD$HtLxMMD VIUHI}BnFZHt$(H|$I@_AMZAGHD$08AML|$MfDH} ZMIH.f@$AD$HD$8dH+%(+HHL[]A\A]A^A_SuSH|$IUH}LhLLHH%Ht$L^HD$0IG6DqH5t$ LK,1sE1LDH|$(TXZ8D3YHt$(H|$ IV\AuIGuHD$08u1fLK1LH5(DH511ɺL@H4$CHD$H4$HD$ H|$E1HD$0SLK1LH5C@H|$S1H5b1ɺ1LR@H4$qCH4$LKL}1E1H5 5CH|$;SXE1LBH5BfAVAUATIUHSGHR t t @uHHA$"AA\D$ T/}HcUH5 !u$[]A\A]A^LHHHcTtLt[]A\A]A^DMA$2i5u+1[]A\A]A^u9b1fD1LH5A1ADHAI9D$1DHAtHzIt$HV1`HsH;1HIIHAEA9$u.LHLH%uMmMd$Mt MufDHCM LHxZMl1tZH;1U4f}t%HEf5H;1)fftH;1UHHcEE1L6=1ɺH5(K@1S@AWIAVIAUMATUHSHHIp*}IH1AEAEAD$(EtrIE(HtiIL$ AE!A} HAtQID$HH{I\$MtMgHL[]A\A]A^A_fAEu H (HcH>fD}xуH}LLID$ID$ HuMd${I~ FHIf@UID$ T$ H}IL$ T$ LH5{1E1>IL$ IEAE!BHH5>@HDHAIL$ AE!AEA{IL$ Au fIcEHA fEDIL$ AE!tdT$ H}1AUIL$ T$ HjID$ LcID$ LIcET$ 1H}AUIL$ Au T$ H?DT$ H}1AUIL$ T$ @T$ H}1IL$ T$ fDL1H5<[ff.@AWH>MAVIH jAUATIUHSHHHH9HVILLl$PHDLD$1MEH $:H $LT$#ME1HILL9LkLLDxD輵DLHEHHHHLxMIcLME AU(MIxEWLEAu.fH[H!uEWEAAG uEML>H5C<11E1W;0DMML1E1!H5%;HD[]A\A]A^A_EWAD$UAG Jf#EPIcALEgA  HDmH <HQH,$IIQAH HP1AH-[+$8H DH3AUML&S1ɺH51E17:AYAZ fDEWAEA AG LHC8?EMLaH5<11E19DEWEAD$DmHH a;HQPAAQIIH*$H{ 1HH-<*$6t$ H H1AUMSL1ɃH519_AXfI} EM)Lr<1ɃH51E18AE(DDmD$HLz:APMH AAPAAPE1LLH~kfI}  f#ERL fDLo1I9L#DHLDxDhDLHEHH萻HHt LxMEM4LP<1Ƀ@I} L H@LEEH-ALH<H11AVC7XL4Z1ɺKH1E1!7@HH 81DeQH^($IɾQLHAQHH-'$A_4t$ H Ho/ASfDI} HL `LDEL<H1AVH-@1Hc6YH^L(31fDDmD$HfHH 7PAQAfDLcL$LcnL$@EMULC<H1ɃATf I} HL hLDEL<H1ɃAVf#EL |EL L <H1ɃAVAWE1AVAUIATL%!UHcSH\HLHHHt$Lt$LdH%(H$1{t'M1LH54HDE1HIAD$ @utM1LAT$As LL9(t5H$dH+%(u7HĨD[]A\A]A^A_DE|$빐H|$DL+AvIfDAVfAUATAUHSHH0dH%(HD$(1H)D$HD$HF HD$HD$ H<$H7Dh@1HL$IH_H$EHHD$L56HIL1P1L>3XZH<$Ht Ht$LHC HtDhHD$(dH+%(H0[]A\A]A^H'HHED$L5HIL1PyfDL5}L+L2H$HEtHE1GL57fAWAVAUATUSHxH|$Ht$ HT$(dH%(HD$hHHD$HH$HH $Ld$0HHL$HIHH $L=k HLIGnLt$Ld$0f11LLIF)D$@)D$0HD$H)D$P _HH|$Lx HHMf.A?vMwA<@u AFIYHD$LHL9uCMmL93IuLFuHD$HHD$f1L1)D$@)D$0HD$H)D$PR^HHHD$LxMteMMI} tIUHEf1L1)D$@)D$0HD$H)D$P]IHyIU IV MuH<$HHD$ H\$(H@HSHt!HtHZH9XHPHD$hdH+%(THx[]A\A]A^A_MMsH<${I}H5L 0ELEH5>LLD$ELD$uI}H5@DLD$tIH5$1LDI}H5AH|$DtH|$H53DIU HfDHH@HuIF HAHEHH@IEHELhfDHD$ HHH@HL$HAHD$ HHHBHD$L`M0H- !f.Md$HD$L`MI<$HCtMl$MI}HCu{IEID$IDLmIEJIHD$H|$ HH@8HZH9XoJHf.M[CAWIcE1AVIAUE1ATIU1SHJ!H($HHHT$HHL$HD$18DILLLL HLEHHPH&CA9$uAT$tC utC uAD$wPHAD$f9C"wts0Vf9rMtS{YELLLLTuAD$f9C"Fts0Vf91MuLD$HL$LLHT$D\$D\$HI}L1nH5,H(L[]A\A]A^A_f.H K At$f9s"tS0f9} ]fIL$Htj)GC =AD$f9C"@AD$f9C" S0frf9dL1"H5+ 2DAVAUATUSHdH%(HD$1H>HH/HA>IHu`H8IDHLHL$$MEl$HD$dH+%(HL[]A\A]A^IL1E1H5*@1E1LKH5)}@H8LDHH D`H$HH;(r1IHfH@ H@Dh9H;LhL81HHtLHHRBHH8IL$HHI$HIT$HL"LBA9DH@HH RHAHL ʺ PLo1H5(XZKfL1 H5i( LL%1ɺH59a(L(%1ɺ H5=(=IfDSHWHttvH{[V/fDHBHtHxHt17:uL$1ɺH5'fAUATUSHHD%v#EH~ tAHD[]A\A]@H8LFH1L-9$HL$sL"HC HHtsHAąH8H HSH HQH H H(H3AHSH(HH(:@LN1LE1 H5e&HD[]A\A]L1* H51T&CHsLH5H@H{L к; 1 &H{ XZHtHC l該fATUHSH~ HCLt%H5q1E1%D[]A\H@HPtntiHS HH@AHJ[D]A\AąiL!1ɺ1H5%{f.HHHQ:tcHS HPfH@HPt&eL. HHHQ:ufLqf.AWAVIAUL-!ATIUSHcH,HHLdH%(H$1HzuH8D$HuLLD$LL|$E1HILMALT$ LT$Azt'M1LH5u#H1HIAE @ut]LLAUu LL2|$uCH$dH+%(HĨ[]A\A]A^A_A]f.I$@AvHt1HPHHtHHPHt;2uHPHtSHQI$@H@gf.I$@L.=D$fDH7fDAWAVAUATUHSH(WdH%(H$1t GH}HEH> HH9uH]Ƅ$D$HHhEHUEHHAL-C@EL LL<1!H[E1HH{ uL|$HL$HSLAMLLf^_tLX1LHD$K1LLHMC(APsHT$I)MLZYjH[HmEEu/e1H$dH+%(?H([]A\A]A^A_ÃE1Ҿ%AEa뫃릿cHHHHl!L$L[:fDLX0HLPHEHHtJHPI9)E1HپL9uHEHH赚HEHǀHLH5L[1H5c4ff.AUIATIUS@HH?!'HHxHH1HHǀ81H)@HLmLLeM]E ЈEAu*HjI}HA8HD[]A\A]DfM1L1ɺH5lE1HD[]A\A]ff.AT|LUSH@H@8HIIHHLD.1LHIRCtHھHAąH{(%HfH@ A@HCH@HCH@D[]A\L\1ɺ1H5K}J#L_1E1H5GD[]A\1E1LrH5H{h$D[]A\L!1H5H{3$3fDH{$L11H5z|I#*AWAVAUIATIUH-6!SHcLAWLcAVAUO,ATIL%!UMHSHHdH%(H$1HzuH8D$HuHHD$OLt$@E1LILMALT$苾LT$Azt'ME1LQH5KHLE1P @ut\HHPAAu LH|$uAH$dH+%(JHD[]A\A]A^A_DD`f.H@uHt1DHPHHtHHPHt;2uHPHHQH@H@fL@IcHD$Mt\Ll$DMMtGIf11LL)D$ )D$HD$()D$0M>HtH@ Htu D`H1Mt$L1H5pp=#XZ@D$fDH%%ff.ATHH]LcMtUI@BvD#MLĮH5PHߐ#1h@B 1ɃXZLA\fA@BLA\@AWLcAVAUO,ATIL%!UMHSHHdH%(H$1HzuH8D$HuHHD$OLt$@E1LILMALT${LT$Azt'M\1LAH5KHLE1P @ut\HHPLcAu LH|$uAH$dH+%(JHL[]A\A]A^A_DLc`f.H@uHt1DHPHHtHHPHt;2uHPHHQH@H@fL@MtdLl$DMMtOIf11LL)D$ )D$HD$()D$0E;HtH@ HtuLc`H1MATL1ɿH5]m:#XZfDD$fDH%"ff.HGHu'HHH9HGHHt9uH@ ff.@USHHtAHHHt\H;HhtuHSHHPHSHHCH[]1Lz 1ɺ&H5a H1[]fDLL 1ɺ)H5.a 1AUATUSHHtmHIHIH9u:f.HH9t(HsL|!uH[]A\A]HLHL[]A\A]1L1ɺAH5 H1[]A\A]fAWAVAUATUHSHH6L"HT$HvL9tjI@Mt$LLHXH$IHt|HLH>$H]H9u CHH9t8HsL uM$$L;d$uH[]A\A]A^A_fLHLuH-)DH-1ɺA1LH H1Ls1ɺs H1[]A\A]A^A_ff.AWAVAUATIHUHSH(Ht$L$gLHIH4IFIHD$8IXL)LHpIHLLH"LLB(HD$L|$uBA?tTHLH HL$HuLl$LLHD$vfDIHHLtA?uH(L[]A\A]A^A_Li1H5, LLE1"@L1ɺH5ƵH-1 HLH1LFff.UHHGU0HOH8t]LM LE(uID$HxHHPHtBIT$ HPPIT$(HPPE1HHXPHAL1AUL觑A0uHHHDAUATIUSHH(dH%(HD$1HLl$t$ HT$Ht$ LHx脙I9t'C9C@rGHD$dH+%(uvH([]A\A]@tuH@HHufDH@fH1LHHtHD$dH+%(uH(1[]A\A]1,ff.AWIL=AVAAUMATUSH8dH%(HD$(1950#VH1AVLLIEXZ1YHT$(dH+%(H8[]A\A]A^A_ÐHHH$AjL $HHzD@4EM@0HsEIL57HCLH@ HPC0uHsLs tn<HK HS(HQH AE&iH~xHFx?HC HHC(HL0C8Ld{<1tn<HS HC(HL$(HHBHHT$HuHD$HCHD$ aHCHxHHPHHS HPPHS(HPPL2LpP1dEO@0ELDHL $yL $HHH@ H$IAHCHH{1H C0HsC0C0H~hHFhHC HFpHC(HFpL0C8F<LvpC4uE8C4I]jfDHsfLDHLL$LL$HH@ HH$1HC0tL5HCLH@ HPC0uHstn<HK HS(L4$HQH @Et_HK HS(Ls tT~LI1ɺ 1L;L $AUATUSHHG4G4tC0uH[]A\A]HGh8C0tH(\(HsHFHAD+FI<$MHDuHT$dH+%(uH[]A\A]A^fD@AUHMATU1SHHdH %(HL$HOHt)H8ImAĄt H$@LHXHoH<$HD$dH+%(uHD[]A\A]CAWAVAUAATE1UHSHH(dH%(HD$HGHtD H}L7I H9tHAL|$HD$4HD$LDHxH|$BH;\$tCH}HMHDuHT$dH+%(uH([]A\A]A^A_Dlff.AUATLghUHoXSHHLH @H{hI9t2HGHHBHGuGuH H{hI9uLL;t#L-fDHC LHPL;uH9kXH[]A\A]AWIAVAUATUH-SIHHHdH%(HD$81Lt$Ld$,t$,Ll$0HLLLHD$ɖI;tIG HHPI9uILLLHD$HD$脖D$u#HT$8dH+%(uJHH[]A\A]A^A_@ILD$ LLD$ HsH2tD$ )D$ ff.AWHAVAH1AUIATUSHHH?H/H HHII1HHHHt2ILDLI)I9LGLD$AULD$tXM|$L)tfH1DLHN$8HLLAUt+Ht>IEHIL[D]LA\1A]A^A_@H1[]A\A]A^A_H[]A\A]A^A_@HDHL$pHL$1fDAVAAUIATIUSHH5BHWHDHHbHHHu,EE1H u6[D]A\A]A^HHÀ; HA t 8RM1ɺPHLP1H50Y5XDZ[]A\A]A^Ed E181M麵PHH5XPLo1Y^$@H?M1L H5XE1E 8dM1ɺPHLP DAWAVAUATUSHH $HH $H81ҾdH%(H$(!1H AA9t-H1ɺPL-\OLơ1LAXAY1ҾHLpHHL1LILH##H51ҾH"#LVM-"#;1ҾHHh%IHtmL5HL{ H5$Lj L1ɺwt#LL* ufDnt#1ҾHLp"H4 HL1L6p"qƄ$ L-ML1ɺ1L%$ W#1ҾH1p(1ҾHsH 1҈H5@HIL5fLLpHH=H1ҾH1ҾH71H1ҾH1ҾH#@#QLK1H5R1ҾHNH 1҈H5 H@HIHsLHtH5*L'HHtPL` MtGHKDA<$u ID$8u #H1LєMd$Mu1ҾHf6H 1҈H=L 1ҾHL #H 1҈H ЈGAąB1ҾH1Ҿ#HHDžH1ҾHD L5HHsEtH5sH'cLHH5QHmeH52HVzH5$H?H5H( H5HH5>H H1HH:L-IHt 8ILI1Lc1f1H)D$)D$ )D$0)D$@)D$P)D$`)D$p)$HHLh ME11L=L5_fA}u3I}LH|$H|$LDqDDMmMutpHhH #L$ HoLHHD1FxRLt$1ɺLLt |$HHtEtHt 1ҾHA[#1LYH5G1E1H$(!dH+%(H8!D[]A\A]A^A_fD(>fDH$ H #1:DL1H5bM|L-F1ɺ1LLLL11L/11L LlL 1DžDL1ɺ41H5gFf.HL-CFI1hL)1LYA^H$LL@@LI1ɺL-E1L4HƘH #D1ҾHL5HH?-fH$ L x$8%=@L--MtLH9.#LHD$s8|$0HIH'HDHE1sHAPH5t>SL<PLL$81nH PDH~H@H-*>L1ɺHfML܁HL~AWH5=LL$LL$LC11pH5=ALm11H5{=ALD11H5R=WgAVL5;(#AUATIHUHS?HDhDSDHL]HHtHxtH HLPeI$I9u &HI9tH{H,uHHCHBH[]A\A]A^ÐAWAAVAUATIUHH='#.HIHDpDRH=e'#DH]LMAH HIA HCH@M@H@I9vH@8L5;L?HHH % LQP1URHH HL(zAąUA]DA\A]A^A_f.HLAH HUL-C;1RLL1H=J&#D_AXIHSH=4&#LDQ_LAąHLeyAą=L1ɺ1L!E@xUL5w:1RLLeY^LHxAąL1ɺ#1L+fDL)8L1H=$#L]DA\A]A^A_@MLA@1ffLdL1ɺ IHL1E1H1IŨLJ~H5L9AAUURGH fDL1ɺM1LM@H@8L-8L~HHH % LQP1UR-H=##H DWIHH=##LD\Aą^HLvAąL/1ɺ>1LFU1E1L~RRH58XDZ]A\A]A^A_fLcIHQL1ɺ4;fAWAVAUATUSHH $H81ҹdH%(H$(1Ld$ IHHD$LHD$ LL1fDLmHHt|/t D /HHt$1LAH "HAHT$HI)HL$1H$L)f.L&HT$A!HH9$tzH4~.tH1LHHuMtƄ$HME1HD$ LH5^6HHHP1THT$(XYH9$uHl$1Hf.HT$HH<.H9uH|$H$(dH+%(H8D[]A\A]A^A_1HBHpx1L51HDLwL1 H|$ 8H1ɺWPLL$ L$wL1ZYfDLj|LHHFN#HHD$D$,wH$dH+%(uH[]A\A]A^A_VATIUSH/H]H9u;HHMHL9t%HHEH}HCHHtր?t$f[]A\ff.AWHAVAUATUSHHHD$H9ILfH@0@@ L}LI|$LpL\HLLHuI$HC(I$L+HCI$HHmI$H;l$tUI|$8HHZL1ɺ1H5.H1[]A\A]A^A_H[]A\A]A^A_@HC(L1ɺH %$H5 H=1QUHoHI1I#uH5{H]fDAWAVAUATUSHH $HH $HfdH%(H$$1HH$)$HHEHIH@HI AA%AA D(?H$1EEH x"HHHHHHHt-x.tHHH$1HzH66$iLUz1ɺ1H$ATH5,AUIH_AXHXH=#HHH$HxHHHHLHLHH)H)HfDD9j H5H=#HHH$L5yHHHtZL|$1HLHT$MLD$HyuD9l$uD9$$u1LH$HyYH $u/1H$$dH+%(ZHĨ$[]A\A]A^A_@H$HH1PILx ATH5;+1AU<H HPHXVL1ɺ 1H5*Ƅ$1f8 L 1PHxLOPH5*1XZ@H$1EEH q"HwH H\$1ɺHHNf|$..L$HHt$Htr/-wHH ЄtQ:$'TfT|$ bH$1IؾH 2"HѿH AT1H5a)1AUILh}SHkH=D#YHX^HH4H$HxHHHHLHLHH) H)HF8I1ɺPHsLKPH5(1AYAZfDLl1ɺ1H5z(Ƅ$wDL>1ɺ1H5L(Q$ۉTTff.@AUIATUSHHuSH5utt9H5uLWtH5uL1=@žIHtN1HxLHu AƄ$H;Al$tEHCI$ID$L LcHL[]A\A]L1ɺt1H5t1Pf.AWAVAUATUSHH $HhL=tH$LhH\$8IcLF8IHT$IHH\$PDL$dH%(H$X1HD$ HD$HMH"HD$HD$HLDHMAt$I IHALLA A1^_9L$H111DžHT$ HD$0v|$0D$4HD$(LT$(E~fHD$8L$4HD$ DH$XdH+%(Hh[]A\A]A^A_HT$ 1HHt}uH|$HulIHT$L0uSLD$H8DI1PH LÿPH5%1'XZLT$($19IEHt7L9t2LH1L yH5r1L ""fAVAUIHATAUHHHLHItEH5erLAąuA-LTHtHxLHE1AHD]A\A]A^HE1]DA\A]A^ff.ATLcUHH~SHHHHDH=H) 1HHHtqHP@< u'JL%H9rSf.H9tDBH< tt4< t0L1HH)H9rD< tHH9t  D uBD#[]A\ff.AUATUHH $HH5 dH%(H$1Hp2H/IH$fDLHhH$#t݁}VERSuf}IOù}NuLL-aptLg1ɺ,1L~IHLH-#TH11UMLv0L?HLLH$dH+%(uGH]A\A]fLHt1L1ɺ9H5oӾ1*1Lv1ɺ"H5po詾1yfUSHH $HfE1AdH%(H$1I)$HH|$HHH3HjHLHt(H5 oHftHHt*HH$dH+%(u H[]KL1ɺH5n̽1USHH $HfE1AdH%(H$1I)$HH|$HHHSHjHL1ɺ1LH0JHt$H=#DTH=#HtDL`0H-LmHѴL)Lmff.HtHHtH9t H@DHi"AWAVAUL-PATUHSHL7dH%(H$1IIL9u HI~LiHU8HD$(u H9HHIH %ILmA LQ1PHH Av% кP1襳M~H LH=#LPc?IIFHBHHIH9>H$dH+%(uHĨ[]A\A]A^A_ff.AWAVAAUIHATUHSHHdH%(H$1HD`De,H=#DHމ6HHL`MAD$`uwM;$$Ht$HI $I9 D$(%=`IT$8Lt$8HL$I9H$Ht1LHLUyH$dH+%(HĸL[]A\A]A^A_DHt$HE1HuD$(%=`EgL1ɺ,1H5趱xH="DQHL$AH$ILIH A% HH5^"tHqHI1ɿSILkPHAH AVL5$%VL кP1H0LMHD$8HHH % IHt L9EH5"IW8HL kSQI1PHIH VAL% кP1腰H0L Ht$8HH|HD`D)H=N"DHމ3HHtL`M@ILyaL1E1DIL2a1ɺH51E1ɯ@ILi1ɺH51E1虯[@I$HI9HPID$8HILiRH5LHHH % 1RP1+H H?H= "HލP:I,$I9u *fHmI9tH}H[uHUHEHBHLE1]I$H{L9rLHLoisHrHi"@Ld$8H="D IHtSLMESH I1ɺL%ALhD H5 P1XLZLd$8LHVHHD`DW'H="DHމ1HHt L`MZIL_1E1cH5z脭FILfg1ɺfL,1LE1BDL !"1ɺ]E1LH5 `ATUHSHfHHtoHPL` HtUfHHRHuHHCHt%AD$`u1LHHAAD$`D tL[]A\;vH@HuE1[]LA\ff.AWAVAUATUSHXdH%(HD$HHa"H@HtmIDHH@HuIL%H-]Lk AIE8H%H9t7HCHt@HH@Huf;vH[Hu1~@MLHLLuIEHtL9urL z"AW11ɺUL]H5 ]fA?1.0XZtA?0.90_ATHT$HdH+%(uHX[]A\A]A^A_LHt@AWAVAUATUSHH $HH $HdH%(H$ 1HxHH}tE Јu?H$ dH+%(RH []A\A]A^A_Ð11f.LpL$1LHR\L踧LGeL$LLLtZL= M11L\Lѩ@LLg11D$ D$ 1Hp2ILH][Ld1H5M R11Ҿ̄uH$1HpHZH苦kH$H31ҹHHp2޾H&ƃoBf1ҾH!u])HH@HHFHt 8HvHu1H߾HHt1IyLbH5 1SDLL'`HMLLYP1薧X1ZDLT1ɺ%1H5b gfH#rf1ҾH)D$ )D$0)D$@)HH8LpI1L$LHXLyRHt$PL$=1H|$HD$HHLt$ HX0L1HH$1MILH_XHHL~x.ILIX11YH5! &|L1ɺV1H5gfDAWAVAUIATIIUAHSH@HdH%(H$1HH % AHL|$HLӵD$(%=`7HD$8HHHaH^HD`DH=0"DHމ(HHoL`MbH$dH+%(rHĸL[]A\A]A^A_fDAVC IٹAUHL$`HHD$1蝤XZHHL7HH{LHD$(%=`0HD$8HH9HHAVH %AUH5 I L_1R` P1Ht$XHH M1ɺe E1LH5ãfDcIHOHt$HLAVH-w1AUL>_HMU aYV ^L&1H1E1?8f.HHD$IH\$1L_U[ HLȟ1ɺ\ H޿1E1ܢHt$L11E E1订fSH-1AVL^EHh sXL>Z1ɺi fDHH->1EAVHQ L](_1AXR H1LHL]E1AVH\$G HҡA[L]1ɺH AVILx]1AUH\$K H萡AYLZAZ1ɺL Զ@ATUHH=_"SH!IHtaID$HI$XLHHP%t L[]A\IٹE1LA]H5fDIٹ1LJ]H5ff.@AT!UHH裶IHt(1ҹ!HH虶HuAD$ HL]A\L/1ɺF1H5 QBATUSH/H]H9tEIfHEH} HCHH}(H}0 HHHL9u[]A\fATUSHH $HfE1AdH%(H$1I)$HH|$HHHmvHjHLVHAąt1H5QHAątAHtHHt*HH$dH+%(uHD[]A\t1ɺ E1LћH5OAWAVAUATUSHH $HHfAH)QAdH%(H$81ID$,I)$0H$@H$0HN`@HHD$4HLP;ZYAt LcD$,Eu0H$8dH+%(VHHD[]A\A]A^A_@1IEL|$0HD$LHH$4HJDHD$H9AH$0L5AL<u,CLK< <D<$AfCH\H;\$S1HHЃ< <usH{H~ILLO1艴HT$LAĸA9DOCH\H;\$h@AD<8SHsLI|$0eui.|$0naa.D$CLK<<HCME1HD$fE$IcLHH1A[IL9d$uILNL1mAĸHT$LA9DOGA6@D$LE1ͫI9s-{K /LHC/I蠫I9rHT$t$LJDHCME1HD$E$IcLHH1A[IL9d$uILML1mAĸHT$LA9DOGD$HHC ME1HD$E$IcLHH1A軱IL9d$u[HC ME1HD$fE$IcLHH1AkIL9d$u HCME1HD$fE$IcLHH1AIL9d$u6fDAWfE1AVIH"AUMAATAUHSHHdH%(H$1I)$HN` L)D$)D$()D$8)D$H)D$X)D$h)D$xj&L$1 L8tu x1IcLL$HS1LHHMtIUH$dH+%(HĘ[]A\A]A^A_HLE1AjH HHlZYt$1tHx0TIcLLyJfDHH|(A1L1ɺH5H1,cAWAVAUATUSL$HH $L9uH(fdH%(H$@1IH$ H)$)D$HH|$ Hf2f  HjHcH>@E1L$HAjLH&nLHH$ _AXLD"t辧HfX tE_H]Huڀ$L蜫IHLH$@dH+%([H(@L[]A\A]A^A_@L$HE1AjLH[ILWH5^ILxY^H}DE1L$E1LLeHl$LHH|$_H/HDH9wHH9t8_t@ftHLԫLHHfFa@HEHH9=H iKHH99PuHx&IfDE1L$HAjLH Hff1E1D$H$ L$ HHALL)$ H}GjA\A_$ L$tLLۛ$xHALHHD$ AH.GLPbAZA[DL$E$ fDI9LGH$ fu JDIt?B<8 tMt3L HIt#x tHpLLfDH>H>H>H?H>H>H>H>H>H>H>HAWAVAUATUSHH $H8dH%(H$(1IHHHt$Imt D$9Et0E1H$(dH+%(H8D[]A\A]A^A_Ð]L} fLt$ LLfLI\$ IL$ H9t&DH{HtD}fD9{HH9u߾ H $dH $HHGULLH $1UI|$ HCIfSID$(H $HCH HI\$(Mt#LLHL$$V$HL$fAD$a@/M|$ID$HD$I9uM?L;|$I_LH $HH $AuԾ uH $HI~AGHa\D,DfABHL$HL$L$I|$ HIB ID$(HL$AI IBLHMT$(LeAL$`HMT$0HDHI$HL9 L@}L$A{V QI11APH5<9LEAVqLT$ H ABfE]f._L3H|$ _LGIDL9wHL9t8_tf}@_|$ tT|$!1I|$"0>H5:LۙH&LDII\$8Dp I$Ht L9nH5w"L7HL9d1ҹLL"HtI9H;H5:L觕t H5:L菕Ht$ LJHL$HIHȋR H%H9ID$8HH HƁH H HHH H9H I $%HkL9bLIVLC1R: PAWH571FH f AHHtLm fHLКI|$ HCID$ HID$(HCHI$I\$(LeAL$`I\$0HL9HH}L09Q 1AUI1H5R6A腅XZfDLhI$LeAL$`I\$0HtYL9tTHHAL8Q 1AVIDHpL_f.H "9H ݱ"I$LeAL$`I\$0Ht6L9t1HHL=8Q 1AWIL"H "LLH $H $A/ID$8HHH % I $Ht$L9tLIHLA1R' PAWL "nL "Lɀ1ɺ H541܃L1ɺ 1H5}4趃L}1ɺ 벐UH56HAE'H5}6HܘAEH5h6H輘AEH5P6H蜘AEH5;6H|AEH5&6H\AEH56HAf9Ct2[D]A\f.E1DfE1[]DA\DHLE1[]A\AD@AWAVAUATUSL$HH $L9uH(fdH%(H$F1D$lD$hD$d)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$u8AH$FdH+%( H(FD[]A\A]A^A_fD1ۀp2Ht"H$6Hp21茐HH#AL=X#L50L=HLHDʀ=4#IEHAQA1RSR8P1H0<LL1M9t2fI}(Ht袏I} Ht蒏MmM9uD-"E=#t41HL$hHT$lLLD$dH5H3讌|$lHp1H$H1HL$8H|$~|Hp21H$H2HL$HH|$J|bH|$舍H|$H5g2_HD$(H H|$11sD$49H1L9tfHL9uHcD$HHt$@跌Ht$@HHD$ l LMtL1L1Mt ;\$3D$dAH$H1H|$@DH1,{~DT$LL$@Hc1H|$ LHA)IcDT$P͔DT$PA9Lù 1HH|$@LLM9Dl$PMMLd$ Hl$XvA}HLIDl$AQHcHAPL;IDQ)LVLcIHL1H 97MmM9IEHHHH9HJH9/HVHEME0Mt A<.tuL6EMIu E$A}HLIDl$HcHIMDH)LAPLcL;QVLx1ɺa1L{$fDHLeH5$/LtH5/LL%{"Ht"I9tE1L-{fDI|$HHtL詉tM$$H7"I9u҅="LDLp211L.z"k8 諌h1LPHu.L/xPLL$ 1zXZfL81ɺV1LczL81ɺ[1LAzL5.H|$ H1荑=Lv1ɺ1LyfH|$ H|$(,|$4苆1^8觋1LPHL+wPLL$(1yXZDIM(H Y"@H Z@Lv1ɺd1L3yɍ81ɿLPH& LvpPLL$(1xA\A_H|$(9t9耍8Ɋ1ɺLPHqvLMvPLL$ 1x[]|$4 L1LF7|xDl$PHl$XHt$ HcD$@KL|$p1L$LHD$p蛃HD$P衇t$LAHyH+VHDHL$XQAPL/7PLM1CD$pH HcD$PHt$(LƄ艊Ht$(H|$ rH|$(PH|$(.LjH|$(襍Ht$HH|$n)|$4荈6|$4܃H1L6LD$XPSD$ PLL$`1vf$HDŽ$DŽ$)$)$H HH|$ 裆L1L85nvyL1L5Dl$PDvO="@LL311vHAoڿϦUD$L1L4uL1La5uL1L)uLIr1ɺ1L`ukL'r1ɺ1L>uILr1ɺ1LuH|$ "9L4L1tH|$ ;1ҾHaD$(#H$&HL$8H(HD$H1(rqH|$?H|$ԄHD$HLL$H$6讌H*&0LH׌HL$81DKMHZ4HqH5'H΋IH?HLdžH|$ L貆L蒍Lr UL#1IL'1ɺLE1psDl$4E1E1H$D$HD$8H|$ƌHHl{.tLkLHH#uHC"fH|$81)$L$ H$H$C+LT$P$C/)$f$C2HDŽ$$`H 1HD$HJH|$P 1HD$@2LD$HAT$AA9vHL$@E9A91ҹ$LDT$H$XDT$HuƄ$D$4AADT$Ln1ɺ1LqLn1ɺ1LqLL$1ɺkLL%qDL$LL0}qH|$(͇LH;H t1H;H t;t;H tgH;H ufH;uAUATUHSHHH9tIIL-" HH9t2H{uHs(1LHCHtHH`H9uH[]A\A]LK(L1L@ gATUSHH $HHdH%(H$1H$HHpH,eHHwAąubHp2@1HgyDžtAH$dH+%(HĠD[]A\@IL(1E1H5f@1E1L "H5fz@[{H1ɋILH5ZP1fXZ?fLLc1ɺ1H5&_f{DAVAUATUSHD%Y#o#A9EAվ1H KHH=LMUL5F#1HpL`cD _"EDAABL1wAąBDPwD%"A#*AL>'114H5E19eHD[]A\A]A^fAHtHD[]A\A]A^1L&1ɺDH5dHD[]A\A]A^La9H5j1dc@1ҾHHD$IHL$HIL?a1ɺ;1H5RdDx1ɺJE1DLo&1H5dA@L`1ɺ=1H5cf{xL-1ɿDL#&1LWcDlpuE1A\DL\`1ɺZ1LscɐUHdH%(HD$1D$H%=uaHL$uIL%1ɺH5bT$HD$dH+%(H]@H舢H8uL_1ɺH5Wb=Q"HD$dH+%(HL11H5]Lb@%=Dl#6HD$dH+%(u:HH]pL$1ɺ1H5a5wDAWAVAUATUSHhHt$T$,L$(LD$8dH%(HD$X1HD$@HD$ HD$HHD$@u#HD$XdH+%(0Hh[]A\A]A^A_L= I11L$S L.aI$I$H97L5L-`DLB@Hs0HK {HIDHIDHV APIL#1VLQ1`HH H9t"HCMHtHHtH9uLu"I$H9D$L-dH,$HH\$LuMCUf5Ht"HH9uHH9L;puAFb I$H LLHEHU0fAAHHu IIMH3JH3:H uI{IKH3zH3JH /IHt L9H R"HL#IDHIDHT$0 ASI1L\$QHT$@1R VL_HE0IH H=fL\$HHDHt L9QL Ջ"P11L"AS LL\$ ^A[XH|$HHD$H}0nHT$HU0A$ED$HM I6H6L9-HvHL"IDHIDHT$HVHT$ IL1R Q1^H A$ HU(HHEHtHHt H93H=Ɋ"HHT$Ld$ IIL$H\$5@In Ht_HHTouPI~0 DMmM9tHfA}uI] HtI}0tI}tL9$$tLt$M9tfA~tM6M9uMmM9uL$LH\$Ld$ I9L-_ @HH9t|A$xqHK H9./ f{uH{uHS0HtHC RLL  L% HID1P1XA$H^_H9uL$0 A$  D$( L11 LXLHD$HD$,H8H9t}M$HWI9LDHH9H;PuHH0LH1HAH3H3H HQHAI3QI3AH |H?H;|$uA$cL|1ɺ 1LWA$8Hu HH Hc IMML3JH3:L IxMHH3zL3JL AHI6H@H5!"HHV H9M HPIF0MRL LPHLD11VLk_AXHHI~ fI^ A$I^(D$HHIv HLHHDQH ARI1Q1VLPVIVH b`IN0HB0IFHN"HPHfHHRHu@HX HHH31H3QH ~HHH3qH3QH _HvHH:H91LhIv A~HLHHDZH1 AUI1Q1VLYUH L jLH$jLHD$i I2kH<$ H|$~ Mu Hl I~ HD$0dI~(dHS HHT$qH$IF HD$IF(HD$0LhI^K`H{ HC0d HT$IvHHHS(HPHS(HHC(։A$D$ HPHtHHRHu?fDH@H;wf.HHH9LPHT$HtHH9uLHH9@H;XuCb 0MF HMLDVLARI 1Q1APLSI|$H ?[HfH@IVH|$@HP HL$HH|$ HHHL$HH8HHD$HA$HHHH9vLHM1ɺ L1RIV1LI$HPIvH莸HHt1I$M6II9:gIHL9HHHT$=APLQHT$ I11R VL3RIH HjL9aH@HLM 1ɺ PLL1QLM LLL$ aI|$LpXZLYIHtHt$LHjII|$I$LLEA$fDHM H:.I6MH_I9VHvHHT$IDAPLVHT$IL1R Q1 QIHU0H H:L91LHH11LRL PH}0`HE01A$AYAZED$HM H=}}"ZLq}"L e}"L-Y}"LM}"aHs0LH{L-V LQI1ɿ1PA$AXAYHs0HIDHW(IHt L92L|"Hu0HM HIDHIDHx APILVQ1L1OH H9HL9tGfxu@HH0Ht7Hxt0H:HrH39H3qH uHzHrH3yH3qH @HH9uA~dDIIHt L9L{"Hu0HM }HIDHIDAP LJASIVQ1$H5HmHyL@LJHI'IV[Lh#LXwIE RL L jLHID1P1=NI}0D^I}(;^I$IE0IE(A$XIZD$|H5z"L1ɺ 1LMBHz"L z"AM#I$7HD$8HtE$T$(AEɅL1ɺ 1LAM@IHt L9eLz"Hu0HM HIDHIDHn APILVQ1LHL 1LU LzLIFII~ HBH\I~(\I~0\L\HD$0HHD$ HD$AZA[D$L1ɺ 1LALLArE$1L1Lz AAKfHu MdD$I[H x"VL@Hx"1ɺ LLjHKH<$HD$0[H|$[L}[H|$0s[L/H11= LFKI`ff.@AWAVIAUATUSHHHHt$@L$T$LHL$PdH%(H$1H$L$HD$H$H$HD$pHD$(HD$xHD$pHL$HD$0H9t8Ll$L|$0DH}tLm Mt f}x HmL9uLl$L1ɺP 1H5&J1HD$HHt$LIHoID$ Il$ H9uHH9fxuLxMtIH9ufDHmH9tHuL _uI~YQHpfL`H$ H$L(HPH$HH$/IH hLLHIH ϻLLHIH LLHIH LLHLL褰IHIH9 Hl$IH M?I9 IwH]uI~Hl$ Hl$PLD$ HH f HBLD$ HT$^LD$ Ha AI|$ L@fDxm IL$(HT$H(HHIL$(HH$ID$(Lb< H$L*HBH$HH$}DHD$H@Hth H|$|WH$E1L9t@HAL9uLM1ɺY 1H5+GL$IM9` MgID$ IT$ H9Efx.HhH!AD$`Ht$lLD$lAVADT$lE3IH ILLHt>IH LLHt!IH LLHE IGH[HHOH9FHRHRI1PL[x 1H5EIIGHBHAXAYHIL9tdHfHH9I$Ht L9tLHL r"1L1ɺ] H5?IuEHL9uL$M9 E1fM?AM9uL 1ɺ} 1H5#EH$Hl$H9^ Ld$(HCHxHx0tI~@LHtlf@@ H|$p@0HSHJHHHJ0o HoQP(J HL$xL HHHL$xHHD$xHB``HBHH9_H$L|$L9D$HLd$(Lt$DHmL9`HEHP0HtLH p(1ɿRH5 1Lj CH$Y_L9LuHI~0LLGHXHLL1M1L 'LWHWL3H3L HI^K`HAH98H@MN P 1WL 1H55CH$A[ZL9u KHL9t@H;XuIV0HHHpH@ H3 H3BH uHNHFH3JH3BH DHmD$HL9Lt$H$H;D$Ll$ ILt$X@MmL;l$IEHD$H@HD$HuHD$Ln 1ɺ H5LH p(p01BBH$AYAZHD$HX H;l$ Ll$8E1f.LeM|$ Ml$ M9t.DfAuIwHtHOWGM?M9uHmH;l$ uHD$Ll$8LH0AmHL$MHhIIEHHmHHaH9XLJVIGHHHH9HBHILm1Pn &I$HtKL9tFH@HIL$1Pe H51@A[]DHm"Hm"I$Ht L9Hm"IĨPI1ATLa Hsm"I|$(Y^Ht NHmID$(D$HL9uHD$PHtT$HtD$LD$HH$dH+%(&Hĸ[]A\A]A^A_ÐA9Ld$HmAH;l$ \HtHHt H9FL 3j"I1ɺ H51&=HU1LIHPHuHHHHmL9MI9uw@M$$I9fIt$LRuI~lDH>fHhH$H$HL$HPH$HHH$Ll$8HD$LH0HD$L{1ɺ H5p(1S<_AXuH@]LHIH ;LLHC LTE1cE1kD$H-ILKHl$pH;l$(P3L?81ɺF1H5R;H $H5;H=;Hff.AWAVAUATUHSHHt$0L$T$L$8LD$HdH%(H$1H$L$L$HD$H$H$1D$|$@u @, HLE1D$ D$L9 DD$ϦIL-D$<M$$M9ML$0MtI|$u@uD$u fA|$u11LcL9H}@AHtvf@ H$@@0IT$0o HoRP(>H$|$L8It$0D$<HPH$H H$豴D$M$$M9LAH$L9Ѓ@E1ƒfDHL%1ɿATD$ H5PD$8PD$$P1R8H0L9$u @ L.1ɺ1H5T81IH D$`ϦD$df.LHUIH1AEbuHH rLHHtHH ݪLHHtHH LHHtHH LHHjH}?HSfLhH$LH|$Iu8D$dH$H8|$`HPH$HH$軲D$`fD$kD$X 1L1ɺH57D$(D$8H$Ll$0L9tUDLcMt?H}>Ht,fL`I}y IUL(HPIUHIEHL9u@u/D$ D$8u%D$tH}H5<K; DH$dH+%(.Hĸ[]A\A]A^A_E1ɃHAL9uID$Hth LF@u1D$u)HDD$`L$dT$t$< \ @Li1ɺ1H5n5L$L;l$IH\$ Lt$(Dt$L|$L|$MeEtLHMcI$HVL9MLH1H51L5Ht$xLDD$xHH LHHtbHH LHHtEHH LHHt(HH LHHMt AD$aMmM9H\$ Lt$(L|$L$D$D$(D$XM9L|$MDHJHBH3NH3FH HD$xE1fDD$v@u |$HL$xHT$vLHLTHD$xHHD$ bHLHD$PUH|$vH5W5LJHD$@XLK0[MLD΃=$"H5H1ATt$0P1>3H ;IIHnH|$@bH|$ VH|$PJH{ CH{(BIE HHD$XxeHD$ T$vLkHC HD$@fSHC(HD$PfAT$ID$AM`I} Me0E HD$XHsLI$IE(ID$IE(L Me(gD$XM?L;|$t~MoMIIEI9<L%%_"HtL`HD$(IwI9t/HS0HtH HBH3H3FH HI9uM?1L;|$u@|$XL|$L$D$D$8!D$M9[L%fM6M9DMnMtH1LHHPH1LHHuA}d&IUINHthL9tcLJP1MQH51ɿ 1XZHtHCAe`d@D$fDL ]"@L ]"At$XH=d"*LKfM'I$HL9LHLV1ɺ1H53l0H$HD$LH9M$Ll$MDt$@IHl$PLL|$XIHSHC L{H3EH3UH IWIGH3UH3EH HCHzMqI$HdL9[HJHH;H92HBQML1P&H5A1x/A[LX1ɺ(H51T/)1ML1ɿH50/HHCHBHIELM9Ll$Dt$@Hl$PL|$XD$`ϦD$dD$D$(1L01ɺH5.D$(D$D$8HD$HH|$xL i["@HY["@H I["@LH5@T$LLCH55LE1D$ CH5?LAlCHT$I9D$ffDLHT$hfL$vyBLHD$ HD$xgBLHD$PZBH1HD$HHT$p1H59MLrRcg-^_&MtI$Ht L9H2Z"HML1P,H51-LcAYAZ@D$8D$dD$D$`ϦD$L`1ɺ1H5,HFL1ɿLDH1qH5*LJ@L8r;g;L 1LO'PuH|PH5e1)AZA[(3>8ss;M1ɺePH=L&PH51V)A^A_8L&1ɺ1H5')|=1ɿLDH1H5(L70;%:L 1LS&PHPH5n1(ZYHH5PA1PL1u(LM7^_<8>:L 1L%PHPs=IH{D$L$P H# HASH=0D$D$$ϦD$fLL@6HI9,$mA<$# HAo$P #tHSYSTEMIDI9$tL6<$LH5L$4y H5L4eH5L4YH5L 8H5wLHD$@H7H5gLHD$(7H5[LHD$H7H5LLHD$07HD$8HH|$(8;HHH$PH|$@HHD$ Cd$PEHt$ H|$(!d$P<. H|$ 9HHC D$(H|$HHt$Ht$ c$Pt <.H|$0t(Ht$ H|$0c$Pt<.H|$8t(Ht$ H|$8tc$Pt<.DL$(E:IHD$HIHCHIrfD$cfA|$SHL$PLLLD$b8H|$ 1HHt;HIɺ 1VL1LHXZL9RIL1L 1HL9HC0HJL LHHD1ɺ PATRfHs L}HHDIQ 1VICHHt H9L(?"Hs0HK {HIDHIDH APILTVQ1HCHtHHt H9tLBL>"Hs0HK {HIDHID薅H} APIL)VQ1UHs0HK L{HIDHIDRV QI1*Li!LJL@ HCHtNHHtFH9tALBHs0HK {HIDHIDH APILVQ1 L="fATUHSHdH%(H$1eAątSp2HHt :aL1ɺ1H5CsHH>3AtHH$dH+%((HĠD[]A\fDBAąuL 1ɺ1H5rfL| 1ɺ1H5rvf.HHp21 %=11҉HAąL1 H5qHAZDH%=p2gHHp2PCHtc2fuD%=A#Hf.Hhu1E1LH5p %=D%A#EHE111ҾHOAąL1H5kpp W@LeH5LtH5LI1E1Lp2LH5o 0"HLJHfHLJff.ATSHHHtLHL[A\fDL%"Mt4HW8bL!IHtCHt_LfDL1ɺ:1H5 DL1ɺ=1H5 afHHt8H9t3LHB1E1LiH5c "L y8"SHHHt'Hǃ[DATL%UHH@ucHEE@HtH9u>L 8"1LL E`uyH]A\fLHf.k8HUHtH9ufL 7"PHS1PL%j1LL XZHHEHx{H}rHH]A\cLJf.AVAUATUSHdH%(H$HH H=w11H$dH+%(H[]A\A]A^H IHպLLHL,T$==ILHLY$=t =SL1Dt$D$訄D9A9H9HH-H9$HRHMRLAVPefL1Dt$D$4D9t[A9tVHtHHt H9H5"HMRLtAVPH5&1zH `LeSfL,1ɺgH5A1+f.HR~L1ɺ~H51f.H4"?ff.@HHdH%(HD$1HtH1HL$t<|$LUKSt"HT$dH+%(u@HD1f|$uL$1ɺH5*9ff.fAWH5RAVAUATUSH8H|$dH%(H$(1HD$ IH$ D$LH@HE1B\-E tքt=L8HADG u^#tMc{ILVHtaH5ZLty H5WLED$D$`IIkJf.}LHHD$t)D$ D$@D$ \$ \$ tH5!TLHHD$Ll$ @ALHAMc117fu<"tPu PπgHcуD IA1BD5< t't#HAWf tfu <"u'>|$ JHt$M1P1L H5LH=+H#YHX^Hu HHt5,tD$ tADfDfDH=G#H5G#L1ɺH5W.ifLhuDH$(dH+%(H8[]A\A]A^A_fL1ɺ1H5DHt$M1PL1H5xLH=F#LpXZL+ HHt;AAEt"D$ AtECD5fBD2fDH=F#H5F#\$9L1ɺH5D$ HD$ HzLHHILHLHH) H)H/HD$ HzLHHDILHLHH)A H)HGD$ ۉADDD$ ECD5BD2ff.AWAVAUATUSHH $HfdH%(H$1H|$)$HHH=&H=#HHtjH3HtMx.tHHHPL P1LYH^NHHuHi@HD#L5D#L8L9HL-D#DI]L`L9ulfHL9t[HsLluH]L9u@DHHL9t-HHuL>uHEHUHHBHHL9uHILM9tIrf.L9tUHC#E1LeALLH߉CHmL9uEL11H5d6H$dH+%(uVH[]A\A]A^A_8L 1PH$LpPH51XZ|(AWAVAUATUSL$HH $L9uHH|$HLD$0dH%(H$xAHHD$HF8FIHH$p1I AȾHAAHA H"HD$H1L$p!HLH/LƄp!L@HHL$1H$pHEH|$ &VH$H|$ HHD$(AąP$%=@RH|$ HH@HHx.LxuAtހx.uA.u AtfHD$ML$pH/LHp1c Ht$(LH$IHI HAA HD$L$"xL@Ht$L5hL1VL$L1ɺL1fLL$ L11H5DHxOL1ɺ1H5bf.HHH9LHHL$AVD$LH5yP1AUFH DL!1ɺ1H5EE1LHHt H9L &"RH51AUL^_L &"5@L1H58\ $p1MIH H&EH5HDHAPLPZVH5EP1H HHt H92L %"HL5D$dLFLPD$LP1AWH="<#H HtHt$\|HtKA# 8l X1LPHLPLL$01QXZE-D$\H\$0AHH H%H ЋT$Ht$@$p1Ht$@kHPH-PHIPMLW1Ht$`UH Ht$@PL5ULL"HHH9LHL1ɺ1H5vL5LALHIHpHDHHH9t}LJPLDE1AVD$L6L5PL1AWUH HIAQ @L "" HPHPAWL !"{_ 8$p1HMIH@H5QHDAPLUVH5PFff.AWAVIιAUIATEUHSDH(dH%(HD$1L|$hHT$HD$T$pAED T$`DT$ u1LH=L-LJAULPH51XZDH[]A\A]L "L "P@UG@HGD~6GDtu0H ]ft]DtԅtHEHtH9uzL #"Ld1H5DHHtH9u3L "1LH51]@LHfLHUG@HxqGD~GDuH8]ÐHEHt7H9t2LHL1H5&JL )"HHtH9u3L "1LH5Կ1]@LHf.AWAVAUATUHSHdH%(H$HH9L="AAHtLxDE@ExkEDE`ut<AEDH$dH+%([HĸD[]A\A]A^A_@HEDzAŅg=9"E`AEt@n lDLDD1DE@U`EƒEDD‰ƒU`wEumHY MH5iH /HDL^HDH!HHEHVH5 QP1,U`H AU`@LO8LpH5˽LAIH % Ѓ=8"9HA1P1E1AYAZCK8HEE`@D1LHL$oHL$E@e`ߺwM1L-H5 4U`Ѓ@n}@Ht$xHE8H9D$8M1L%L LHAŅE1KL1ɺM1H5s"f E`AA@EtqH1H56MPLY}1HY^M`E1ML11TH5 HMPL1H5XZA$M`ALHD$D1HL$E@Ml1LCH5Cgf1MFLH59EDU`L1ɺ1LYfAU1IպATUHSHH(dH%(HD$1B5"HH$Ll$H_HDHHUHH9HRHML%.PL1LRS94"H u}@1HwHYteAHD$dH+%(H(D[]A\A]DH"b@AL11H5f1ɺLL]{8dHUHtkH9tfLJH1ɿPL1LAUS=H H$LL11AL "RfAUATUSHdH%(H$1HHHHG`THH9LhD%4#"D9eh>1Hھr?gHHM1LyxH HHEpDehP1H5,XZA4fHt{H9L1ɺ>H5Ϸ1E1H$dH+%(HĨD[]A\A]fDL1ɺ]L-" @L%"D-6""D9mh8HLHD$0HM1LQH HHEpDmhPfD1HLAąa}@1HھrH!"H1L%öMH LLHHEpUhxP1YH^ LL{11{Af.L` 8TA<$MIHH&.HDHE1HH iAPH5QLECP1H E18H1PLMnH51_AXL1ɺh1H5{f.HupM1LM`1H5AA_HEpHA[[bHMup1L AfD8HM1PL-n1LLAYHAZnHyPHH-#H#MAA<$tZnHPHtsHt$LH#T$HT$dH+%(FH(]A\D1L?1ɺH51L!H5H=#PH=!#1H#H#^H=#D$ @PD$ H#3@1L H5b41DnOH5H~#fL H5H61*f.ATUSHH $HPH !HoLG8MI dH%(H$H1H\$@AIAHAHA 1H5HHHHH¾@HE1<$LVM-AHJu&H$HdH+%(HPD[]A\k8MI1PH\L3PH51XZHEHt7H9t2LHL׹1ɺ@1H5fE1Z_DL 9"IL%1E1HH5$qE1fAWAVAUATUSHH $HHt$I$dH%(H$1H$HvA<$,H$1LHH|$ VH|$ H51HD$HFD$Lt$0fDHT$PLH21ۀ|$0 LHT$/uHcH< tHcL 1Iĉ=vJ LHtDHLҸ1ɁM1UH5_AXt$?HcT0tHc@AHcHu uHT$/HcHcH< tM,EeAmu A}duHT2HDP LH=puHT6HDP KLH=ͧ?ufHT4HDP LH=u5HT4HDP LH=uuHT8HDP LH=MuHT5HDP WLH="{uHT4HDP LH=JuqHT6HDP  LH=̦u@HT=HDP Asu A}duHT2HDP iLL=L 1eIfLXHI9rLLcIA?uHD$HHX HLt$(ffDL{LH[HH LsMI9rLLCH[HZ;tH-s1LKHTH|$fH<$GH$H$dH+%(qH$HĘ[]A\A]A^A_f1|0BD$H $HcŃL(H$h TH$hH$h H$hH$h`H$h#H$hH$hH$(m1ɺ1LH5TPH $HA$H$HH9u1MH-LUHH|$H8Lj1ɺYPHxPLL$01HXZrHcH HcH[TH $T$1MH-xLJ]HeH|$87L1ɺaPHPLL$0^Lt$(L1H5H|$9|8$HH iIHH5HDHnAPL,QPLL$@1H H8[L1ɺNPHPLL$0H$LHcLt$(L$LH58$HH #xIHAQHDAPL+QH5PLL$@1H gfAVAUATUSHH $HLG8dH%(H$1G\HHD$t6EAH$dH+%(HİD[]A\A]A^MAIHI L$AAH !H!LA 1hxtHt$LAąt C\AEZLt$1ɺLLy|$tj 1L[C\ HHtH9u3L !HLG8MI dH%(H$1AAIH$A 1HAHxBHHAAt|H$dH+%(HĠD[]A\fDHHt8H9t3LHL 1ɺ)1H5E1fL i! E18qH/I1PHLPH511+XZ8ff.@S1HdH%(H$1HHOtcE1f$Ut$H$dH+%(uqHD[DHHL$@uBDEHH9uLD1ɺ]H5]YE1@E1|AVAUATUSHH $HH $H`dH%(H$X 1IH~8HHHH@H H% щD$ L$FbuHcED$AH1u=HE8AHH$X dH+%( H` D[]A\A]A^fDL$PL%A!DL$1DD$ LLHHl$PLH!iHHDPHLLIHs1vH5kLHHKLt$H¾@L>HHL$HT$ L1H5 Aă^D$HcT$ HHH H H%H HH8-4M1PHLPH51XZifșAt6)HAHcHH H HH H(H;AfML1ɺH51E1@HEHtH9uBL [!L 1ɺ H0HLA1ɺIDLHf.H1H5MAVL/,1E1Y^@Ho8$PMHIHH5HDH'E1APL#SP1H $8t=WM1PHo"E1PLҿH5=17_AXML}11 H5E1cAWAVAUATUSHH $HH $LD$dH%(H$HF8=!HD$IHՋOHIILH9 H9HL$HH UL=A!LLA H1AƾY^$Lt$ LLlH5 LIHL@LxHgHT$H4$L1LÃ!L qH$dH+%(HH[]A\A]A^A_fD8[$MIHH* HDHH=uNAPH5qLM!WP1H IH1LH5q1)f.1IALHfLAIL[11۹UH5%q耿1ɿMqLH5p1TL@8$$MIHH HDHH }APH5pL QP1H 'HT$HD$IIL@I$HtL9u:L {!AVv1LCUH5 pdXZDLHML11lH5o1'qfAWAVAUATUHSHHH|$HdH%(H$1HF8H%D(u FbHT$ H{AąLl$ H|$I؉HLֽ0fH=#)D$0)D$@)D$P)D$`)D$p)$)$)$bHl$AHD$HHD$HD$L-#LxL|$(L;|$ul@M?L|$(L;|$UAGMOI_LGLMLAG6DLLw@HHtHxtHD$HHH;D$LHH1SLH5_XZAH$dH+%(HD[]A\A]A^A_L@HD$HL !L1ɺnH5@=<"E1|L1ɺ1H5ݏ读Sf.HD$@`@uHt$H|$OHD$@` uHt$H|$HT$0LD$(!aHT$(BLbHZLGLGLA4H="DL>HHHxGf.L !LHHHt_HxH5UHHtH5~;H{H5sH1uPE1AL11ɺ1H5rDdf.H(W AdH%(HD$HF8H%H9t2H9t+WH9t#WH9tWH9tWH9t WH9t E1HD$dH+%(uADH(DHT$H|$atHD$H|$E1H%H9AAWAVIAUIATIUSHH8dH%(HD$(1HD$ HD$HD$HHžH H lHHL$HT$ HH5NoHL$%H|$L|$ MtwMHL$tLLHL$MHHT$H5ʐH|$u H|$VAEL|$ HmMHLD{ILe1ɺc1H5 MtzA$AHqHD$(dH+%(H8D[]A\A]A^A_H|$HHHDSp1MWL"1H5菷XZADILΡ1E1CH5ZV`ILi1ɺXf.IL,11SH5E1  @Ht 1H|$AEAEL|$ H=ˎ"fAVAUIATUSHH dH%(HD$HcHD$HD$"HHžHi HHAąALt$Ld$HLLH5lH|$Ht$H[LLHH5EFu H|$LLH5.H!E1uLl$MLLH5HHE1H P I1AVLH5[AUAP1GH D="M麠11ALWH5 8 H}HD$dH+%(OH D[]A\A]A^fH|$5H|$1 HIA%MEDIH MLΞ1E1H5ZVT="M麖LU11H5&"8 H蓿fDML1E1H5޳HVH|$ 1 @H|$11IH fAWAVAUI1ATUHSHxH4$<H$L$DD$DL$dH%(HD$h1Ž HAHD$`LHDHAHHHPS$PD|$0Lt$ EL8H u0HD$hdH+%(+HxD[]A\A]A^A_f.HEA LHHLHPS$PͽH tHEALH~LHE1PH^S$P菽H APH $HD$,HHDHH9>H=!HtHxHHHL5͆HHHD$ f.HAąL|$81H5gHHD$0LHD$8HD$@HD$HHD$PHD$XHD$`L|$8D$tH5LrjD$tH5uLTL1HT$0H5cH&.$LL$8BHAULӛ1L脰XZHD$ AąL$ AAD+ tGAHHHNE1ɺaAH1PLi1H5XZH艻4@1LH5HL1HT$0H5H.$LL$8HAULۚfDHL$`HT$@HH5 tg$LL$8HAULL 1ɺ1L#fDHۇHD$HH|$01 H|$HIHT$P1H5H6HT$X1HH5N HM1t$PLL1t$Ht$pt$pt$X舮LL$hD\$DH0Et!LH5QLL$LL$D$ $u&HL$0LL1H=˚>LL$8HD$M=!L !uUL1ɺ1H5E1 H$hdH+%(HxD[]A\A]A^A_DIH\$`HJ8H<$IHHHLL$AL2HL$L_L$HIpHl$ L@HH LH5 IH1ͷAƃL(̾8I1PHLPH5~1XZ1ɺE1LH5~ΩfL1ɺ1H5~蟩f.H1H5~IUL1E1dY^DE189I1PH0VLPH5"~1_AXoLD$襽LD$8H$t>I1ɺPHVLdPH5}1èAYAZE1HT$HLgL !tHL$LLHLAtFLH@IHH$8tDI1ɺPHzULȥP_L1ɺ1H5}ff.@AU41ATUHHdH%(H$1ILHHݻ}@1LDsE1䃼$xA1Ht.H$dH+%(6HİD]A\A]L1ɺcH5f1AL11WH5>f蛻8HUHH9urL !H H5A9HEL !H9t LJDHZE1PHLPH51Q{H fLJH 3A9tH 8fDL 9!H "H A9HD茻ff.AVAUATUSHH $HH !IIIHI IHվdH%(H$1A@AA H1L8pLIHLHPLH.uAytۀx.dHI1SL5~L~L(AYAZL,1ML~1ɺ^L1H$dH+%(H[]A\A]A^Ay.`Ay&PDAymI1LHTH|LL5}}HL~1IS1ɺ\L@_AXAIٹ5L̑1H5} 1fL5h}1ɺR1LLܣk8tnM>LH}L5}@;L5}8}1LMPYHQPL1dY^DH1ISL|<H5|,A[1[0f軷8YM1PH7QLPL1XZ?ff.@H,LWjDL LXHAWfAVIAUI1ATMUSHH(H $H|$ >dH%(H$1)D$HH8`L|$ǺD$ Lx|$ ḪHc1LLH5޳LD,]TH-{LHҳHH$LH:H<$yAMtMH-{LH芳HALLHSH5)LǯD˵8I1PHXLMPH5{1_AXILz1ɺOfILz1ɺG1H5z謠1H$dH+%(}H([]A\A]A^A_ÐILN1ɺUDI1ɺaLRH5QzFH$f.I1ɺpLazH5zA$UI1ɺ[LzH5y֟H$9f.I1ɺvL H5y螟A$H|1IATL1ɿH5iy^XZA$fH1H5IyILt$Ldg1AV!AY^qAWAVAUATUSHH $H8dH%(H$(1HH=*yID$D$HIIL$ fDLIHA.tIoH虮H uE1۹LHLغHULL xL訵L$1LD$,HH|$0D$(H|$IHLLAZA[HT$Ht$L $Q9ML $tLL5L $HL $足IHAoGHcT$L $@ oMH0D$ $5f|$ eL$L 11t$MAUH52w'H;_AXL$HCILICLL[|IHdL0MHlLDHE1H9tHAH9uH11AUL wH5v荜XZH$(dH+%(H8[]A\A]A^A_DHHH H H%H Ѐ$ICI{A1ҹLL$6L$H|$ AƃfDHt$1ҹL$IL$HrAƃ@ef.K8蔭1H5uL uPHIPL1sY^@1輰(ATUSHH $HL%uHpLdH%(H$1HHIH莘L%t1ɿ1ILwuLϚH觩u#H$dH+%(}H[]A\;8tI1PHINLPL1fXZfHMLH1SH5It17Hl芯f.AUATUSHH $HL-tH>LdH%(H$1HIHIHYL-sI11L\tL蚙Hﺀ1膫Dž7AH$dH+%(HD[]A\A]ÐA$t5HMLG1SH5sE1H또{SLӇE1AUAH5r1Θ_AX]fD[H1LILksE1P1葘Y^!f.8dI1PHLPLߕ1KXZ蟭ff.@AWAVAUATUSHH $H>H-[rfLf8H|$LIHH$H$ML$H dH%(H$1D$<D$8)$HHLLMEH IHDr1DD L$ALL$l$(ȔAÅ=H $H0HcD$1H)HqL萔D\$A0A,HpHD$HHH9HHLt$@1DD$,H_LD\$ 2D\$ LcD$,x,HHpH9gH@HMLXq1PD$8(PD$,PHt$81BH 1L*AƅOufD)ŅHcLDxy菪HHHt H9L !R1ɿ1AUHt$(L6谕AYDAZd@DAt^HI AWLCH5ko1YXZ1H$dH+%(H[]A\A]A^A_@裤AWLUA 1H5 o]1A\fHt$H HH9LHHHH9LH=c!D\$ LH1ɺt$D$8PD$,PHrnHHD$81]D\$@H E1DifL )!D$(L1H5#nPD$PfH!@H !-@HmE1HD$f.kD AHL$H9HH9wLHAT1LXAUHt$(.mA[1[Ic1LLH4nH)LΐD|賧8M1ɺBPH@LPHt$(1_AX@Ht H9tHXH!4HL܁AD$0H5lPD$$PS1~H DHt[H9tVHXݡHLUATA.AUSHt$8fLHUL !@H!L !M@}أM1ɺ9PHL\PfL$@1H$LHT$8HHHt$H9t9HXHLATAct$SL ,!H !艤fATUSHH $HfL%HiH/dH%(H$1HH$H$I)$HLH:L%hI11LitL{HHIمtA1Li1ɺ{LL1H$dH+%(ufHĠ[]A\1ɺxLL7i fDHp1MSLR1ɿH5g׍X1Z,ff.AWAVAUATUSHH $HH $HfHɆH4$IH$IdH%(H$!1D$PD$,D$()$)$)D$0HH$)D$@HH$H \hH|$莊Lʉ1ɺxH|$H5p觤HD$HGL|$`H\$0iD$LT$M11ULN~H5ft$|I<$AYAZLT$ID$M"IBLMT$HT$@LқHfAofAoWH) )S?H L$H1SL@LL >fL$0H$A1LHHIHLLD$<D$8XZHT$(Ht$,H$Ht$ tHL٠HbIHfofocHcT$,X `0D$( tHHH H H%H IB$ CIzA1ҹLLT$LT$H$AƂ1ҹHLT$I轠LT$HAƂ@LN1ɺ@H5od1E1ZH$!dH+%(Hĸ!D[]A\A]A^A_fDI$E1I9t@HAI9uHL{11t$H5cA݉_AXH|$ nc8講1ɺH5cPHPL,PLL$(1草Y^,fDLL1ɺ1H5oc_I<$HI9tHGHCHPHHI9uH|${Aą軝E181LPHH5bPLL$(1XZL1ɺH5b蹈UAUL;z1SLL$H5b興A[[!LL1ɺ1H5ob_H $H5ʈH=ۈ薝fDATUSHH $HL%ecHPLdH%(H$1HHIHnL%a1ɿ1IL$cL诇H臖u#H$dH+%(}H[]A\8t_I1PH);LPLڄ1FXZfHML51SH5)a1Hljf.ATHIH=kbUSVAEtiH-{1LH5tYHuLH=7bAEt)1MQLxH5[r1[]A\HcH~{H[]A\fHUH5H裛tnH5aH萛AEtRH5HtAEt6H5`HXAEtH5nH<]1DATUSHGYuHoHHKPHGv ǂG1LBI1HH~L܂xPHSPHGDGL[]A\fHHH9rH@pHhHa@HCPHE1LwLU1H5ZXZff.fAWAVAUATUSL$HH $L9uHhfH|$H˹IH$`!H$HdH%(H$Xa1)$P!HH腔L5H=_LL|$0袏Lހ1ɺ HH$P!H$H@HPIHtZI}H1lY^fDDL$h11LH|GHlMHL\i1ɺ1H5AolH$dH+%(HD[]A\A]A^A_H@HPXQHCX'Hh8C\ f LKHL1y1H1ksLHCXE1MH$ E1fDHAŅ HKXH0H- @ SD$(D$D$ D$fDIEPLa1HAuHLpvDD$L-dwD$tL-5aHHPL ?1LbjXZL$IMkID$XHHAIA,jM EuAZLjyA[I11IHiHD$HHNpL<1ɺNHIL[LT$MBMnIPLD$(H\HH5SLT$ HT$qpHT$LT$ 8LD$(I}HT$XLT$D$ Ip诇LT$L$ IEHt$H|$XHH~GFLHD$x|$(H8aD$D$Ht$HHLT$=LT$HKXD$(D$H D$ D$zt$HH;D$tHLni1ɺ2H@LHHLV1ɺ=1H5VYCH`cLT$H1RH5WL fR]LvYH|$ hY^HHD$@Lp 1ɺ"HILh1AYHD$@Lp$1ɺ$HILg1YHD$@H@DHHXAtAHqeAt4HYeEt(1LP1ɺJH5gXH7eILg1H&1XHD$@H@xU1ɺ(HILg1eXHD$@L2H@DHEt8LdAt+LxP1ɺ$1H5!gLT$XLT$M1H1LEg*WHD$@AHA,IH@M HpjEHpcAZLgA[I11,HWHD$@H8^11HILeLT$LHH1MWLT$1HLeIH@LHH1WDt$L lDl$EHCPE1L WcHHHpHH;D$6qHHHH9-qrTH1HDHHHIH9HHtRH9HxfH*MGfI*^Y,ȅhuHD$L׉HzLR1ɺcH5SUH|$IELT$(DL ,HxARjHt$0_aHD$ IEDL ,HxHD$h$H0aA[HIXt$1ɺoAUI1LMH54S$UHD$hL\$0LXZLT$(LAfHL H*XHƒfHH H*Xs$jL$USHH\$ HH8a\HHxHHHHǀH1H)HBHD$(HBHB(HB(HHB0HHHHBHHHH[]@H-L*M1H !H11LP:ڀ!H1[]\ff.AVAUATUH(D%Z!dH%(HD$1Et"D%"t$HD$dH+%(H(D]A\A]A^ÐLt$Ll$t"AHl$ LLHH=DcPH]`UDO HEuH]`fDLJ1H5cPH]`UDO HEuH]v`fDLJ1jH5bH5bOH]_UDO HEuH]_fDLJ11H5XbOH]_UDO HEuH]_fDLJ1)H5J[LOH]S_UDO HEuH}6_H]-_DLJ1LH5aNfUDO HEuH]^fDLJ1DH5aNH]^UDO HEuH]^fDLJ1/H5Z\NH]c^ATHKdIHtHHla L h1ɺiID$ L H5>`1ML$(ID$aMLA\LJ1ɺc1H5`MAWL`1ɺAV1AUE1ATUSHH5`HH|$MHH$H-0L%`L=(@L3HLbtnLLbt_LLbtPH5a`Lbt=HD$1HH@H@PHxZHtJH $HtHAMH$LDDH[HsHD$LH[]A\A]A^A_LwI1ɺ"H5_LH1[]A\A]A^A_ff.HI1HF1xfAWIAVIAUIATUSHHD-!Et 9AHkADžH]HAMtH{(LGauLLHLAąt H]HHuAHD[]A\A]A^A_H\lHW HHIUHL9LJHH5 PLG1A'KHk^_H]H#^AfL(\tIDžBAHvV HHIUHtL9u7L w!HL2GPH5^1JXZLJL mw!"AUATUSHLnHtIHIH9t)fDHkH\ZI}HP HI9uH[]A\A]f.MeA$I|$ tk1DHHtDHHYHuI|$ AD$9vύP1HVA$AD$ID$ H[]A\A]AD$ff.fAWAVAUIATIUSHH^H|$HtH~(H^M<$M9H-"v!MtIoHAYHDpDH;DHHHt3H@H?"H9H+"H9AHHCH|$LLHAƅ H-" AD$dM,$M9uDMmM9M}LXH;HLPuLEE1H5[%HWIT$8HE1LDH5W[HIH I%A к[P1GAXAYHD[]A\A]A^A_f.HsH|$LLHH[]A\A]A^A_fDH-ќ"@I$I9;H2H@HEH5ZPLsD1|A,G^_YDL t!MtMOd1E1LCH5IZF@L s!MtMOLC1jH5 ZAFI$HtWI9tRH@EHYL YLYLDHPH5Y1PFZYfH)s!Hs!@ATUHHDO LgEu5I<$ID$HPLUHH]A\Uf.LAC1H5 YEf.AWAVAUATUSHLvbd߀H A<L:HL9E1A@IwI~賰x Iv#AM?E1L9uDEtlHKd Ht H9L q!1LkXH5QD1(AFƒ <fH[]A\A]A^A_@EuuH=!uMO1LWH538DIGIHBHHHII_LxL;{LH"1LA1ɺH5'PCANB1LA1ɺH5OCAFAFfDUSHH $HHNdH%(H$1HB0bdHHtf@uULC8H$HHMAII AAA 1@x?HHXuXH$dH+%(HĨ[]f.LlV1ɺ%1H5UBDHHtH9u;L to!1LEV*H5T`BKd1gfLHWDAUAATIHUSHHERLHh HIIHtnEHUIHH UHVLHD1r?xHL[]A\A]ù]1E1LUH5UALU1WH5U|Af.USHHD "bdEuH[]f.1HHdt̃t]yHHH9LHL?1uH5JS@Kd1@f.DHAAHH9Hp1H-RjL>H]@_AXHHH9LHlH1L>@BfDL l! @H1j5l!H-ORL'>H?Y^kHPK HHHHHt>H9t9LJQnL4>HP1o?XZL Ql!)L El!x{USHH "bdu H[]DEtTAHJ I<ILc>1H5eQ>H[]@fHHH9LHL=1ɺ/1H5Q>UHH5}KHH5H5HSH5HKPHHuUHH9LJL=1UH5}P=Kd1L j!-@HH5eI HHHtFH9tALJQWL=PH5P1=XZL ij!e@L Yj!AUATAUHSHHHdH%(HD$1bdHH$~u+HD$dH+%(HD[]A\A]fHHtHH9tCLHL-xOL=1!L<KdCbt H<$HuE1L i!HHH9tDHPHtH;z8tHH9u|{HHH9HrH$L GHHH  HtH8HH9LOHL[<1VLQ1R+;D%"H E!HlvmdevicH9ez!tDLd<1ɺ/1L;Ԑ"lH5ph!8L dh!qf=z!esu=z!PATUSHHHz8bdHHHLcd$HЋU H9tQUH9tIU H9Cb A~OHK8HH %H 1IHu/HHʁEH9t0Hst/=d![]A\@fHxtċHE HHHHHt H9@L )g!Q%LL;PH5L1:XZKd1[]A\fD[HS8H(HXq:fDHIHL`H5NLFHHC8U H%H9t/LH5MFHHH5MNHHtH9u4L %f!L:1#H5K9@LHfLJL51ɺ~H5 8=L51ɺ1H5 8ATSHH(LfHz8dH%(HD$1bdHD$ tA4$HT$ H׮AątPHt$HCSHf!AH9D$HD$dH+%(5H(D[A\@CdL$ €t HSdHH9LHL(L1<H5yJ7fHHH9LHL81H51JS7KdE11@HHtH9ucL d!HHaT"PLK1H5I6XZL c!m@L c!@LH%LDSHH $H1dH%(H$1IgdHLHLHB<$HD$tB$HpH9$H$dH+%(H[f|$MuwHHH9LHLJ/*DHHtH9usL b!LE7'1H5H5Kd@1[D=AHHtH9u;L db!L%J6릐LHf.L 9b!L@LHJDIHAx Wf.HHw DHATL%I1 ULLu6~SDOHE4CH{4LHt"SH1H<@Hkc[]A\1LVIL溂W41ATSHHGP;Ww/HSA CHSCHD[A\D#Aąt CL01ɺ1H5H3ff.fAVIAUIATIUHSHHdH%(HD$1CA1EHc]0H|$Hھ ?HHuD.FH}LLCMt7U0ЅXIHu C~HuLEHu BHT$dH+%(uH[]A\A]A^fD1H|$`HATIкUHH(udH%(HD$1I)H}o$HAHHD$Ax EP;Uv7HgAąt@AHD$dH+%(uxH(D]A\EHU(Aąt0AL.1ɺ1H5F1DL.1ɺ1H5F1x Gff.fATHFADHxDt DA\AL9.11ɺbH5\FL1DA\fDATSH>tAHD[A\HFPH~ Ho@hoHxN'AąuHCPHL2H5ELsH10XZfDAVHHAUATULE1SHLIC LkHLP AXAYIHu Ht}t [L]A\A]A^ÐImHHIŋC )HHEH$H9HLHRL5E11LL1/HEY^HH9LH11L1L/MIMME{t$T$hA @>/,w!w!eA1EL6>1ɺH5D(DU1HHD!L$H8F>L$vHD! L$H07t$EAyH-5EAnH- EH}{H}ul1L>%2H5A%w'v!WHC!H=!=H4?nS*H)$)D$uTIrLh11H50U1H$(dH+%(H0[]A\A]A^@Ll$ IHLe*x/H+H$HHtHII)IwILHL)HBD4 H$HLL]H,$D$ DI}LT.fAVAUATUHH $HfdH%(H$1L$IHH$IHLHoD$HD$xe$Au-H$dH+%(uhHD]A\A]A^Ht$ L)xHHLLt1ɺ1H5/E1-ff.fAWIAVAAUAATEUHSHH0HtHxJ(I0fH@I?HHt_fH@I0}AuHD[]A\A]A^A_H,HCHtKDsDkD#f.L.11ILJ0H5+E1~돃9E1LeH5l+Yg@AVAUAATIUHSH8HtHx6'H8fH@H}HHtZfH@AH8A<$u[D]A\A]A^L+HCHtKD+D[]A\A]A^1E1HDž8L-H5*n땃E1L}H5\*Im@AUIATIUSHHdH%(HD$81HGHpH$HD$Ht$ HD$HHD$(HGD$ P`HHH HH@ H9HALE1E1LHIHtTHLI9t fHSLHHI9uHD$8dH+%(uuHHL[]A\A]L$1ɺI1H5O)7HEHE1H@Ph@C1E1LZH5){O*ff.@AWAVAUATAUSHH(dH%(HD$1sHHHHH9tkHHH9tOHPHH#zXtLLE*L 1ɺ1H5A()HLL91HPHHHL9utlHL1E1Q'LH5'XZHHD$dH+%(H(D[]A\A]A^A_fHH{hH$HD$HD$HGP`LWHH H!H}HHLHI9uU(LkHEDLHDžHxHGPDAŅHL9LkIE`@atIu@HHaxH@|uH}(4HfH@ @LkHLhHL0HPHHH"fDL%&LL)1aLL1ɺ1LE1@IE@Ht HHtH9u2L >!L%%L1fLtfLJf.HCH@@HHHH9{LJLDH5'%1E1 NDL 1ɺ1H5$E1(HAŅH蕪AŅAHCH@@Ht HHtH9umL g=!L1H5k$SfDHDžL,H53$1E1ZLJL 1ɺ1H5$.L 1ɺ1H5#L _f.L1ɺ1H5/[f.L1ɺ1H5+f.H5H1oAąhL1ɺ1H5fDLt1ɺ1H5ffLL1ɺ1H5>_f.HU(AąCP1҃H5hH1Aą0L1ɺ1H5L1ɺ1H5Lh1ɺ1H5Z{LB1ɺ1H54U1HHcHT5ѸʸÐAWAVAUATUSHH $HH $H8dH%(H$( 1IH5uIUAG0IH\$9OAG0ML9Hl$ L5;I\$ HH QH{HP։$qI$H{HHHPHH$LAW(H$A1LLAG01HLfo ]H5`WfAnG0f89fA~G0PlHK@HH1HwH9~HVHH$H$H=PHu):f.Hȃ"t2HHH@0t<\u\HA1HH5Li-LAW(IUHC@HHH0HyH $ftqjH5(HHD$ HT$H $tKLAHtBMt=1H5YLL$L$1LH5KL HL3mHH;_H1H LHLLH1H5L|nAHLHH1+HHtHAG0PAW0H1LHM$$L;d$AG0PAW01HL>A@H"!@H"!Ht$HL$HH$H$HL$H=Ht$H9bHVYLP$L1ɺ:fLkH5X ~AG0I1H-/ LHFL11H)E1H$( dH+%(BH8 D[]A\A]A^A_f.1H5 LoH1H LH$L}1ɺD$Li1ɺH5]1|D $M$L<1ɺD $L(1ɺ 뽉$L1ɺ$몉$L1ɺ!L1'H5E1$L1ɺ-U$L1ɺ+?$L1ɺ7)$L1ɺ<$Lk1ɺH$LU1ɺ?$L?1ɺ>$L)1ɺ2$L1ɺ3L0kH5AG0H{$L1ɺLT$L1ɺC>(AWAVAUATUSHH $HXHnXdH%(H$H1IHW(sHSHH5+ L1AŅSAG0fo H{ L$@LfAnG0f89fA~G0IAŅiLH5PL1AŅJHLAŅKHH;?HHHHtH5L1"AŅC`[  m 1҃v H5L1AŅPL1ɺ1H5)DAL11H5H$HdH+%( HXD[]A\A]A^A_L|1ɺ1H5nDLT1ɺ1H5FgDHCPHHt:u-HHM?DH50HH5DL1ɺ1H5fHChHt HPH5PL1RAŅSptGH5 L1&AŅu/L[1ɺ1H5MnfStSxx>H5L1AŅu&L1ɺ1H5,HH1HL$H9tfDHH9uH5nL1dAŅLAW(AŅHL%&H9l$cHD$@H\$(L5hHD$ ːHD$(D$@E1HD$8H@P\$ HD$HEL`XHD$ HD$0AEIH@IHH@tItHHHt$81H|$0HuL1ɺVH-1HL1ɺ 1HE1L|1ɺ1H5nf.L AŅL91ɺ1H5+LcH5L1AŅL1ɺ1H5 !L1ɺ1H5L1ɺ1H5HHHTST$ 1H5wLAG01Lfo H5 fAnG0f89fA~G0U AHD$M$HLH1\LAW(M(t*HD$HLH1HHEHL$ H5LHP(1FHH;SHEH@ H@HtLHЅAG0PAW0|L%܋1LL HmH9l$AG0PAW0mLL1AŅA!DH-L1ɺ[HfALH5LxAŅHH5L1%AŅLV1ɺ1H5HiL01ɺXeH-L1ɺ\H/THvH5L1AŅL1ɺ1H5L1ɺ1H5H-L1ɺcHL`1ɺ1H5RsH-<L31ɺ^HLqLH-L1ɺfH:L1ɺ1H5LkH5AG0ULkH5sAG0dH-ZLQ1ɺ`HjH-3L*1ɺjHChH- L1ɺmHA1\L1ɺ1H5,"'AWIH=AVAUATUSHHt$HT$ dH%(H$1 IH^sT`IGHHD$E1Hl$@Ll$`HHHD$H9uu)f7tEAH|$@L>LILLP/jHH;\$HCD HHAHD$1#HI?HPHH$@IHH$7HEMFIIIHtItLL)I)1I4 I49rEG8EHD$H-LHH1cAą`AG0fo ;LHt$fAnG0f89fA~G0AąLAW(AąHt$LcAą(LAW(AąHD$LL;1H5JLAG0H\$9OAG0HL9tsfDH{?StHsLrHI9uHD$HI9t/fDH{RuHsLHI9uAG0PAW0 L%1LLH-.L%1ɺ5H>L 1ɺKHD$HT$ LH8AąL1ɺ1H5FDEADADf.L1ɺ1H5~I?Ht IIHt M]IGH$dH+%( HĸD[]A\A]A^A_fL 1ɺ1H5{f.H-L1ɺHL1ɺH1E1*fL1ɺH-1Hf.L\1ɺΉDfADkfDL41ɺ1H5&GfH-L1ɺH+fH-L1ɺHfL1ɺ1H5Ef.H-~Lu1ɺHfLAW(AąH\$L%߁HHD$(H;`1H5KLqAG0H\$9OAG0HH9\$(L|$I@HD$0IFH@LhpHXpHD$L9E1fDIE8uH@HxHMdLd$0MmL9uMeI|$H|$0H$HH$Ll$0L|$8HLLHD$812HD$L`pL9tfID$0uKu!1H'LLID$H@H>LLHHH11M$$L9u1HLLHD$H\$`(HHx :7HD$HP(AHD$H|$HHPH1HD$fo HH5=@0Hfn@0f89f~@014HD$H|$A(HH59HPX`HD$H|$A(HH5HP` HD$H@hHt7HPHRHH|$H1HH5 H$HtH|$HH51H\$C0PS0TL%~H|$1LH<$4M6L9t$(L|$AG0PAW0~1LLAG0PAW0LL1YAąAG8ALs1ɺ1H5e LM1ɺ1H5?`H-)L 1ɺ H9@H$nH-L1ɺcHL|$H<$L1ɺ1HL1ɺL|$L1ɺxH-~HH<$H-_LV1ɺWHL|$jiH-3L*1ɺ*HCL|$L1ɺzvL"kH5AG0!L|$L1ɺ^H-1HH-L1ɺ1HdHD$HT$ LH8AąLN1ɺ1H5@aLXkH5:AG0L|$L1ɺg1L1ɺ1H5PL|$L1ɺ~'L|$L1ɺ{H-L1ɺHL|$L_1ɺL|kH58^AG0SH-L1ɺH/TH|$1H5'wL|$L1ɺGLkH5HD$@0yL|$L1ɺL|$Ls1ɺL|$L[1ɺL|$LC1ɺH--LQHL|$7?fUH-+"H|u+"]@8LAIVH511H0H1\+"]f,"ff.fATfIUHHXdH%(HD$H1H)D$HD$ HcHD$(*")D$0HT$D$8)$u HLHkuHT$HdH+%(u#HX]A\H|$.Off.@AWAVAUATUSHH $HH $HH $HL$HHIDD$L$HT$f.D$]LHI.11%1H-LH|$<6AąH8HMH$IH QHAPLQ0HDSE1P1H md@ATUSHHH0DEHxHDg!ETAąu8L|1ɺ|1H5f.HH0Hxu8C(HL1H-LPLH1"HZYHpHxˋHHHHH0HHpD@AąHK`AD[]A\DHK`1A1LvH5D[]A\@t1E1LLH5aN@L1ɺ1H+afDL1ɺ1HE16ff.ATUHH!u~!u!~$AE`t)cHD]A\AE`uHHtH5tHaA HD]A\ff.ATUSHH $HHdH%(H$1H8HHHHG`LI1HLWHH}LO"E"\IH@(9E(""AD$`RLzE`u,HHH5H萿u$L1ɺH5  DH$dH+%(H[]A\D@u1L1ɺvH5HE@fHEH1ɺLH5H8LH1fLVfD1HNL1ɺH5:'fI$HtH51LvL1ɺH5R@^"KDHUhHEpI3T$hI3D$pH HUxHI3T$xI3$H L"vYff.AWIH5IAVAUATUHSHHhdH%(HD$X1E09O‰E0AOLtH 01AUL=LLLL+Hs_LAXHyAą^|$ et8HʼnHsL]AąHs MCL1L診HsLY^2A.f.L11%H5l\H$ dH+%(H( D[]A\A]A^A_ù1E1LH5 BD$LDL1ɺA1LӹE1oA.Lt$fD\$ f1ML3L荹LtH8^ML$IHH%HDH5APLVSP1&H DLKL-ֺL%ILH LA9:IEHAPLQP1ĸH L}LKL<A9MDHPH)PATL1mH @8DEMLPL1s-XZL%H8HL=ML$ILARHEH AP*QLP1轷|$,H p}$,LIDAQMPH"PSATD%!USHZF(LEt^H1ɺTPH-<L71H%H{AXAYH{AD[]A\fH \PH-L1HĶYLK3 ]H1Lz蝶H{H3^_w"8kLKH_PL13TXDZ[]A\f.LKHL1 W8LKHIHȷHA9H iHDHXE1APLQP1H D[]A\DATSH8HhIHt0ooKHoS P HC0ID$0HL[A\LK1H5L<f.HLVM2 001HfAWAVAUATUSHH $HHjdH%(H$1HcAąt8Lm/LLHL`MDLLu:AH$dH+%(dHD[]A\A]A^A_LM)uHXJ#H=ILLLL-/K<&HLH 1AVLMLLD%|!LEt,L1ɺ1L迳 f.H}L78LLP1AVLMiXLZ_f.HM1AWE1H52L Y^t@SHHZdH%(H$1H{?u\H;?u,ײH$dH+%(HĠ[fHH;x|H;HxH{St 8SLKH&H fIH'A9HDHAPLTQP1H5#H 168L HH eIHA9HDHAPLQPATUSHn HLe H} Ht*HL9t"HGHCHHHI9uH}0Le(Le Le0Ht+HL9t#HGHCH@HHL9uLe8Le0[]A\AWfIAVAUATIUHSHHZpLrhdH%(H$x1D$`D$0)D$@)D$P)D$)D$ Ht8H5Hu o)\$ocT$)d$ .fDHHHoxhPh)|$oxx)|$ oMoUHD$HD)L$@)T$PLl$@HM@ILIt$ jLPL6^LѬ_H1ɺ~HUH@XHHD$HLc`H HCpF} Lo] oe0)\$@)d$PE1H,$DM LL aIHLhIUIEIMH H H\H1HPH9GLNRL PH5/1HC`EL$ HsIMMEHxpIUAH$ZYuH,$H{0Lk0LH0MuDHu:I9t5HfHHL9uHBHRH H HHL'L9t$HGID$L gLM$$L9uLL I I 軼H<H{0L`LpHS8LL(Lk HPHS8HH{ HC8HaMu&L9t!H@HHI9uHBH HL'I9t#fDHGID$L 觽LM$$I9uL I H~H{ L`H@CHS(L(LkL|$pE1HPHS(HLcHC(H$M9H$LIHL9L>fLH)D$pHCHPH$C t DŽ$HpH8Lu1ɺQ$H-LoH蔬L`11 H5sL?11HVD $H$xdH+%(#HĈD[]A\A]A^A_fDomou)l$@)t$PL @KLH5īL11 H5裫Lo1ɺH51肫E1(f.omou)l$@)t$PH$H}pDc|HtH5讹ADEtDH}@Ht$C|CxBALH5ͪL11 H5謪Lx1ɺfLk8Lk0?Lk(Lk 1ɺ$L-H5YND $$L11H51!D $s6ff.t=ATUSHHv@Ht#HIHHxxvpE|t[]A\øf.HC@HtHHt H9L o L1ɺ1H5n^A$@HC@HtHHt H9L  L1ɺ1H5A$AHC@Ht HHtH9uZL 1LH5Ͻ迨1LJ(LJhLJf.AWL1ɿAVIֺ$AUATL%]USHHLndH%(H$1HFLMHD$P1XZMMH-MIF@HtHHt H91H HMHPLc1ɺ1赧M^_Mu8H|$IF@Ht=IF`1Ҿ1HxMIF@HtHHt H9H> H1ɺ HPL1,IIA_YH9RH,LLcPI1ɺ<1IA[A]H9 HKhI~@L)L9LKpIHMH1IIIHt&ILH)L)L9 HIH)IMHtHHt H9o H0 HM_LPLQ1Q1UH S|ACxAHIIHDH9HSHIfHBHBIHD$II @IN@HtH1Ht H9~L G RLW5P1L5X1ZH$dH+%(n HĘ[]A\A]A^A_IF`1Ҿ0HxD,McM\MH-MIF`1Ҿ.H-Hx躑LHHII HLD11MMn虵 AM9ZI~@IF`1Ҿ-HxIF`1Ҿ/Hx7MML1H1MMfMHPHHDH9;H@HL41LP1s腣HCh_AXH`HK`HSpHt H4H9H9H)H9HIHDI@HtHHt H9ZL LH1L1@LNIH(HHH9H@HIL 1PfL1肢AYAZdfHY @IF@HHHH9LJLz*@A#@A@A11LHMݡI~@M|MIF@HtHHt H9L L8BML1L*1`IIF`IV@H5H@Hy1҅ILcMIF`M~@H H ?H@LHHD$8HD$8IHD$H|$H̀HL$8MIHL9LHQ11LݾRH51R肠A[XHD$8H HD$ 8LT$@H|$LH MHLT$(D$8;MLT$(HlIHL9LHARLQ1ɿH5Q1LT$0R۟HT$(H|$81H5'CAYAZDT$8EDT$(pLLD$H|$LLH iD$8xDT$(Lҽ0T$8MIHL9}LHDT$L11RH5PASHcD$H_AXDT$A yH ZDHcH>IF`IV@H5VH@HIHtiL1IHt\IF@HHHH9HBPML{1AWH1M`MAZA[DIF`IV@H5ܼH@HqIHL1IHIF@HHH H9HBPML31AWH1˝AXAYMIF@HHHH9HZIF`HH@DL ,HxjAHIF`H@D,DL Hx$AHIHt2D踨Y^ISLUH@LJ(LHH @H @L q BMIHL9LHH1ARH5ML0Y^HD$ HD$ HT$ H M<IH0L9'LHH11RLfH5rM͛XZHL$ HL1HHyIF@HHHH9HBPL|$(M11ɺHAWL^A]MXMHHD$ HD$ HHD$ HD$ fL @L _@H n@H @H N@L L {L RI7ff.vSHH@Ht6H{[鼡ff.UHHXHtsH}pAH]8AWAVAUATIUHSHH8LvhdH%(HD$(1~ D$ oF oN0)$)L$L9utQE1ID LL0KIHtH}D LKHAtmADHs@HH?HfHH`HPhI9H¨Hp LMAąI LLJE1HtH@HtLhI LeH{hI9tMtA$Ht HGH@PhLchHHu]tcAHHLHHD$(dH+%(mH8D[]A\A]A^A_f.AuƋAtH+1L)HHH Hoo^)$)\$*fHC@HtHHt H9L 1E1L{H5託#HELHx0JHHrH}E L`AHI(HtHHtwH9trLHH 1QLnH5%_1AXLH51E1yfLJL HEH,DL Hxj[HS@Y^HtHH Ht@H9t;LIHE1PL1H5cSXZ@L 1 L1ɺ1H5'Lޒ1ɺZf.AWHAVAAUATUSHHL~hDL$(dH%(H$1Ҁ~ D$PeoN oV0)L$0)T$@dHI LLHt$0 MH Ht$HD$HI H HD$HHD$ HH H$FHt>o+osHT$`1H{hA Ƅ$)l$`)t$p躅A…? AÅusH EH|$H5L;,$HC@HHHH9HBHA PL|fM틓E ȅH JHHHH HDLEL;,$H$L9HL)I9fL$$M)LHC@HtHHt H9L D$H 1WLH5Q1AT蓓D\$ H AMBL9H{@LD$I9IF1HIֱD$*HC`HD$LppHChHxIHfH@@8@@ @0HChHx賚H fH@0t$(L@@ IVIGIWHS@AG HLhL`H@H@0@ Eo;H{hAHT$` LƄ$)|$`o{)|$p<<D$qfDoof)\$0)d$@HH(HC@Ht HHtH9ujH QALPH51ڑXE1ZH$dH+%(,HĘD[]A\A]A^A_fHBf.H dpHt$1ɺ LD\$ ABD\$ H XHtH@HtLhH OLhHD$HIH C @Ht$ LD$,}BD\$,Ht H@HH|$L,$H ͯt L+l$H H5åL;,$ IBH9rIcH1HHH)HHEL|$J<&MH1LD$ II HMtMJL9J<&L9MI)EmLt$K6L9I)1J<&HIHt MI)J<&I9AH H|$HLIE2H $@HC@HHHH9HBD$HAPLr1H5ZJAYAZD$hDH57@L$$M)H|$1LAH1Ht$HIH$LH99H)LL9@II L9vSMI)EdLIfO 'I)JL9SM1MHt$H#J<&EILhH 1HHHLI[LJWHC@HHHH9LJAVH51AU LǺYE1^LIDH @HH5MPL-1 Ht$__AXH4$L`ML  :@H5L1H4$H4$L1ɺ 1ڌE1fH5ϡLB1H4$訌L谜H4$IMH|$E1eH8fAdH%(HD$(1D$ )$)D$w>oH~hH oV1) $)T$|HT$(dH+%(ugH8@HF`HH(HF@Ht HHtH9u:H˸ QE LP1H5 貋X1Z@HBff.fAWIAVAUATUHSHHxLfhdH%(HD$h1~ D$0oF oN0)D$)L$ ILl$LALJ L<Ht~HPHtu@ Ao'1AAooIh LrHT$@D$ D$`)d$@)l$P{DL$ MLI HAAHt$HHtHH5u3HD$hdH+%(HxD[]A\A]A^A_f. LLI;HtH@Ht H@H HI)A@IG@Ht_HHtWH9tRLJ 1E1LH5觉Bfoo^)T$)\$ JL i ҞfAWAVAUIH=ATUSHH׏HPHHIHfH@@ @0@@D3LhLh H@0@HhDpLhLhID$8ID$0螐fHH@ID$HAI|$HhIH,fH@@@@ @0HjLsIGID$H$MIH5HNHHtHNHDH9H<$HHFHH<$HPHHT$蹏HHT$HHРMFHEMLLD$җH<$HXHrHHfHt$H艠HI^H}HH荗H<$LpL-HLHHFHHMI|$ IoAG ID$@ ID$(M/IGID$(L8M|$(-tLkH[ID$@HAHL[]A\A]A^A_@L5L1VL虆I|$E1LX11 LoDL̵1H5VDH蜍L1ɺ 1H5+E1=H(H<$HpˍLǂ1ɺ7HHteHD$I1H HH|$3fH<$rHHHELZ1ɺ@L51LjH<$H1,L1LG<HLHHXHhH9u4f.HH9HChHs LHvu1Lb H5#资L11tH5蔄LT1ɺ1H5~g&fL5_1ɺ^1LL<HEL1ɺ2DL5MiLŲL؃:1fL1ɺ/1H5蟃[f.HpM1SLH5tiXZfILֱ11)H5B7fHEL1ɺ<ATf1H=USHH@dH%(HD$8HH1)D$H)$)D$ HD$3H H@ Ht8tT71E1L )L/H5~HD$8dH+%( H@D[]A\fDHxH5ǡ踗fAuH11HVH)D$)$HD$)D$ 脯HH@ Ht"uHxuAlf.L Lr17H5赁2L LBE17H5脁7L LH5O襖DAWfAVAUI1ATILUHSHxH$H<$Ht$01H$LL$HD$H$H\$L$HD$ L$dH%(HD$h1LD$()D$@)D$0H\$H)D$PLD$(HtHx tB$AHD$hdH+%(HxD[]A\A]A^A_HXHtLIH @MMtt$ IMLt$ LHt$ AWH|$ HD$(H u1ɺ$L|H5ID $VM1LH5E1$@AVf1AUAHATUHSHH@dH%(HD$81HI)D$LH|$1)$)D$ 跬HHH HDH豺fAt~11HL)D$)$H\$)D$ `Ht$HH HtDHbAąAHD$8dH+%(H@D[]A\A]A^DL1H5ޝt~f1E1LXH5I~Lq1H5~VrfAWAVIAUATIUHSHH5=H(H;dH%(HD$1HT$D$ 膸tzLl$LՍLxLLvHHtLLH萖HI $H;HT$ H5D$ HEHD$dH+%(u)H([]A\A]A^A_fDL-ALl$菒ff.@AW(HAVAUIATMUSHXdH%(HD$H1L$賄HrfLHH@ @臄HH;HxHHHǀH1H)HHkMvM|LH1LL|$11fLL)D$ )D$Lt$()D$0薩LHLH5LĶ,LH5ZL誶bLH5ML萶I|$hID$hHID$pHCID$pHI\$pHT$HdH+%(fHX[]A\A]A^A_fDHC1L2x1ɺDH5G{1L1ɺNH5!{@HLL&L1ɺRH5Dzf.LD$LLD$ފLHPHH${HRH$Ht$H葓HEHLD$LLD$莊LHPHH$+HH$Ht$HAHEPVL|$LCLLpLHtOLLHHEX01L<IH56y1,DHEXLѩ1`H5yHEPL٩1[H5Ƙ\yuHEHL٩1VH5$y#zDAWHAVAUATIUSLHhdH%(HD$X1L$裀HfɾLH胀HHgHxHHHǀH1H)HHUL8IH$fH@L}MEEIGpI_PLIGxIGpLD$ALHPHH$HH$Ht$HIGHM}MsHELHx 裋AHEEHPPH5pLoRhoZxHT$XZtMLl$HELH$衇LHPHHT$=HHT$LHTHH$HHHLl$ Lm11fLL)D$0)D$ L|$8)D$@膤Ht,L:HT$LLHEHT$HPXLf11LL)D$0)D$ L|$8)D$@'Ht,LӐHT$LL軰HEHT$HP`HInHIHAIFHL0L@fDHEL1H5~vHLE1֏HD$XdH+%(tHhD[]A\A]A^A_ù1E1LzH5#uHLHH1 LH5~uXZqLA1H5Lu3L r1ɺ1IGHH5ufLL$L?-H5St@LL$LG5H5#t@H$1ɺ(LlqH5H@H1tjى4@AWAVAUIATUHSHH5֔HXdH%(HD$HHGL|$H;LLp`Ld$L3HPHLHT${HHT$LHHHE8HuDH[HH{ uLLLD$̃LL`Lm{LD$HHLLH~H[H|$ HEH9AąNfoD$ foL$0Hu0HߺEMAąLH5\Hܭt>LD$LLD$&LL`LzHDHt$LHދHE@LH5bH舭t7L|$LׂLL`LxzHLLH葋HEHHUPH5HAąjI}L BLjL11jASUjH0uQL1ɺLH5r0LM01LH5RqHD$HdH+%(EHXD[]A\A]A^A_fL%sLd$f.HELdn1ɺ+H51E1tqLME1LH5Jq]D&1E1LH5q,@LM71L H5RpHE8Lm1ɺ ;HEHLm1ɺB HE@Lnm1ɺ>f.AWIϾ/AVMAUMATUSHH$LD$HH@dH%(H$1HD$HHHHL$(HD$$MHhHHDM9u`M6M9LI^HHCHxH@AąuLHD$11Lt$PfLL)D$`)D$PHD$h)D$pLHtH|$HT$HL34HD$f11H%L)D$`)D$P)D$pHD$h諜HfHHH|$HLvIHfI^AHD$H8-HD$8Ht$8H|$HL@MMMYAMAHCLHh|IxpI@pII@xIFI@xL0MpxHAH$dH+%(HĘD[]A\A]A^A_@HD$11L)D$`)D$PHD$h)D$p{HHh HELt$HM,fHL5HmHJELMH|$LLL$LL$H@LhM3IHuL*uHHfLhIgHE@t$(LPaHD$ LH5g1lY^H@t$(L}PHD$ LH51l_AXMLLLq<@H?t$(E1ZPLH5ыHD$ L1YlXZLLD$tHTLD$fL@HSIHBhIIIIIIFIL0MpH/HHD$0|HPHHD$HDT$0HT$0HI9uf.HI9kLJHt$0HT$ MALL$IxHLD$πLD$LL$HT$ uA@Ht$0LWfH.>t$(LaPzHD$ LH>t$(LPiHD$ LHH=t$0L PHD$(LL$XH51jH L1H50LjHU=t$(LPPnHD$ L HH=t$0LaPHD$(LL$XPL1H5iuAVAUATUSHHIHV@LsLyHLhLEqIHtLLH_ILLH\AŅt_H[Ht>;t1E1LH5|i[D]A\A]A^fDA[]DA\A]A^fD1Le1ɺH51h[D]A\A]A^ff.AWHAVAUMATIUSHHt$(L$L$dH%(HD$x13pHbfɾLHH@ HpHH+HxHHHǀH1H)HH]I6HH4$ xH4$LHٍP8ADž%MvMpLH{ADž*MLL$wLLxLQoHH4$LHiHLHCpAo]h[xAoexADžHD$@L=11fLHH$)T$P)T$@Lt$X)T$`hHtLHLADžL|$8H5{{LLLH5hELe]LH5LKHH5PL荠ADžHH5L̟ADžHT$(H5$LHD$0HD$(;HT$0H5L'HD$(H)H|$0+LH4$11HLfHLALHH)D$P)D$@Lt$X)D$`Ht$HP Ht:tLLADžAHLǃHǃHD$HC`xADž5AHLAA2fDHELa1ɺH5C1E1dHD$xdH+%(oHĈD[]A\A]A^A_Lta1ɺ1H5dDLA1H5ƃ\df.1E1LH5)dP@L1H5fc#HCpL`1ɺDHT$0HHC@HHHH9LJ1E1LH5߂ucL1H5LcsLD$8LLD$NsLHPHHT$jHHT$Ht$H{HCPYfDLD$8LLD$rLHPHHT$jHiHT$Ht$H{HCHfDLD$8LLD$rLLxLOjHHt$LHf{HCXDL1H54b[L1H5nb+L^1ɺ*1H5AaL *HK@HH1HH9LNR H5L<P 1zaHD$8HHD$@HY^nHCHLI1H5,apHCPLٗ1H5^`RHCXLa1H5&`4L HC@IHtAHHt9H9t4LJH1QL–H5a`XZL C uff.AWAVMAUATUHSHH$H<$HLD$L$HD$dH%(H$1HD$8gHHxHIHHI$LHǀH)1HI$I$LI$I$I$I$I$I$I$I$I$I$I$I$9ADžVM}L*oHLpLfHLLL5E~HwLID$H L LIw1^MmMHt$0LADžHD$0H5s H5HD$0ID$XL=w11HD$PfLH)D$`)D$P)D$pLl$hHD$蝋fHHt$11H~)D$`)D$PLl$h)D$pgHL|$HH5\XLL藘tILD$HLLD$(mHHPHHT$ }eHHT$ Ht$(HvI$LH5~L8 AD$`LH5 LtULH LPLL$XL1]Y^Ht$HH<$2ID$hH-IT$pH5~LhPH$AD$pHt$f11HD8)D$`)D$PLl$h)D$pHt$HP Ht:tHHADžKIl$HHlH|$LHPADžHT$8HtHt$@LI ADž>LvADžI|$HH5 nHHD$LHX6LLI1["LX1ɺr1H5 {[H$dH+%(HĘD[]A\A]A^A_ID$HL3X1ɺuH5z1E1C[뢐LHT$8LPADž]HT$@H5{LѕADžLNLLI1Z7fDLi1nH5{ZLxW1ɺo@fAD$pCAD$p@L LI1@ZHD$Il$X(LXLAoxI|$HH5[vo_LFLg LI1YHD$Il$X7L`LzLאIL1E1YDLLѐLI1UYH|$HFAD$`LH1PLL$XLIL1 YAD$`_AXfLU1ɺ1LX/fDLLQLI1XL\U1ɺ1LsXfDLLOIAD$pafLxLLI1XaLT1ɺ1LE1IDŽ$W0LE1HLTPLL$X1LWXZlff.AWAVAUATUSHH$H$HL$LD$ H]H|$(Ht$8HD$@HdH%(H$1CgHD`DH$DHމHHLxMHEHD$HHt$I jAąIGPD$Lt$oHhAoPxAW&DI_Xt |$MvMI~ uIFD$dHD$H6H|$HT$hH5pi踏H|$HT$lH5_i蚏H|$HT$pH5fw|uD$pH|$HT$tH5wZuD$tH|$H5wHT$xH5|HD$xlH\$xHeH|$LhLV]HD$HHHLHHgn+HJiHD$XHHxjHD$PHLt$0Ll$PHc+LE1iHtL`1fDEHH@L4I~HUAFtLFjuII GXMMDLLIH5s1TH$dH+%(dHD[]A\A]A^A_DHAwHMLnH-sH(T_AXLP1ɺ71HTLP1ɺ1HE1SRH$H|$H5duH<hD$;$1LكLقHL$ AIGtHIAGXAfDHLAwHMH-brLItHRLH-6r1HRMOHI1H- rLHRfLt$0H1Mt$P1H5mL_RY^H|$PcbHt$HH|$(TdIHHt$HH|$kIE H@ HtH|$Ht$dЅ>Dd$lAUL$t\$dD9HE1LLjjjjQDPSjjD$$y4HPHHTH@H@ H@(HtHT$@Ht$HЅHD$f11H$H,)$)$H$)$~HtdHP Ht[:HtOH|$luAIGPHH-ipLeHLAwH1PXZMIML9{ LDIH9P HH9vHHFLHCHFHH^HCI_XH@Āt H1I_XtπI_Xt H I_X t HI_XD$H-moLHOL"qE1H5>oOFH-(oLY1=HOH|$IWxH5AąeHD$L%%q11fLH)$)$H$)$|HOHD$(HP AWtAOxHt$8H|$(LUL1ɺIH5Mn1NIGtIL1E1H5nNLqH5iH-m|NLLmHI1QN'H-mMOHLCH#NLfLRIH5[m1MaC$AMIH HCIHI;ADLL$0A)DL$0H-lLWJ1ɺRHpMkH-l1ɺ1L'JHGMǀ IH9gH8H@H5nHxH_HH@I_XH|$IWtL[AWtH-#lLI1ɺHL~H-kLhI1ɺHLWH-kLAI1ɺXHZLULmbLL1ɺIH5k1LiaHD$XLt$0fAWAVAUIATUSHHHt$HT$dH%(H$1HufDH[HLc MuHLH=m!HH;LuVH$H?HD$HJH[HT$@H5'HtL|$@LL5HEHL|$HH5kHL豅tHLD$HLLD$(ZLHPHHT$ RHVHT$ Ht$(HcHLH5EHSH}hHO^3HU(H5kH^Ht$0H~HT$8H5naHHD$0H5HE`HH5JQH|-HH5kH^=HH5kH@xLH5jHfULH5HLtWH 1LL$XL=hL"LRIY^Ht$HLNHEXHkHLH5jH蛂u DžLjL TLLt$Lit$SjUHT$@Ht$HH0f1Ht$P1HC$)D$`)D$PH\$h)D$pvHt%HP Ht:HtLjL 0LLt$L1HD$HL$ HL$WMIL->11HD$0HD$LH$Ll$8Ll$Ll$ Ll$(1ɺlLL8;Ƅ$EHChHt HHtH9u.L h 1LL=};1LJPAWfIAVAUATUSH(HT$HT$pH|$(dH%(H$1HF)D$PfoƄ$HD$ AD$`HHD$@)D$@Lo oSHD$8)L$p)$AQIP!A[]HIHC I|$ Ml$ ID$pHt&H/L9tfHGHEH(JHHmL9uMl$(LMl$ I|$0ID$0HD$Ht)Hl$L7H9tHGIFL0pJLM6H9uHD$Hk(L{(L5lXID$8ID$0HtSf I_HH I|$ HhHXb IT$(L(HPIT$(HID$(IoIHuIOIoH1Ll$8Mt$E1L<$ALLl$HD$%DAuHD$8HD$@<HMHtKID$`HLEE1LLAHHxpSAAYAZAuHD$8HMH$@<HuDMDL<$EAELuAD$xEHmAD$|Ht^$Ll$f I^rGHx I|$0HhHX" IT$8L(HPIT$8HID$8InIHu$MHt$HCHHt H9$L Ue L-V1 LH$LZLt$4181 HHH|$ LHH$LD$4H$H$DŽ$B$E1$H|$Ht$HHDT$Ht H9>L d 1 MLLYo71 HHHt$H|$ LHH$H$D$4DŽ$ADT$$$D!ЃH$dH+%(H([]A\A]A^A_H|$$E1L-TH$H$Lt$4fHt$HJHH>H95H@H PL-yTLx1L=6_AXH|$(HLHt$HHHH9H@Hh1LPD$1L9y5XZf.fDHt$HHHvH9mLH1 LW H5Se5[LHLHH!b H|$(HL$IIGHt$HBH$H/HH#H9LH1Lv1ɺ*L4D$4D$4AG@AG<u AƄ$I|$@ID$@AIID$HAIGID$HL8M|$Hf1L11ɺH5dR/41(L a @Ht$HHt H9L ` L1Lv1ɺA3Ht$HHt H9L ` B1L51L3IGIHBHD$4AG@AG<pI|$@ID$@*IID$HAH|$$IGID$HL8M|$HsHt$HHt H9L _ L1Lv1ɺs2Ht$HHt H9L _ tL11L42Ht$HFHHBHD$4F@F<xu AƄ$I|$@ID$@2Ht$HID$HHFID$HH0$It$H>fDEO E{HD$E11LHFLHLHDLHHt$HfHHZH9QH@H1L6PD$1L(t1Y^E1$HD$Ht$HH@HBH$OHHHH9~LH1L)t1ɺ[L-1D$4Ht$D$4F@F<AƄ$AƄ$AƄ$t1 MLL ] DT$L"S0HD$HH Ht$H$HH|$ LH$D$4DŽ$;DT$FL L] 1ɺs1LsL?0jL #] L-WN1 LL\RH$0HD$H Lt$4H$HLHH|$ LH$H$D$4DŽ$Q:L \ 1ɺA1L:rL/Hi\ H]\ rHHHH9LH1L}q1ɺ-L)/D$4sHtlHHtdH9t_LH1L&r1ɺ^L.D$4AƄ$IL [ zL [ rL [ L [ H $H5/H=$/D H5@y+L<(1ɺI H5\@Q+Y@L(1ɺO 1H57@'+/}@LM4 H5@*LE1;g% 1LnH5?*@職AWIAVAUIATIULSHHHt H:!u#H_>H!H!!HD$xLHHD$pH#IHE1HtHT$h9KHbHEHH9LHH D$`LLLnLPD$XP1t$X)H L$HHjLAVD$xPt$xDL$xLD$pHT$`%H LQLE H~!H-~!H^L@IuHELLH~PIHHxHELHL$xHT$pPD$HD$XM~8AF4HtHHt HBD$hMtA$HL[]A\A]A^A_ÐL$HT$XE1ʉH9PAHLh#Lm1ɺH5RK(_L aU t@MtA$HtfHEHt]H9tXLHLm 1H5J (LE1-HEHHMtA$L T H/IHfH'HEHtH9u2L T Ltl1ɺ1L޿~'YfLHf.L,$1ɺ1H5J?'f.L#1ɺ1H5IE1 '$HLbl1H5I&AVE1E11AUIIATUH1SHH dH%(HD$1HD$PHD$PjjjjjjH@IHHMtHL;uVH1IUL>I H5:;*&XZHD$dH+%(H L[]A\A]A^@ALE1H1AUIH5:Lik%Y^HLHM1UH5:%_AXd:HAHHHf.ATIUHLSHYHHSoHtHH` []A\DHL[H]A\FfDAUIATIUHSHcz!HDz!H,H4z!LHLIuLHPIHHHH9t[DHSLLHH9uI$H9t2E1fHPHHHAH9uEu"L}HL[]A\A]Li1ɺ1H5F#DH7HFy!H7y!=y!HCHHE1z1Lj 1ɺH5UF#HL[]A\A]ÐAWIAVAUATUSHHHjLHdH%(H$1D$|HEHuHD$HtHHt H9HO HD$HHH9u[HH9LHHH;q@uRDIxHL$|HnIH IHD$ H!AGEo D$@AGD$THID$ L57LhH|$ LHT8RPC(Wt$(LP1A"M|$ H0IHH-I9AD$<ID$(It$0HHD$0H Ht$8HT$)HD$(AHD$8HD$0DO\C(LM9LT$HHLM{LU LKiLm(t$0t$Ht$0t$PP1j!H(C(Lj LAULTiAWLT$hARLT$pP1)!H0LT$HH|$(L;T$M9LT$L LiKDLT$G|LPC(gAUAARP1 D\$`H ECAL\$0HD$LiE) LARDLN<*JD8DT$0PH)кPC(P1M L\$PH DT$(M9H}Ht$It$ 4jC( AWLl$(LLLjAUP1H}H LHL$ LU1 HE 9XXup Hi W D$TE0AH$dH+%( HD[]A\A]A^A_fDH@HD$Gf.HD$(AHD$8HD$HD$0IM9MBL9|$0LS(HLJgt$@ID$ H-PAUt$(RJL1H0HCE1HXHHcH;.HHCfC0HL$HLBK0LHqALHC4fH$HH$q!@)$)$$)$u E$ƿ3H$HH$LH6$$DhH$T$@HD$ HMH|$ D$@Eo I?AG褪 H H{HHD$]HsHT$H;,HT$HCHHz$H{HHt$ DϦmD$TAGsPC(LcAULt$LP1H HI9HD$(HPHT$L+|$K(LIHItH)HLRLctLARLT$XP1Q DM|$ LT$hH II9^H LhC(LbARPL1M|$ H ALL\$hHLL)L+cHHL$` HT$PRLL)RAUARL$P1C(Lm(L L$H(LLcLU t$0t$Ht$0t$PP18H(C(Lt$P LAUL ct$pL$ARL$P1H0LT$`L\$hH|$(HD$0Ht$XS(LH9Ht$H9I9HD$Ht$HLM)HO/L~cHLHHD$@HHHH|$ L\$8HPJDVAL ASP1ARLT$XWRmD$H@ELT$(<LT$XLLcD)L|$HL\$@LHD$8IωL$`LQPH)HL$8 PC(P1HL$HL\$`H LT$XJ)L9M9LICL9C(HLcASAWARt$(LP{Hg<L1M9L9|$0L;T$ H$)LL%<1}H5-L)HHD$(HHT$HLDbLASL\$8ARC(AWt$(LP1iL\$XH0HD$HLME1HD$0L 1ɺ1H5/-dL1ɺa1H5 ->HL^chPQ H}Ht$LT$(It$ ,AWLT$0LC( LARLd$(LbbLT$ ATP1{H}H LHL$ HT$(;MHC( LAWLd$@LL2bATP1HL$@LLL+l$hH}H Lx(#LL$L,bLL|$HM9LIB8ASD$hL`LL\$@PC(AWARLT$Ht$(LP1pL|$xLT$XLM9IBH0L\$8LL`\1H53+#hLL$L1L:>L[7H5**+f.ATL%3k!UH-+k!SH]L9t)HEH}HCHHP(HH%HL9uHj![]Hj!A\Hj!f.@11#1AWAVAUATUSHH $HfHt$AAT$AMLˉL$AAdH%(H$1)$%)$D$ S u*t u*A Dl$tMD$MD^!tֺH54`L"ug!D$b t$tt~ u5t H=\z!o HCML$L$LH$$d#D EAEH HHL$(L#HL$(H=ǃ HLIpH;5 HtjIL; s]HtHAH  Lz HJJ  t$@0 IL> fDEL= ML"LP։T$(6T$(LLeHHIHx>Lx!MD!DT$ Eu D x!HPHex!D= Hx!N4ȋUx!L fH _x!H5Px!H=Ax!HLȃDL$ L]EHD$PHHD P HDHLt$XL$HDHLD$(HDHH|$`LHDHt$hEYHL$pHt$@1HT$xDMP DL$@LT$HL$D$DŽ$購LD$(AAHw!LOw!HP tW@EoMHCL$H [FH\H5\$H$5$Eu > 9| Td!(9-p ~ D$D5pp ED- E t H$t&$OƄ$H$ƒL H=o L M= H.\1*DuƉH IHLu!MD!:Hu!L$HHt$T$M1ɉЋt$@*H$dH+%(dH[]A\A]A^A_@  /LNu!ME BE V* 2E1xDH=ZD#HtM 0uP!Hm HtH=m HWHm H9GH5hm fH=Wm *'58m t= j} o#HCLH$H$$#"D$'fDl$D#-} kD|$Ek'Dl$ E@"[ hD [ E}(H !H8LD$(H=EXM$LD$(LhLLP蕐mHH=l L n9 H_PDD$,1HL$ @_AXD$yH$HHL$+{ HL$HLD$0HD$8H5{ #HL$(LD$0HHT$8HH{ 6L$LH{ !H$ƒXL HL1j o3HCL H$$8 #|$t #=z fDL=!H=!M(HLLL$ F$LL$ L7 LL1HDLLH$L ,eH L o+LEHC$H$D$ 5,H=ŀ!IHvH€!HWI9/H$H0I|5H|0HxLHH)H)HkH n!H L8H% H$t[Ƅ$H$Ln!HHULD$$PLL$ 1sXZLn!H$HHL$(x HL$(o;HCL H$$o3HCL H$$H$ L8H$ HH$ L8{H$ H8$ɉ0At tAt ftULH=LL$ Q9LL$ /H x H=x eff.SHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HM~!HtxAAADHK~!HtfH~!H$IHD$HD$ $(D$0HD$H}!HD$dH+%(u&H[ÐHq# HyHa# Hff.@AUATUSHH8dH%(HD$(1( t$HD$(dH+%(uzH8[]A\A]fHLd$l$Ll$ HHL$LLHD$LD$ LLHD$ HsHtD$ )vEDAWAVAUATUSHL&L9IIHDI\$I1LHHPIc`HC0H9ufHH9tH;XuH@LHL(kHHt˧fAGM$$M9nH[]A\A]A^A_ff.@HH1 dH%(HD$81uHD$8dH+%(HHDHL$HE1E1j1jjAH tD$tD$ Hc|$HHH H H%H CHt@atpXH=c HD$H|$4af.USHdH%(HD$1H$H;6tyHHHHH h HtYHH vHHHt<uH}8H uN H聰f.AVAUATUSH0D= dH%(HD$(1EH=M H?HIIHtG`t ĀPuXHM HLHLt$H$HHD$HHD$AĄ|H=mM AĄ]AHD$(dH+%(lH0D[]A\A]A^De`ADe`A A^HuXFHEH#H9LHAULCS1H5uXX;5m H=L Zum Hm m EaE1fHHt H9L  1L91ɺH5<uXH=-L HpE`̀E`NHAHEHt H9L 7 AULCSfDL  @sHOfDHtcHHt[H9tVLH1E1LLBH5hfDLHLHXL  HEHt?H9t:LHAUH51SLAOY^L ) fUHSHHdH%(HD$1HHt$D$$4 DL$$AAt.==t/HLA1ɺ P@=t4=tiH1ɺPH5 LA1gY^CXH-k k k HD$dH+%(ukH[]=tHLA1ɺP1H5 XZDL1ɺH5q *f.AVAUATUSHHVdH%(H$1HHx8LNHLH HH=xI1H@LLHLL$HHLABELONEH$HD$ PAąHt$ϦodL$HSD$H"HEHt H90QL  RL5s 1ɺ1LL@Y^EaLcHI I$gLLH\2i A9EXuLi Hi i +f.L 1ɺ1H5 H$dH+%(HD[]A\A]A^DHL?1E1jH5c _AXfDLHQRDHHEHt H9&L o L4L1E1\81E1L>H5 )@HEHt H9L  L84L1E1QL  11RL5_ L>LX1ZLc1I I$S1LLV@LHLH@fATUSH1<IHu%L@H1HHHPEaLH8HHuID$Hth LH-qE E8HH}(H}0LIT$At$L LHE HHH=f v[]H f e A\HD ÐH(21ɿ1Lo2H5 HIL1ɺH5ۏ%ff.AVAAUIATUHSHH@dH%(HD$81Ht G`C}XItHLuXEH|$LHDt$HC HD$HHD$HaHD$ HD$HD$(H=C AĄ.d 9EXu#d Hd d @HD$8dH+%(HH@D[]A\A]A^@HQC H|$LHHD$(HD$HHD$HuHD$ KNHEHH9LH@ĀHHt H9L  11L&0H5uXH=B _H}XdDDe`ADe`A ABH2HEHH9LHAUH5.1SL9zY^L Y AULv:S1H5BuXX;5b H=A Zub Hb b De`A AXHE1ݣHEHt'H9t"LHAUL8S`DL  LHhL y ff.@/ uH=@ tf.HHt?HHt7H9t2LH1Lp9H51HL ff.@AWAVAUATUSHH(dH%(H$1H\HHt H9L L5(11ɺ{L8LpC`̐C`HD$E1Hl$HD$1@HMHI HLH HLABELONEH9D$uAL9|$tvIIuH$dH+%(D$H([]A\A]A^A_H15!L I9uM$$H5!I9tI|$LHHtHHt H9L T H11AWLLN8AX1ZLH]H|$HDHH藁fHHt H9wL HL7L1AW_AXf.CHHt H9}L  1L+1ɺLrsXH=> HKC`̐C`fHXD$HHH9LH~L1L+fDLHKLHkHHtH9uSL HL1AWLk6Y^D$LHLHfL I A@L 9 11ɺ{L5L5L%%`LHkff.ATASHMHHdH%(H$1HtbE1DAu&H$dH+%(u=HĨD[A\DH11SL+H5)jXZUH5XH=MMHtZHH-)u(H1L)1ɺ]@L1ɺ1H1L1ɺH5\)1]@ATH5XH=LwHtIHAuDA\f.1LJ1ɺH5(_DA\L%1ɺ1H5(E15ATH5WSHKHHHt]HALuHD[A\DH1SDL(1H5N(XZDH[A\HH5+(E1QDL7(1S1^_ff.SHDKH1[]A\HG1HAąxku[]D%< A\DDtH1ɺVSDL%1H5J$X1Z[]A\DCH1ɺJSDLH%ff.AWLb%AVH5AUIATUSHXdH%(H$H1H$Ld$pH$HD$`H$H$H$H$Ld$xLd$pHD$HD$hHD$`[LAƅ A`< 1,IHk f.LL(IHte~HtH$LxH$HHPHH$AGatAwXH=4 L IFHth LLd.1:H5AL$M>I98Hl$HLMLd$fDHIIH9HMgI1LLHuIIGHBHH$HD$IH$IGH$L0A$L$tI$Ht L9aL =" L-D11H5M$LL9HHtTvfIA$AF AFIHH9HLd$Hl$L-1LH5 gAL$I9t fIIV1LHPM6I9uL$I9t#DIIV1LHPM6I9uH$D$THD$(H$H$AHD$Xt  D$DHL^HD$D$HD$hHD$`HD$p1L9t fHL9u0'E11LILiH2I!HH;I!vpH D LH,H5HLHH)HҺLE11LO,11MH5rDT$EH|$`L|$L7H;|$tHGIFL0LM6L9uT$LE11LoH$L7H9tHGIFL0pLM6H9uH|$pHL9t#HGHCH@HHL9uH$HH9t DHGHCHHHH9uA`< [IH5H<=H5H%HD$ HHD$8HH9 H$Ll$HD$0fƄ$HD$0)$)$oJT)oRd)PHjHBHD$LuH9H$I9H!M H5f LL$qL$HEhHt$H@8HH%H9I$HL9H@MMH VH5LDHL+1P1AW$bH|$(H 1ҹLJJILL9t$ILehI$HmHIOlIID$pH$HMMtH5ELTuHEhHL$H@8HH%H9fI$HHLl$T$DAtA+H$HdH+%( HXD[]A\A]A^A_@AL11H5IH5oJI!6L$'1ɺ1H5gA@LHH$L=}>HLHD$0D$DXDIAL=e>Ht$0LEA>AuD$D5 Ht$(HT$TL#D$D AuD$TD$DL11H5BH$L|$(L7H;|$(tHGIFL0LM6L9uIAuD$Dt$DLԆLN1H5 fDD$ 0I$HL9H@MH MLLDH1ɺPLc'1AWH5$H IL9t$LDHT$8H HH9HD$8fDHt$(LSEI$HL9LHLs1ɺ1H5sI$HtL9tzLHH11AUL&H5-AWSH HAd$`7mH|$1LHHPHt$01bH9fDL YL I3@H9rAt~tz1LY1ɺH5H H9L$1ɺ1H5v}uL1ɺYH5IH$E1H9tf.HAH9u1L#%1ɺH5sE11HILlHLUI赳D$DD$lL51H5 LA1ɺ_1H5zD$D)H11AWL7H5AXZ?H1L,1AWH5A_X9HH9iD  E1HD$HD$ Hl$0H\$8Ht$L(IHII9tL=HtLxHl$`H\$H9uHmH9tH}LKuHttAFb HIƨHLHL$HHL$HD$ T11L'wH5hcyD$DAvyL~1ɺmH5 UHD$Hl$0H\$8H@Hth H|$L|$`HD$I9sL$Hl$0LLd$MIH*@HNHFI3OI3GH HmH9tt<-tL1L_LIHfƄ$I)$)$oA)AocA)gHPI9t7fDHBhHHI3HI3GH /HI9uHEHuATL>"ASHIH VH0I ȁA1PA Ѻ@H5 1wH D$Ld$Hl$0Lt$ L$}Z1LH5XAuw7D$D2zL1ɺ1H5CHEQ1AVLHIH AWH0I APA H51VH D$HD$(H9$ 11L?H5Aux8D$D3HEAWLH5THIH H0I ȁA1PA 1 _AXD$MHEHuATLASHIH HI 0V A1A P8Lp1ɺL1H50Ht$(HT$XLHD$XHD$H$H0HD$ Ht$H9Ll$0Lt$(Hl$8HHUHHH9L$LxM9uMmM9I}LuMtlH|$Ht A<-ttIuBHMHEHAHH|$pHD$xHt$ LeHEHD$xH0AHt$xHt$Ht$ HHH9t HD$Ll$0Hl$8H$Ht$H HHE1H9HH9uHD$pE1L9t HAL9uQLo11RH5lHt$8H|$MH|$ cA[A^D$L 1ɺH5#H$L7H;|$(tHGIFL0LM6H;|$(uA.,L1ɺH5LH $H5(H=9Y1MMATL% 11ULHLHNteu1t,HtNH]A\fD1ɺLL1ɺLLſ{HLL1]A\鞿fD1ɺLLU}aAWAVAUATUSHH $HH $H8dH%(H$( 1HH5i AHHHl$ AľL5%!1IHLHmwoEAAAAL[1H5c薾Lb1ɺ<1H5E1rH$( dH+%(H8 D[]A\A]A^A_fDHl$ 1IؾL% %!HHL註1HML1S7H5r]A\E1gfDARAA L$ DHV$!L-O$!DEL9u@HL9L{HLu|$ ML-L1Ƀ"L P1AV2{DZYmAfHeA~DAWAA L$  VIHuHrIEIH/|$ L AEM}1Ƀ" P1AVL5- LbAXAYHAD #!E 1ID$H$ H HRHߺLr^_L$ Ht$HA4t$H,L$ HLKHILLP1聻A[[fHML"1S2H5 DA]A^L$ HDL&11 t@H=!!H!!IEH!!IEL(L-!!@11I}LL11L詺L$ LHt$H߉Y3GL{L711H5 JL1ɺ1H5 $ff.@ !H !S  ! !HtwЅt s !tkL 1H5 裹[!6 ! ! tDUHЃEeu;~xu5~u/H5P t]fDst3uu^~nuX~uRHH5κ]D~huǀ~uuHH5]铺I1{LH5 i1]D1Lt 1ɺgH5 ?]AU11IATUHAąuD]A\A]R!tLH;&AątA]DA\A]D11H5JHmff.AWAVIAUATUSHHHL'L9 H&L9 %HL=AL9 DŅLfDD9t,PH5(AAULk1Y^LDHHH;-!pH;-!SH;-!6HH[]A\A]A^A_1LH5dH1[]A\A]A^A_AL=DŅ8HML>PHD8PHP1H5 H 1H[]A\A]A^A_@k8A?MHIHHDHH BAPH5LQP1uH DW;8CA?MIH HHDHH APH5/L9QP1H  8A?MIHHHDHH APH5LQP1薴H DL=E1!fH+!@Hi+!@HI+!8(A?HMIHH HDRAPL-QPff.AWAVI1AUIATL%$ULSHdH%(H$1IljLHÅBjHc1LLH5u,)L]HtHxLH51t*1L #1ɺLH5&1H$dH+%(H[]A\A]A^A_s8M1ɺPHDL@PH51蟲X1Zf+L-8Hj1ɿMPHLPL1QL;;(M1ɺPHlLLPkfD81MPH8H5PLk1ױY^V+ff.AWAVAUATUSHHLwPHwhI>=1IHHHIHIDL<@HI H90HHL9sIHDL ,HxjмHHD$A[XP+HHHD$IDL ,Hxj脼LIXZ1L\$"ASLT$ARL5L芰ILDL ,Hx$HIIDL ,Hx$׻HHD$Y^X*AWHT$LIL81LR&֯_1AXM9rH[]A\A]A^A_DHCPHHHDL ,Hxj9HIXZ)HHIIDL ,HxjY^AWATIL%1L.L _MAXL21L ܮ1I>HHD,IDL HjD҃HULHIHDL ,Hx$LL_ I41H$/AYAZ1H[]A\A]A^A_f.L^LHLLM9MAARLIHRH| HH9to8uHPI0HJIPH31H3QH u'IpIPH3qH3QH uADIP@HtHI@HtHI8H9J8tHH9uMM9XfDH1L֩1ɺH51H@UH5H謺AEt[H5,SH萺AEt?H5HtAEt#1L 1ɺH5f1]fATUH-J SHyHtKuGL%;#!MtHLH=[] A\ u  []A\DHiL gL%"!8t襽HMt-LHk1׸[] A\HL @ATLL%tHL%kt薢1ɺE1LMH5nfHE1LIH51.脷@AWAVAUL-ATUHSHH8Ht$dH%(HD$(1XHHD$HH9¸HEHD$HD$ H$@H4$H\Ld$ Mt$AIH5]M~(I<$Mvh辨M5jAH ]HE11PL1LXZEY]HD$Hǀ`5(HEPH8,< D]EuVM m6$ HLLI1?HD$D`EE1fHhML=LH1P1AXAY!HLE1PL1ɺ1諟^_EYH1ɺLIL1wvfL12H5L1ɺALH5HD$(dH+%(H8D[]A\A]A^A_I<$AAH)L1ɺIH5d1赞L|1LAĺ蒞oDHALLI1Z7tnHD$Aǀ`HD$HD$Hǀ`2AąLњ1ɺ1LH|$ AątKHEPH8&AąjHLGIH5;1茝iLS1ɺ1H5fC輲ff.AWAVAUATUHSHhLdH%(HD$X1HI9ƸLDHGXH0H2HGPL(2H%AŅ_I@] ^ALHEPHmX,HH8&VH FHuX,Ld$ LHEAŅLM AŅILxL LHRsAŅWI@I0H5zHD$I8HD$I MHD$IGPH8II9ҭIFHL蘃AŅE11H1LAŅAHIoX2II0HtDHD$I HD$I@HD$I8HIl$X4AFT IH11LLAŅH1L/AŅL1ɺ1H5i輚FHE1E1jH1HjLLd$8AT:H :D$ fLd1ɺ:IH517Lo AŅtxHAŅA4DS4LIH51E1ٙHD$XdH+%(HhD[]A\A]A^A_L|1ɺ1H5<菙DLT1ɺs1H5gDHHH9QLHXLgI(ILL`=AŅLHpAŅL蔄AŅL1ɺQ1H5U記Ll1ɺo1H5,f.L<1ɺC1H5Oqf.L 1ɺH5!:@L1ɺ1H5fL1ɺO1H5|ϗf.L1ɺ1H5L蟗f.L\1ɺ1H5of.L,1ɺM1H5?af.1ɺE1LH50fL̓1ɺ1H5ߖL1ɺ1H5f蹖ff.@HHH9u 1fDS1Hf.HH9uv1[@H0rHtHPHRXH0sH2rHH;Zt1ff.@ATH5tUHHdH%(HD$1D$HtiH@ H@XHt\1HT$HЅtLD$L%M 1LcH5'z0L1ɺ1H5L%HHD$dH+%(uIHL]A\DL%{@1E1LH5Jf.AWAVAUATIUHSHHXHdH%(HD$H1HGhHD$HEH@HH@0HAH M[L荤LhHELH@PHx%H4LLH>HPLXHM蹿 IHn訿 IHHLIEHXI$Me IHHL:AMt I~ Mt I}Ht H{HD$HdH+%(HXD[]A\A]A^A_f. HHPXH4H ʃHHH9ŸHDMHPHEHT$DH@PH8wHPHHEH@PH8HPH1ɺ E1LH5H蠒 HE1E11fHt$11H)D$ )D$HD$()D$0п HHTHE1H@PHx HXIHfH-M^ID$HD$HD$HFIMM3IG 8uHxHNuHD$L9@HH@HtI9uIGHADE1E1MkHEHT$EH@PH8tHHtwLhMI}t I] HMmMuLXE11@ L,E1IH51 t@LXL1ɺ,1H5LE1͐/L1ɺ61H5TE1褐Lk1ɺ*1H5+E1{HPI}֥ADžHE1LH@PHx HXIHHE1E1I$@1E1HDžPLGH5QHD$H@ID$L1ɺ11H5ZLE1觏Ln1ɺE1H5.聏LX1@ɤfAWMAVMAUAATUSHH(dH%(HD$HGH@PHHD$LLH%Aą"HKH{HQLGhHH @iHPIHGPH5(mL8L詠D$HH@ H@XHt1HT$LЅL=11ALL=CHCI|$HPHH HwX;A$HcEHHKDmTA A&DL1ɺ1H5d跍HD$dH+%(H(D[]A\A]A^A_ÐALY11H5lf.HEaCTdHH{Hp AąL1ɺ1H5HHLHI9I$P A$HID$L¾BH@PH8y\ID$H5kH@PH(H}D$HH@ H@XH1HT$HЅD$L=1A LL9HKI|$HQID$HQHhX;HH DHHHH9EHCH|$GHPhrxAHK_fDHH@@\NHHHH9&L$LR1ɺ1H5@~fL=]IL1L衊Lm1ɺ1LE1聊@ID$H5hH@PL8LmD$H<H@ H@XH+1HT$LЅD$L=1A LLHKfDD$H}AąD9mTLt$HDAEM A,D$I~j'H{ZYIHuTI~IAEM A,D$jڔ^_AWATIL 1ɺH51AXAYDmTH2I$PI|$H}DAąLe1ɺ1H5%xL= 1ɺ1ALLFALL1xfA1ɺ1LrH5@E1WL=l1ɺ1AL+L覇`Lm1ɺ1H5-耇AL1 H5QL=A 1LL#kI|$Iff.AUATUHGXHH-H4HHH9HRB@H,HHEXHEPH8AąHuX,1E1E1j1HjIAXZE+HEPHL(4=HLD]A\A]HH9uH4sIfHHLI1E1H5v΅D]A\A]DHHH9֠HHzHHLIH51aD]A\A]HLIKHpLIH51@Hj(A1H1ɺUIH5nL1踄Y^G[tHHH9t1HH9ut1DHH|$B`Ht=HPHRXt-H2r&HH|$H;xuHf.1HfHHH9t:fHPHt HJHtHhHt A[tH9tHH9u1@fAWLAVE1AUATIUHSHHdH%(H$1ILHHH=L9IDHD$@ӉHD$8HHLLI9IDE11L$|$Hu\HD$PH|$8HHHPHSHPH@HSHC/H$dH+%(HĘ[]A\A]A^A_ÐHHWLPDL$X1H5jXZH|$8辉1f.LHH5.1]HhLMIH5q1H0LRIH591蹁Lff.@AWAVAUATUSHHLwPHdH%(HD$81HMH9HCH@LhMHLxM HL[AąeHuXLHHǃh!XAąLlAąLIuX4LiLTtLA*Lg}1ɺ1H5zE1fHoX,HLLT$z LT$ALLT$LT$H5IHLT$LT$fLHT$HLT$)D$)D$ ED1DH~ HgFHpzLM|LrIH1LHvLHkL ;lH 8lLHDLDH1ULD$ H92zgZYHt$LL\(H$AD9hLWL|$@H$HHD8AAcH\E1H߉T$,D$(HCHHHD$syT$,I1DHLH fL1eH5L|$hHCH@HHCH@XH!H"(HPHBH@@HHHt{H9tvHAHD$H$DzH|$PPT$,|xT$,IHlHT$,H}HD$(H$H|$HD|7xT$,IgHHD$f.1 LH5gL14H5lgL}H5=L|$yg@L1nH5L|$GgQfL)1xH5L|$g!L1_H5L|$f?|ff.@AVAUIATIUSH@HndH%(HD$81D$ HD$Ht E\MIFH@ Ht0Hxpt)=& H-su I|$2fH-hHLmHtTڃruHUL@HIHHTHTHL)H)ڃr1L 9M 89rHT$8dH+%(zH@[]A\A]A^tMtLfL@Hjt.HEPHxcHHHx\2ID$HHCLHI9黀fIF@tAF1 t)H-fDMLLIt$HFPH8|HL$HE1E1jjj荡H QD$EIFHT$Ht$ LH@ Ppf|$ u!|$T H-tyH-ff.HATHUSGHHHcH>HWPHBHHRH9HHfH*fHWP-HJ 1HHR(HH9gHNfH*HfH*IfDHP<G2Hk@HHHH9~LEJT1IHDHHHHH9H1HH9HfH*HfH*HWPB8HJ HHR1H~fDOHOPHQHt]HI1HtRH9HpfH*HfH*^Y9,=D[]A\HG@H@@GpᐅHGPHPHH+HHbfHOPQuH1t 1H9qHQHo1HdH9t/HfH*6fD&fDHЃfHH H*XfGxHfHH H*XfHȃfHH H*X{fHJHHR1Hf.I@PHHDL ,HxjkHsPIHEH6H@PHDL ,Hx$kH}HXZAT1H5bSIL1_Y^HJHHR1Hf.HJ0H~HR 1Hjf.HȃfHH H*XfHЃfHH H*XffDHfHH H*XfHЃfHH H*XfHfHH H*X{f.@V9WrfDHHNH9ff.H 1H9H9~tDFF;BATAUHH;tHD]A\@HuHEXH&rHxHE1AfAWHAVAUATUHSHLL>HD$LfI9NAFL1ۅu)A9^LIH @HHʃ:uII9t%HRHz1H9xHDL9uu(LH $dIHfH@ H $@IHDH@IEH@@HHHH9HRHEP LH5B}LR1uHL\I?ZYIGM}IEIGL(MoA9^L@M6L;t$H[]A\A]A^A_fDHوe@1LH5|[H1[]A\A]A^A_H $H5\H=,\Liff.HHHW E1Hv1Hz j1jjL H(ff.@AWEAVIAUEATAUHSHFH~D9w_H4sHEsHHSHC9v2)HHTHHHHDHHH9uDMVPHHMI~3cIFPI~HP HEH0I~H5膒IFHPHH0LLMH H[HH@0IE@8HNHE@H[HHE}HH@@HHHH9HIH;L2HgLT$IDR L VLH5qzAUATWQPHAWLD1rYLT$HH@Mt I~L(sH+DcH[]A\A]A^A_DH !^@ H-yLHYH1LU1ɺ? XH1[]A\A]A^A_DIFHZE1HH@0@8H@0H-syLR@8 H1rXj16 LH5*yKX1@ATASHHHQH@@t"DHHBH8t1AHD[A\HQHtAHD[A\fHQHtHsD9fvD9fvHSH{EE1ɋJ mAąuLrT1ɺ^ 1H5ixWuAWAVAUATUSHHDaH<$@EuOIH$ztA@IIΉD$ T$ Dt1HHIFH8t H$AD9`wf.E1hHHH,$H]H9u-ɐHI E11j1jj6H uHH9tIELCH0MuI9uD$ uAHD[]A\A]A^A_ÐAM H<$EE1LL7AąuLfDT$ۉATT"`ff.fAVAUATIUHHuuHxLHHvL5ٜ1ɿIL1{L˼JHLteAHD]A\A]A^ustwtrHL5y 1LILm1{JHLu}LWG1ɺ}1LE1kJ|fDHL51ɺpLIL<1(JHLHuAŅtnH>HLGH7LLI1IH]+fLlF1ɺr1LIfDLLE1IiH51IIZ1ATIUH SHGXH*H-sHHH9II$Ht HH%A$H"rH!sLu]ID$X uSI$I$H9t>H$M$AAHrHNHAXEtH$rH29HH9uL[]A\ÐM$M9cHI9uHH9uDA$%HJXHAXLhuI$I$H9uDHH9sHCHx/tLL|IH5B1|GHCL`&ff.@HGXH0sH2szH$r;HHǰH9bLBXLfDHHH9LBXMuLMuʩtJHHǰH9bHL@Lf.HHǰH9\bLBXMj[Z@E1LÐH%X fDAWAVAUIATIUHSHH(HHMHH@HHHMHH@HIEI$HtADEt9H3HH8IuHH8|@HID$XHX O$HH5HHu E$EtHH'MuL;H&$H$H%vA$ID$XHHu"LBID$XufDH H/MuHL$H.L=OLHL7tHLH{7L?A1ɺL%8e1LODLA1ɺq1L2D5DM}L3Fu HLH6tHQLH6:L@1ɺL%d1LCL~@11bLCHLH~6 HLHd6 ID$X$ĀHLH56YID$XL?1ɺ\1H5cBH3H\$$H([]A\A]A^A_@H1LH5HLH5$ID$X LZH53fBH1LPH5c;B$IH"MuL;H! H{LH4I$I$H9]LpIF& @,HH+DID$XfD L:H5FAIE1LUH5aADLhpII9HH$HHD$IHL$HI9 HsL(VuHL$H$H$L=HHI9HsLUuH$HLHf3d IT$X$H0'HT$Ht$H53L<1ɺf.HLH2tH;LH2L<1ɺhDL<1ɺDHALH2tHLH2LL<1ɺ[L%E`1L\?L(<11lL??Bf.HLH2 $ID$XDHLH1tBH+LH1t,H-LH1t$ID$XDLt;1ɺ`#DLعID$XH0`tHt$HHU1BL5IT$XH4OH-fHHHHAAxLHT$L$L$HT$UMutDHnLH0HLH0IT$XMu$H`HvH(s@HLHe0IuHHJ0$MuHA$HD$OIL=I91H\$HfHL9HsLXRuH\$HLH/ID$Xt H$tA$/ ID$XH7IuHH|/4IuHHa/HH; MeH DH I$H 0HHHdHL`$HBI$HyLH.tHLH.xL81ɺDHLH.+IT$X$H0gHt$LHw.#IT$XEDHLHN.f$IT$XDHLH.tHLH.L71ɺ L%[1L:L71ɺg1L:f.HLH-II9!HH$HHD$IHL$HI9_ HsLOuHL$H$H$L=HHI9, HsLOuH$HLH,: IT$X$HT$Ht$H,ML61ɺDfLl61ɺDMuHLHT$HD$HT$EHt$HH=,N IT$XMuL51ɺL%Y1L8L511vL8f.I$ID$X"H$M>HGM9vH\$LI HL9THsLMuH\$H8LH]+L!51ɺL%Y1L18L41ɺ1L8L;@H fHmLH*a HLH*G IT$XMu$fHH;M$M$M9;E1Hl$E1LH\$H5;XELJfHEPH1ɺLҭLuH1$7ZH5WYM6I9WIF@tA~LDEDD֐H!HDd$)DT$) E-fD$MehHt>HxI$H HHH HL`HBI$L431ɺ1H5+WG6JfH$HT$LH,)t.IL=I9jDLLH)L21ɺH\$LLH(L21ɺkfHILH(t:L=sLHL(t!ILHo(L,21ɺ;DHLH6(~HLH(dI|$XH$I$I$H9E11@HH9~HPL;bXuAH\$Hl$H3EEYH3HH'LK11ɺH5?U`4c$ID$XL 11ɺ1H5U4"f.HLH&tH#LH&uL01ɺLQID$XfDL|01ɺm+DH)LH&vHLHl&\$JH;HH I?HHs IWL8LHHPIWHHNIG%IT$XMu$bIL=I92H\$HHI9HsLHuH\$HLH%A$xHLHd%^L(/1ɺfH3HH.%fL.1ɺH5R2 fH$HyLH$t:HLH$t$HLH$f.Ll.1ɺ2L%eR1L|1LH.11{L_1bL&.1ɺ)H5;1L.1ɺ-L-1ɺEDL-1ɺ}H$HT$LH#t)IL=I9LLH#L-1ɺHCM9`H\$LIDHI9:HsLBuH\$HLHU ?L*1ɺyHt$HּH& $iL%ML)1ɺL,H$L)1ɺL)1ɺHLH/Ls)1ɺ L|$H8HL}tHLHgL+)1ɺL)1ɺH\$LLH&L(1ɺqL%LL(1ɺL+HHD$HԻLHAL(1ɺ#Lr(1ɺH5fL+LN(1ɺ HLH]L!(1ɺ&PH\$LLH/HgH@LHiIF"MHnLH3Lw'1ɺ6HLH~LB'1ɺtH̻HD$aHLH@-IF@ HLHL&1ɺDHGLHTL&1ɺ-H2LH'Lk&1ɺ0L%_JLQ&1ɺ)Lj)H>LHSL&1ɺ>FH)LH&L%1ɺAL%IL%1ɺ:L(HuLHRL%1ɺ3袵mff.fAVL5mIL| AUATUHH0dH%(HD$ 1HFPHT$H|$LvH1L?(XZHILt;LH1H7AHD$dH+%(u6H(D]A\A]A^DAL$1L 1')=fAVIAUATUS81ҾLA1ҾLD,AD tED9tzCtX ډ Љ ‰ Љ ‰!AAAAL1ɺM1H5G&D ؅u[]A\A]A^ÐE11A1ɺSLjH5G&[]A\A]A^fD+11L2H5CG_&rfAVAUATIUHSHHH9u)fHH9tH9Xu@[]A\A]A^LHDs H{I8AUL-F1AVIf1LL%XID$P ZHxx-HtSf@I$@HXtYI$H(HPI$H[I$]A\A]A^f1jLLB0%1 @AUHATUHSHHH9tH9ktVHH9u9De H}H)SATI1LH5E$XZ1H[]A\A]ËCvCH[]A\A]f˞Dm H}I軞AT1ɺAUI1H5.EL}C$HCHHBHY^H[]A\A]AUATUSHHHHHH9t#H;uXH@urH[]A\A]1H9tfHH9uHHLŜSI1H5eD#XZ1H[]A\A]fHxDh 賝HI訝HL SI1AUH5DAT(#H 1;D1LH5C"1 ff.fATE1UHHu2HEXuu H"s-DHIHt@L`HL]A\fH!rH.rH/rH&rH'rL$1ɺ1H5s7"DATUSHHdH%(HD$1茒AąC\HHHH9HxHHPBHL H1HVDH9H;uHxHtAąH$E1<(AAfDHD$dH+%(HD[]A\LKH]LH5r1E1!LKHeLfH@HjE1LLHHsH1H5ir XZKLKHtLkkfDLL1ɺ{1H5#r_ 5DHATUSHHdH%(HD$HGXHDH HHH9HH}HHHEH}@*HsAąWHKXH DMLEaHH!D1H"1@tLI;\t,tLI;\tD@HHH9uE9H$E1<DA4H9BLKHLH5p1E1HD$dH+%(HD[]A\@LOHLۘ믐H<$DE12HAfDHLOHsH1E1LH5-pnXZkL,1ɺ1H5p?>LKHL{3ff.HHǰH91E1#fD u'xLv&DHH9t"HPHPHRuуuHAH9u޸tE1Et>A9tDffI*H*^Yw,t=Døf.f.AWAVAUATUSH(HFPT$ Lt$hLxD$pL$DD$,@LL$H|HILh$IH-HxHHHHǀ`H1H)hHLt$HKH1H(IHC2D$ I]MeAE D$AE$D$AE(HD$IE0D$`AE8D$pAELD$xAEP$$A$AET$A$AH$IIIIIExIIExIIIMt*MLINXіLL6nHCĀtIl$X1t IL$XH(L[]A\A]A^A_HL#HIH1H|'IDŽ$HC T$p$DŽ$C$fL|1ɺ1H5s;)f. 1E1LڔH5=;Y@IDžLL 4L1ɺH5:1E11ɺ.E1LH5:fIDžLL3L1ɺf.HWGLB u+BDAWAVAUAATIUHHSHLD$趓D} H}I覓AULL1AVIL5:1SLAW(H 9]LvLD$H[M D$XHI!MD$XrAHL`DhLHAątzAHD[]A\A]A^A_fHL`Eur@뵐H}E1ALPELL!P1lXZL,1ɺ21LCjfDLML1E1'<ATD$vUASHGHLH@PHxHtRL1H5$HCLuHkL[]A\H@HHH0H@H{בLk@IH5F81`1ff.H(HHH93HH@HPXH0ruH%r@uu@ATIDLHtL`L׸uLA\DLE1LIH5l71LA\HGPHHHt}SH=@H(HtCPPP$H@HHHtHHu[@L1ɺH561[øAVAUATUHHHGPL(Ax G[HLAą}HLL5Z6E\uAHD]A\A]A^H舜AąuH艏LݐIH551HL55QLL,I1HLCdHE1LLI1HD]A\A]A^fDӎL܏E1I1H585YHD]A\A]A^f.HHtu*ATM Aąt&ADA\f.HxG1L1ɺ1H54DA\fAWAVAUATUSH8H_XHH|$H\$ Ht$T$H\$D$,D$(H9tHD$ H\$HHt}H@H LH54LHHsH1HA]A^HxhtHxލHH`0H@hHD$H`XHǀHD$l$E1LlL;|$afIHLEA9o$IGhHt|IWHL H5>3LJHpH1LI_hA[A\HHxhtHx HH`0H@hHcXHǃIHt IHt sDT$EIGH@ IHxIG@^Lq6IMH@@MML蕀uFAL11H52-H8D[]A\A]A^A_IGH@H%8MML SIHO Eg$tSIH@D9t=AG$I1ɿL݌I:H5X11wIEg$HOIIGHBHAwL t 1AWD f.E1AE;wLDL(uH-0L 1ɺHL 1ɺE1HE1pD)1҉D=ÅkAG$D)AG$uAGP)AGPD)ML;|$tHD$|$(t D$D$,D$H|$+t$AądHD$HHtH;D$tt$(*P$L$Ht$HFPH9XHt$HxHGH@H@HHtHt$AąVMtAH HD$ tQHD$HxPLXMt|$D E$h|$8T$AG@HCE'E9t'L5Lq1RLL$4$DHL$4$D$hHAݸDD$0DH$`ķ1Eo,AG0AWDCuAG$D$$ \$t|$|$L5E1LLOqAP1SCA]A^@H|$OP$xV&@N'Eo(E*Eo0$ \$uEg0EtmHDL5L ,Aw4H}jv AXAYLpEO0P1ɺD$8LP1AZA[$t$8|$ ؅EA_t$\$ IG`SHITpH@HHH9uHD$@:HIGXIGPHt#HHx E1E1j111jjkH 1Ҿ;HAG<$AG1H|$xt HD$xEO$D9r AO(3&AO$vA)1D>&HDŽ$AG($AG$HD$xHt!HHH9øHEH$IoH HD$@IH&HH@HD$(L(L9#L<$I#HH!HMmL9l$(PHIUHH!HuuHR@H (IL`I9uID$ L`I9I$H;P@uIm HH]H9upfHH9[KSLLu1ɺ|LL%[`LL<$LL1ɺ1LHD$LLnL1Ht$@HL5 1ɺ7 1L|LI L_1ɺ D$ ?LUkH56 1E1MH$dH+%($H(L[]A\A]A^A_HD$HE1H- LWkHH@H@LH(s(1^Lok_H1kLk L5z 1LL]1ɺL1E1qLuk I$1LLA1ɺtLL%V^LL<$L0L IH"fA$AD$AD$ IEI$ID$ID$I>ID$ID$ %IVMt$ IT$(IVHIFL<$IGXMgPI_HD$HHD$L(I9}L<$L5: H!$ImIEHD$H9 HEHP@HHHH9LxL#HLH%"MtQH5H""IT$ HuHK!H5 H!eHmH9l$pH5@H!7L<$ L\.DL=9La9L<$ L\LHC0C8L1ɺ: 1LH|$@HH91HH9D$@u$t-AG AGAG(9vAt Eg@E"$H$HtGLƉ$HHH$H"AG$!$MDŽ$$I~PqHHLL` HLjHD$ H1AnAN$AEf1EN$A~ A)D$dA^DDD$AA1҉DA1҅uAV,EtAV0HHD$@L H0LVLH91LB BIPL9D$@uI9$$DŽ$$H$H$HB'D$tH$9CL/$|$:I~Pt $$t$H$EH$Iĉ+D$dD$HIFXHD$XHDŽ$D$$$t5H$PHHAHf.HHHH9uHl$@MH9t$@f.I@MHHPI9z HJ9ztoLHr zA[HqMSH)AKIKHqI9u@IwLM9t L~;~ vH~HJHN HJ HN HHF A[HBHPI9tI@ L@H9KAD$AA@T1A<$$EPHt$ Lsh1 AF1+$Av$E~D$$AAF AFEE^HEdE^0LWDE)LD$@1IHBI9tfDHP pHBI9uDD$w L=LT$EVL QWLgEҿMDHQVPHt$@1HALgAUAF { PAFPHl$@1HHAHmD\$HLE~ 1LASLuHHHL LNDIDN$HI9uȅ" D$B4(;t$g A|$y#AN ANʉT$D$H1Av$AŅt*H$QHHFHLA9DGHH9uANDD$t AVHuI~& HD$HTM~`EDl$(E1M$H\$EAnHI$F At$LHAF0HHl$HUuEA;D$ RHJ@H HH H9 HRLT$8HLeP1VRHt$@gDL$PuH LyLT$8LIRHHLLHx`E^DDL$0HUHPhEHUH*Hhh EVHDEuA+F0CI$At$HsHJ@HSH HH H9 HRHPLd1VRHt$@yDL$PsH L螉I}L+IEDL$0HCHI]AH ID9L$ AFAV D9u |$E~0)lj<$$DȉHH$L AFDDfDDd$8Et>\$t6H$H$HLHHtHIH9HH9uI_H\$(LcH9\$0H$D$THD$HDIAL$H$tKD\$8E$H$HHTfDHH9{L9 uID$HD$(L`H9D$0uLAHŋu$T$B ($9D9l$`OD$$D9;DD$Dl$`E$Dl$`$H\$(LcfD$|$DT$B(A9sDD)H$HL$hHT$pHHH|HHtHML9THH9uH\$(LcH9\$0o;$7fDD$$;$+AFHHLHH9HLA0HJJ<H9t,H H9uHH9ufDL q@$@SDT$EEN u t-HCH1LMD@$H HPt$ ^_uWSЃIvPH HCHMLH HPD@$t$ ,ZY{@AutL$AHDD\$TEN$AL$EA}$qD$H1DD5AAV09B9AD$E1Ht$LL~D$TЃHL$1LLr(Cf@($1DDD$HAUAV AVD9MAF09IfM$)IT$ AL$AIL$A[I{HQH IKA+T$ ASHqH9uHrHH9t HVD;N vH~HV H|$(IL$IT$ HV H:H~ A[D$H1DD5A2HL$LLX{EN$A9D$H@u AF(vD$TAu;u@LAHn<$t9[D$Et EP9$$ $|$EN@D4:EX9P9DD$ERD$EL$\ PHt$01^_Dl$`$D$fDHCHE1E1H=yP Hp@$H$H|$ L$L$TH$HDŽ$H$PHPI>jjjH0t8S׃rEFD D$8蚤$h|$EAEL8I,"AG4Eo,1Ҿ@AG4HAG06AG@A_0AGD\$LJ1ɺ 1H5HdH& 1QL5!LIL3XZL%W;1ɺ1LLLL<$C81LL<$HC0 LL<$ L!; f.L;1H5:|11L $L5:LNLLH<$ L<$ L:1H\$xHHtHCH$H:L LDHL6M PL51LH$XZ)AGH\$x1Aw$HcHtHSH$L KPH9RLhL LD녋$MAGL5LHO L|L51@ LLCHL1LpHB (L9 LL<$XRH 9RH58H=89f1ҋ$$hAw$L$0A41HHDHHHHH!1HH HDHIH EH1WL5LELAXZLC_fAWAVE1AUATUHHSHHH9LEt-AHIE1HH9uu I8t<1E1LKH5!=HD[]A\A]A^A_HCPH5 DL$ H8 I9FDL$ tLD DL$ HIEtAD9E~LLCƉD$ 讫AąEt.IAOH IHBHL fDHHH jXH9uD;|$ r!`I}AI>D9|$ tAIUI1DL贩AąuL 1ɺ1H5HKXALп1ɺ1H5E1HEE1PLJ1H5XZhLq1ɺ1H5hBff.@AWAVEAUAպATIUHSH H$`L$(1DD$D$XL JHD$ $h$pD$dH%(H$1wHLN(H5ID$ZY H‹H E1Ʉt H}PjDLSD$ HPt$0AWAVDD$8H01ɺHLDHHpID$H‰t$(H t HƁHHt$0qĄ|$|$@tAAL$L$@|$hD$hT$(HE1HH)‹D$(PDD$Y^AŅ~ AD$J|$?Ht$1HkH:L PL1ɺ1H5 'rfHh0L,>IH5*1L1ɺfDH)IL MXHD$XHHD$8f.H/L)1L`>I L޿1q@L41ɺ1H55GL1ɺl@MN(L=H5,) DHMH1EH-)Ls U`HMPL7HHh1DLIsLh1ɺuH5\H\$`xH.L<IH5e(1AK@L1ɺ H56(#@Lܰ1ɺ1H5(L HjHL4)L'LL\$xL\$tIPL\$чL\$L޹H1LN=L\$oL\$L61ɺK@L޿1L\$DL\$f.H\$`Ld$@Dl$lHgH|$HHD$PHHHGHH8HL1ɺd1H5H\$`貲!DLt1ɺgH5hH\$`脲裆H}PBLHEPHmX,HH8e<j11E1jE11HuuZYHEPHHuX,LLD$hH|$HT'L&HL\$(,Ht$L9;I,1赱H|$8H\$(+LMIH5j1z.H|$8H\$(+LBIH5/1?H\$(Dl$@Hl$8Ld$HL1ɺY1H5H\$`.HEPHL$pE11HH8HAŅEZu|$p+L<1ɺ IH5x1蒰HMX' LG1ɺ1H5|$ZdL!1ɺD1H54Hw*L{:LIH51oHH\$(>*L;IH51ǯ{LMHL;H5H\$(藯KL^1ɺH5\s'H}PEIL\$gbL1ɺr1H5H\$`-L1ɺm1H5H\$`5H)L:IH51Ѯ)L;I7H( L"ILL71L\$wL\$;H(Lv"L7LI&1L\$8HEPHuX,HL eHLx#L\$!aHL\$D(Ht$L7IC1ѭL\$IPGL\$Bg:HLL9tAfALt)H1HRH׃:u HRR9ALwH L9uȸfH AWAVAUATUSHdH%(HD$HGXH@H4DHEL6LfLL}HLHHLH5>1E1UEVhEH,H{DT$D)L\$L jIDH趯 ZYL=>DT$ L$1ɺH޿MMI ARP1At$`_AFhAAX@)‰LHHH H 葼Aƅuz1ML5H޹WAD$`I$HxNI<$EL=zML=At$`A>EDAUATUHSHHdH%(HD$1t';u(L_=HEXH"rH!suHE\H{L 9LDHLl=PH51E13ZYHD$dH+%(CHD[]A\A]LLM9IL$HQ@A|$L@LAD$(;AoHEPHH9X=JL>H5A11^(ftcL;E1亠H5fDH&]H'rHH su$H2uLM9ǼL =H5c1E1zDDH'%H$sI$H9ChI$@GAąa1L<H5f.ID$@2HiAąHL(2IH51蟟if.HIT$HHB HHHLIHSL:@LHHx FLE\OM9H% DH8L:IH51E1辞fLJ(HHL9IfL):f.HA D$H@XHt[HMP1HT$H9ЅtGD$t@HEXTL(:HYL:IL):J5DAWAVAUATIUHSH(LoPD^HT$I]EuD_`uhAD\$HL L=H,H{DjE$ DLHD$AYHEAZLDy}H /L /LK:LEH1HT$RAWL=ǽPL1H }D\$EhE$D9kAEDL ,H{E9L\$DHDT$HDžj L\$ H{AHDL I,$ק LHXZZDT$L=IARL91U1AVS՛H AH(D[]A\A]A^A_fHLjH^ YL^HAVLS=GIL811d_AAXfI$I$D)H9]DLUHLUTMXVASLt$(PDEPH t>E$6A$L+uh uۉD$L1ɺ DD$L1ɺL1蟚DL$DUHHHW`FpVH9HEHFH@u!FP1F$E8NTHFXH]@GYu2FPF$EL1E8NTHFXH]fHt$Ht$FPF$tfATUHdH%(HD$1HHGXH@@ua"HtwHgL8IH5V1E1mHD$dH+%(HD]A\fDbLr7IDHHIAąHEX uw@Av+]L6I?fL6E1XH5蛘)fDH ttHEXtH0OHdHvL7IHlL6IHXL7qIH5Ǹ1o@H L,7IH51詗7ff.@ATIUHSHAHYHVH9uHH9tH;Pu[]A\H( HtMfH@ @IT$H}HPtUHUHHPHUH[HE]A\f.1L{)H5̖1p#AW$fAVAUATUHS1HHLgPdH%(H$81H|$)$Hf7I$H(H#EXH&AŃHHD0EAAD$,L#jtL/L1ɺ]2Ht^At$Lw1ɺXH5p1芕E1H$8dH+%(HHD[]A\A]A^A_E1HtAE^*fAL=ٖHE[t:HHt.HxL='6H'2HH1] DHH=MAD$aH l'HIHDEH5_'HDEHDH1SH=4hZYf[]A\A]A^fChA$slHƒH(\(HPcHHHHShA$9ǃN@slChA$HƒHPcHEH(\(HHHShǃDǃH5!H!VELL/RPHUGH1P1臎H []A\A]A^DSh{lstH5A!HpdHI$H9 1ShKtslDKpAADAuHHt E\*1LL$.蒍1L1L-.k[1]A\A]A^H(\(HHHShǃShH51 fOAEǃH5H 5ShslKtA$AHƒHPcHEH(\(HHHShfDI$A$HChDHL D,HzjD LE=H$Lv,11YslSh_#DA$ʉAHƒHPcHEH(\(HHHShDHƒHPcHEH(\(HHHSh>fDH@XChHЃ{ltHcH(\(HHHHShAHƒHPcHEH(\(HHHShH(\(slHЃHBcHEHHHHSh@DAWfvLAVIAUIATIUSH8HHL$dH%(HD$(1)$L9t;Hl$$HCHLHxH1ۗufo $fnD$$f8=) $HL9uIIL9tAHl$$fHCHLH@HxH1臗ufo$fnD$$f8=)$HL9ufoBL1Lf$Ht$f~S LHHD$(dH+%(uH8L[]A\A]A^A_UHSHHF HfHhuHUHZhH HSuDHHHHHHHHHH[]@HzpHJpHHJxHHHJxHHBxH[]HH°H9HY`HVH[]HEL)6H5NLHH1dH1[]fDAWAVAUIATLUSHHGPH4$HxL0T$ 1L9HD؏ IHIG11ID$ D$LMIdLM$LE1HH+LUPjjj+aH0HCU$U HЅtCL)A$9H|$A$<$U )щM$uI$I9tC 9rC$9rRHI9uHML$H1RLz(E1H5ͧXZHL[]A\A]A^A_DLLM$A@Lt-IpHVv9AP IpID$P(T$Hx9 HHfH@ H@T$@HEI?HEIGL}HEIGH(Io tAP Ip,)AP Ip1ɺE1LH5辅t$ E M$fD1E1LH5UqL&1H5,H\H $H5H=ą@SHct[DHCPHKX@H1LKHL& H51̈́XZ[fSHu[DHCPHcXH;LKHL H5Y1mXZ[fAWLAVAUATUS1HL~PdH%(H$HL9HEMAGaDHEDEAHVX!H!~H"sH&H'H.H/H$H$IA@HLLT$LT$<HEXH4H%DH-OH4]Ht D[(EH<$H$HHHHH9ǸHD1)H\$fHHH9fHl$HHHH9=HCHxG^t!nu݉$HCHx Lt&IHt$1(D$QfMLZ1H5 L~1ɺ1H5ԁE1H$dH+%(v HD[]A\A]A^A_DHLw$I@H5S1mE1HL/#IfHL#IfHhL#IfL"1H5܀HL"I/HL#IHL#IL9HH1HDH$HHl$HHEXt H$:H4H-s H;H?D$HHZDENH@H1ɺ:L pHHt$L`$1YH^Ok.H<$LSLDH$Ht @\ H<${HcHLlHHuHHU L-EuuD$ tmKHH H@L@HHl$ 1H#HG| AG,=mHt$ILF`11~ADHLT$KHEXLT$"H%HD$HHL9HJAHHyHt G[HhHHD$4LH6~HFHYAEHt$DDL2GHEXgHuHL A1Ht$L%"11ۺ:R}_HAXiHEHL H>PHt$1L! }XE1Z2$Ly1ɺH5ŝ1|D$HI9 HH9Ht H$HHt 8yHui$L6y1ɺeH5LQHCHHH@CLCPC$HWHtHPHR H$?HEXDEHHt$1LI1{Ht E\ LZx1ɺ01H5cym{L9x1ɺHt$1N{E1uH$@\ H<$jvH<$A_=L IHʛ1HD$Hƃ1zH$#I|$H5H|$)tH|$H5 AO,Ht$ 1LGuz=LLEHH LYs1ɺH5MnvE1H$LI 蟋D$LIH|$$bL IHt$Lr1ɺ1uE1!Ht$LIO1uE1Ht$'1L(uE1ff.AWAVIAUAATAUHSHXdH%(HD$H1uHHtL~XI$vEEAF[IDL"ADžL+HH$LH1ɺHIL1tAL$DHIHpADž'ELtSL|DDLHADžxAHD$HdH+%(*HXD[]A\A]A^A_@L@uAIFXH%@H-II9upIIH9Hu*HHIH9֏HHxB*HHIFXH(sqEulINPHHH9tUHfHH9t8HPHH#ZXtL3H=H1FH1dCmLLI]L`L\IH5ύ1l?L'L(1ɺIH5j1l3ff.AWAVIAUAATIUHSHHM$L9u_M?I9tPIGDLHpAąuLi1ɺ1H5lHD[]A\A]A^A_ÐAE1H9tHAH9uLLD$Ht$DH=H1?fDHD$8dH+%(H@D[]A\A]A^@CH1ɺ&IHkL5PL1LiXLZ=Lzf1ɺ)1LE1iifSHE1LQLI@1Ei I}HHt2LIL1iLHMmD%ƕfHD$(D$H$D$D$D$Eu@H=tLde1ɺ:1L{h fDLHH=A&Eu1HLLI61&hE1s}AWE1AVAUIATUHSHHLvPH|$dH%(HD$81HFHHD$(HD$ HHt DE1EAH@ H#EXuHAąHT$LLAąumHEX@@MEHLmHH@LhHAHD$8dH+%(HHD[]A\A]A^A_DL$HhAL pAUH5L*ɺLD1E1f^_@LMH1LH5tfXLMH1LH5D`f(L:tL$Lc1ɺ1H5ffDHHHHH9_H@H@ H@XHtHMP1HT$H9Ѕt D$THLIH5h1eJDLuL`HD$LHx+m HLLHD~HL$ 1HHHD$(IAą~HD$(HEHHHtE\tSH1HAąLa1ɺ1H5duHhXLla1ɺ1H5cdGf.1E1L H5-HD$(@dyfDAWAVAUATUSL$HH $L9uHHH|$H$@HIdH%(H$RHFPH|$DŽ$DŽ$HD$ H2HHD$(1H9˹t$HHDHBXHt6H9 Ht$ H9J HPL51H HHUXAÅuHxHHkHD$H0HH%HItXZtSMuxMH'HH9D$(wHL`H$LfD0 H' HKAoMHt$HAoUAo] IAoe0Aom@)$@AouPAo}`)$PAoEp)$`AoAo)$pAoAo)$)$)$)$)$)$)$)$9IExH,$IExH$AADž$E1H<$#Im$HHH tAMA}$AG[ fH$H HH°H9{DH(EMIHt$H<$gAËD$@ D$(D$E$tsHD$ IL5~HH91LH$H<$T$H1LT$ I1LR]Y^|$8ILL贿Dt$@D t$(EE1LEuhLH1AVL5 ~IL1L]XZIGXH%Ht$( t$@HDt$EvMtLAf.DD$@EH|$D$[D$LD$lH|$HD$SLL1ɺIH5}17\D$fD@HH9D$(xHH$L`AAEtLHMt L{DIH<$I%L2f.$LiX1ɺH5b|1|[D$cA EEq HYDHICH$IfDH'sH)DAomHt$HAouAo} IAoE0AoM@)$@AoUPAo]`)$PAoep)$`AoAo)$pAoAo)$)$)$)$)$)$)$)$ſI}x2AIExE1ADžH$H,$@L|$ HIDL ,Hxje IuXIIDL ,Hx$ce L4$=`L5fzIP1LP1LnYAAYAZIEXHXL1LX6YLV1ɺ1LYE1fDH$RdH+%(g(HĘRD[]A\A]A^A_@HD$ H@L5yHDL ,Hxj[d A[LB[IJL1uX:HH9D$(tAomAouAo} AoE0LHt$)$@AoAom@)$PAoLL4$AouP)$`AoAo}`)$pAoAoEp)$)$)$)$)$)$)$)$IExIExH$AADž$M I@R DGEt^IGXH7A}1H|$HELVDT$@AEuHD$hEOfDLS1ɺf.H5w1VE1DMR1|$D$D$0D$0H<$$u$$MD$8D$8B:L8H5w1"VE1 f.Ht H$LR1ɺ:(LAFDAU$D$(Im$H5HkAMIGPHL$H$HqMOHH|$HL1HpDŽ$R @L$H|$H1H$L觛$uHcrypto_LH9$;HT$HH|$LL#%A}$HHHjAE D$0f$LIQ1ɺf.L,Q1ɺ`@D$@E1mLP1ɺ]DH,$wHH9D$(~pLpH5I~(RiAFHH#EXpL _HtHCLH(=hL5ntL1L1ySfAE$fDE]E H|$IoX,L` H|$IwX,RD$(AU$[fDEIm$LDHH5sUIL11R^E1_fDHD$ LIH5ks1RD$l@DEmAHIAEt;H$IfEH5H=-]IHHl$H6@HhH5,HegPH5HNg9L>`HuLHl$H]1DHH9T$(# HELaAEtELHt$LL<$׶D$HH$IH$LL RHH9D$(mHAoMAoUAo] Aoe0LLbAom@)$@AouPAo}`)$PLAoEp)$`AoAoHt$)$pAoL<$Ao)$)$)$)$)$)$)$)$践AL$IEx$LADžL 2LD|Ed H|$LH|$1OD$@IL5pLL1ɺLO"f.$LYL1ɺf.MRI$I$H9kD@(EH<$LK1ɺH5oOE1f$LK1ɺ[f.HH9T$(ikE1GfDHD$ HI9 $SD$D$8{$LIK1ɺf.Im$HHHcAuAMEE 11L$L芥$~LiqH5n1M\$(E1 \$@ |$0>L$1@ LLt$HZH$@21@ HHD$PYLLrW$82IGPAUhL51nHH HD$0$92 $ext2#$ext3$ext4P$xfsHND$pHD$xL$82 $92LIH|NH?HDAP=bLJ1PLL$X1|L_AXH$2H HreiserfsH9$IL1L0LLH1ɺ/1LL1ɺLLHHL1LQ H5K[]f$LyH1ɺ f.H<$1($LFH1ɺH5?l1YK\$(D$ \$@MtLD\$E]A}$RHHw`AMAUhE1LEE S$L1H5kJD$ADžfLlG1ɺH5`kJD$1L$L'G11H5k\$( \$@2JD$yfH|$LLP$LF1ɺHHW_AMAUhE1LEE 3 DT$(ELH|$HLL5`j1ɺLIL1aI@LD$#H5j2ID$yfD$LE1ɺH5i1HD$D$D$@:f.D$LE1ɺH5i1HDt$@D$DA}$$LaE1LxH$I @HHD$HIGPHL$L$@2MOHLLT$@HjLHp1E LT$@8 LLT$P!XHHHD$HHL$@HxO Ht3HL$@LT$P/t$@2oIH|$HWHHHD$HHL$@HxTO HHt.HL$@dt$AI[IGPH\$H$@2MOHHbHLHp1D {1H$H$HwB $ $LC1ɺAMEE 11L$L$wH% L$LJ(IH5%g1?FD$$LB1ɺRLSnO IGX$t$011L$ 2LLL$XEAYAZf$ex$tH+D$pHD$xLD$пLILM9L)H|$11LL5fLA1ɺL EH|$ 1L5e1ɺLLADMII9AaHT$ AEhAJTHH1HIIL9L5Ke1ɺ1LLL $LT$8KDAomLT$8AouAo} )$@Aom0AoE`M)$PAou@)$`Ao}PHt$)$pAompL)$Ao)$Ao)$Ao)$Ao)$)$)$)$L $LDŽ$L$,H$L5)d-L@1L4CD$(AU$oH$@21@ HHHD$PcOHLg $xR IGPAUhL5cHH H$$yRb $@2ext2K$@2ext3H\$PH5.HW,H5HWH|$PH5"WZfLLA$BL>1ɺ1LBLL1AE1ADž&ALnH9D$0t$LiwHCHfAHCIHT$Ht$0DT$tHL\$pH D$H,HxL jDHD$M LT$H$(2HD$hAIzH A,M $L$pEL =LIXZt$XL\$p11LAS@Y^DT$tEqH5HVD$pl HreiserfsH9$LL$HL1LR@蘺$92LIHAHHDƒ=H1H$RAPL4PLL$h1?H mL$+L I*AMEE 11L$L$L1FH5K`g?$ 2H)T$0L=LL$0LH11R$%?A[XL5_L;1ɺL>L>LbBIH5_1>$L=zH5_=LHl$H`JlLθL_IH5=_1W>r$D2H1L1$`RLL$`aL>Y^f$@2exJ$xR<L:$yRLIH?HaHDAP=nLd1PLL$`1=XZL%HLRu3I]4H5QHR $xR $xRAE $xRH߈$xRƒd$ @ =  $yR LHWRA$xREA} A}H|>L lHD$yRLDʄIH _H_ uH ?>@HKH/>HDARH=$1SHt$`WA[[A$xRAnD E@ $xR$yR=LL11;A L81ɺH5|\L5p\1ɺd1LY8Ly;DŽ$L5<\1ɺ1L%8LE;$>L71ɺj1H5[ ;'$LZL1:L1 H5:$UKS1fH$P2)$@2H$HH|$HJ Ht$HH$(H$@2*ZJ1LH5Z :;|$pLLI9$@2xfs LL$PLL19L$yRLIHb;H%HDƒ=JH1H$X2RrAPLPLL$p1U9H $`RH)$LH$=APLR1Iك19AYAZ\H$HH|$HHtHtHrHHH)H)ȃ1AȃN N 9re$H$@2HxHHItHtHLH)H)HL5;YL-51ɺLF8:=LSL118$82$82f%f=tv$82@ $82$92=z\LL117L$02L9L$0<H5HL L!41ɺE1L87xL31ɺP1L7VIGPHHt<:#t7H|$R6 IGPHtP,tHx@P,,IGPHH|$8THL$0HT$HME4LH|$IGPH|$Hj8DH|$1ҀIGPH4! Ht$P1LZg H$2[L$XRL9L$0HASL1t$8L5[L2]1ɺL151ۀ$B2tLr21ɺO1H5iV5=ALL11Ƀ\5$xR?L21ɺ1H5V.5As=LL114A}u$82 $82t @$82$82H57HD$X$82%JIU4MARILRL/14A[[MIGPHHt<:#t7H|$3/ IGPHtP,tHx@P,*IGPHH|$6H $HT$PME4LH|$蹸A;1ɺLL03=L L11Ƀ3$xRLf01ɺ1L}3A=3L L11N3W= LL11%3 $xRHLL$HLL12?LL2HL$0f1H$HĎ)$H|$H"0  H$(2H$HH|$0HH  1/ H=ugHuH|$H$H$HDŽ$H$HdH$HcH$HD$0H$H H$HD$HH$ LH5 1y$D2:=:LSL11ɃU1$xR߈$xR&=L9L111Z=LS[L1103=LWL110=LUL11Ƀ0$82EH5=HEy$xR3p$xR L%HLEu]I]4H5HEn$xRwHLL1/$xRHLL$Hh1LU H5" /b$LL1x/C1ɺjLL0,X/@1ɺgLL,8/$xR0mLLO/H5v H^D~=}LYL11.H59;HDH5 HD$xRH`EȐ$xR6HH50HT$`CHT$`D$pX|$XD$X@*D$X $92=|L2?L11-A}D$p$82Ht$xH/L zLH HD$92WH=LDȄLI VHt$XHDȀ@HPHD1rAXAYHuHHmuL{&1ɺ1H5)vLU&1ɺ}1H5h)PLTL1E)AT fT"LL)HL$HLfLL(L1(@AVL1ɺ^ AUL-IATIUSHH(dH%(HD$ 1wHLNHL(_HAXVHLpHM9tYHAt$HLKHL]g L1E11(Y^HD$dH+%(XH D[]A\A]A^IMI9!1HI9u}LH8ZH9XA;u1LAąHL]!AąIFPH5H8o9HHAHAąHkHH5H69HAfLXHDMLLaP~ 1LE1&XZDLIE1I9tfHAI9uHw PL@HAt$HLLKHa "DL訠H IHAPLDALp EPLP LE1=LLI 1%L"1ɺ 1L%tLo"1ɺ 1L%RHLc(HH{7HtUHL9u;L$"1ɺ 1L;%L"1ɺ 1LE1%IFHHHw1LH,$HD$AąL!1ɺ 1L$:ff.AWIAVAUATUHSHHHT$(Ll$@H31HL$HNHLﾀdH%(H$1! HsXHKPLHIHBH蚔H5EL6HHCPH1ɺ MLAHDHHD$01#YH^H55LH^LHM$HD$L9u1M6L;t$"IVH}LuHt$ L*E1 +#H$dH+%(PHL[]A\A]A^A_@HCHD$ HML$HsH1Ht$0LS1!"_HAXL;HH5D4HHA$E11HHjjjjjQjjjLL$x!HP1ɺ!HLHE111LHyHHXHEHHKPHEHH(A$HHHHAH@@au3H-Lm1 H5@Ht$ 1ɺ!E1LmcLW1ɺ !HCPHML Ht$01E1BXZHCP LFLHt$ 1E1 HCP LYLHCPHML k4w UHAWAVAUATSH(HdH%(HE1H9AIE1M?AL9uEsL9uhHCHL`PL9t`H{臍uELY1"H5> D]HEdH+%(cHeD[A\A]A^A_] rlzEIHIILHH)H9tHH$H9uAL)MM7Ll$IM91M6M9tTI~ύكAD uIvI<$HH FXFPHIFM6H!PXM9uM7M9uM6M9I~j1E1jE11AXZEuL1ɺ"1H5=D]D]M7M9IE1@M6M94A9sDERA|uM$I~D]DULE7H}H蛑DUD]uI~DUrLn"IH5<1DUE1oL 1"H5<AfMt#LtLwLT1ɺ"1H5K<gE1WAEAI<$D]D]L1ɺ"H5;D]A_JL4i5{iuENE1I~EL"IH5;1D]/ff.f1G]tTtLuHHHGP1ɺ6#L*H5;LwH1-H1DAVAUIATUSHGHHPHk8EL%vmk<*k@kD(H{HGXH=r {HHSHB HHHHH{HDcH虓HLaIH1UATH5P1AEH PAUdH{HGXHH[]A\A]A^HSHB HHHHHH{L%SUwIHLPL~1wAEY^PAUd}k8HSHB HHHHЋk8IfHSHB HHH{HЋIH{IdžfDIIM HD$EEIH@6H)+AH+EAOtAWpASAPWLVHt$0EB6H HD$@tAGt5DH}7LtF  GuzMtHD$@ IFXH-H  H%0 Mt 1LG5E_EtHD$@, AW,IFXINPH 0H*E_0IFXEtHIFXAw4 LtAG4HTHLDDEE I@EEL%1ɿ1LLL%ILPH|$ HL'u IvHIIV HbHD$ H5:Hxt*LRtHtHZfL9L1E1&MIIHL$H9!H@@@u1LLmtInX+EG(EtInX,IHP IFXH-H$;HD$Ht @\IIH9yHH9AW4H|$ LDd$,EgAWDIH9D$YH@@@uOLLt;AGDAO11LPAPEEG LAZA[MIH@H*7 Y H|$t AF] R ASL蛫H|$ HiIFPH8AM4AuIfXH|$H|$AOxLXAHJtHdAW4Ht$H|$ H|$-nLa&IfDAHEO| fII9Lz#LDDL$4L HATL#ɹLDH51^_ED=H*8DL8uAG41(AE\  LLz1ɺ$ IIAwxAAH9ǸMMHDb@L%$L1ɺ$L/:f.L1ɺD%DH|$I H\$AGxH9HD$H@ f.La1ɺ#1H5IGBH$IIH9HyXfD$,E1ALeE1HL*E1P#1H5_AXHH7 L* AG4g^H|$ L<DLjL5]%IL%]1LtIIH9GH>HCH@.MII9J ID$I|$@HHH91HHH9BH9uDJA9L 19H5DL$DL$DE)I$HHD$Ht @\11LH?Ht$HeE11LL_h1ɺ%E1LH5EEEEu>H|$0HD$$Lf@[H|$^/AWxAH\#H|$ H5HD$HQHL$IGzL%-LT1#L3fDH}H5(HD$H*1ɺ]$E1LH5IIH9 HT9s^D1HHDH1HHID9t<=[<$EуHLh1PH5H1gEXZAGID$,HXf.IIA@LH9ǸHD11t1ɺ$E1LH5 uDLeL1ɺ8$E1L}H5} 9fIIH9 HWHB H%;AGY^zL"aL^IH5z1A1ۉG@AGD|A~H*;H,H|$ LIFXpT IvX,LD1ɺn%1H5+\AGHIL}1 H5{9DL1ɺ$1H5JAG4=4H|$ LoL_L8h%IHIL$>$HML$QL1RH5$E1LY^LL(@IHyL%1ɺ&1LL)E%H߾LٿEL LDL%M1LdH)H5!HHgILr^L;LIo&11ɺF$E1LH5s1ɺY$E1LH5LL$Tu3\$,H|$ LEÉD$,mL%SJAE\ +L L1ɺ%AW4H|$ L蹗Li]LE%IH,H|$ LIFX mL%Ln%LIEPLH8HD$8lHT$8LBHD$8HPH8L2 IH9HLI9p\SLAVI1H5uA_XL1ɺ%$zHHHH9L9'HQRHt$H|$ v Ht$H|$ w AE\ M 1L LJ1ɺ% L[)$LIl1ɺ &E1LH5%L%L1ɺ%LLH|$ HDV|L$[L=%IDHuAAWHL]1 H5uxL%HLtL%HLML1ɺ$1H5A?I_`HH(sHHpH1L'^AR Aw`LLH5tA[[L%mMNHL%Lq1ɺ$E1L)H5)JI_`HHfrHHpHT0Le]RL Aw`H5tLrY^>L"Y.$LIILYr$LIL;15H5qtǃL61ɺ %HHLL9CL9HT$1LHLD$-LD$HD$HI9HHxT1ɺ%E1LH5YfL|$@IvHH/LH|$ LLMm1ɺ(&LL2ZW%L?ILWL^IH5yp1L%Lţ%LL#W0&L¤I@LWLޚIH5o1k1ɺ&LLCkLVLǚIH5o191ɺ&LLL_VL)IH5[o1ǃq&VL54o1LIL1'IEPLH萒HHPnLU,LILȚ1dD 1LH5^p=INHH|$ H5AHL$'HL$HIzH|$@1HaH|$y H|$&DH<HD$HjE1A1jLjSH|$8*H A11ɺ$E1L8H58YN&1L%LL/1ɺ~$E1LH5RL AwXH5oLY^4WL SL1H5nAXAYH|$SLHS%APILӠSF1ɺ%E1L*H5*K1ɺ%E1LH5$1ɺ$E1LH51ɺ$E1LH5qAT SLLH5mA]A^Lj1ɺU&WL SLH5mbAXAY1ɺ&LL>qAL1 9H5~kǃm[LM@R1ɺ%&LIL1QLRL7&I"IL1$H5kE1H|$1l f&E1LLH5'HLQL{^IH5j1H|$WQL{%IfL|$L%L,QLILǛ1v%H|$ Llu+H|$P{%LIL+1HT$8L6uULP%LIL|1@K1ɺ%E1LH5HD$8HPH8L:` IIHL$H9L9tCHL9HT$t2LPAWHT$ LIL1R1%^_LOLAW P%1L;LfZIYH9D$HHIH9D$ǀ3LkOL<%I)L%L1ɺ#LL%L1ɺ#LLW"L%z1LL"fDAVAUATIUHSV(HHCH LnXM_H?H5(6!HIHHU`HL/IHH@^!N&="I11LH5fDH)H?H55HIHkHU`MDHLHHHDIHdeDIEHHHE`HUPHL\IHLHHE(u==!L&H511[L]A\A]A^fD1Lw1ɺ&H5[L]A\A]A^H?H5HIHMDDu4HLE4HU`IHDu4L 1ɺ&1H5@f.[L&LIH51E1@LK(&L3L1&H5Ld1ɺ&1H5[wL>1ɺ&1H55QrL1ɺ&1H5+LL1ɺ&1H5&L1ɺ&1H5L1ɺ&1H5@HGX@ AUATIUSH~I$IİH]L9u HLL+I9tvHtHEH;CuH@ H@0HtHHЅtHHCHHBHf.۫HtH@H@X@u ^H[]A\A]ff.AWAVAUATUSHHXHt$ dH%(HD$H1HD$DHD$H9+&D$E1L% AH9]t@HLKHLAVq1L-T$TBD$TY^dmE ;D$tHHLKHwLPD$ LP1AVT$dBD$dH dHUM$uPELz9tQ)9tHHLKH1VLLQAV}T$dBD$dH dHUBtHEpHt H;EXZD|$ EjuLE1@DL,@HILHpHtHKPH9NPu H9AWLKHL'1AVLT$TBD$TAXAYdH|$ LHpHFZtsHHưPH9tDG 9r G$9H?H9uAWLKHAVL1LT$TBD$TY^d^HJt(HHH911H9hHH9ut@LNHAVLsH1LT$TBD$TA[YdDT$ Et&HEH@tuLA}#AD9}LDl$Dm$Dl$HmH;l$L$Dt$ Dd$D91E1LHHD$L91E1LInHEULL@kLL RM1H HI1҃A?f.HHt@tMuH9\SHI9<uH9\ufAWLKHAVL|fHt H9n AWLKHAVLMHFHLKHLLAQPP1AVT$dBD$dH d*A1EHT$HdH+%(/HX[]A\A]A^A_@ H9$]DL$ SD9~(-fIEUP9HLKHLRL+P1AWT$dBD$dH d(fCZHE@ C^HHH H#PXHSXH0@^Dl$ H}HH9t2Hp LHPHCPuTH8" H}HEG_ HK L}MoAu C^HAH$@Zu|IG HHHHIH}BHLSIH8AULP1AVXD$dPT$dH dHHHH9tHt H9tyHEHP HHHHIH}:BHLIHAULP1AVD$dPT$dH deL}MoA0LEH5gL$(IxHLD$ oLD$ L$(HAIG Hg-HH[-HLEILeAHLݒIHAUPAV1LD$dPT$dH dL}MoD`E3HHSXHE1H-DHHEE DLE\HPHP HHH HIHHtH@@RHEHP HHHHIpHLKH1AVLLbT$TBD$TA[A]deHP HHHHIHP HtoHHtgHIaLh(H}?HiLIHAULP1AVD$dPT$dH dALh(H}E?HLIHAUuPAV1LD$dPT$dH dpHHSXHLh(H}>HmLLIHIAULP1AVQD$dPT$dH dLh(H}w>HLIHAULP1AVD$dPT$dH dHEHXtyHP HWHHKHIH}=HLlIH<AULP1AVqD$dPT$dH dHEH}G_WHP H\HHPHH}Im=HLIH_AUPAV1LD$dPT$dH dHt C\AYHH#CXuHH}H#GXAH}LH8H@HHtHH9t=H9tyL}IG HZ'HHN'HIH}_HIH}87AULIHLuP1軼D$TL}PT$TAZA[dH}ptoIG HHHHIH}6AULIHLIuP1AD$TL}PT$TAXAYdHExH9ExMLE1Dt$ LH\$(EHDD9ZHA H HH HHHHDH}HL$8T$05HLLtHL$@IHQT$@R3P1eD$dPT$dH dyHMELAA9RDHHRHH:t}HA HI HH= HIH}D5AW.LIH\LsP1ǺD$TPT$TA_ZdHHMHHRB\C EHHDD)HP HHHHIH}4HLIHAULP1AVD$dPT$dH dHE}HEHP HHHvHIH}4HLIHAUrPAV@tyIG HHHHIH}3HL#IHAULP1AV(D$dPT$dH dL}HH9H}GYAGW HCXH$H% HH` @\ HHtHEhHt)HHXH$ HAGC[@"}LuH8HEHP H HH HIH}F2HLIHAU!PAV1L÷D$dPT$dH dq1H$,  L}IGH)s,C[ =!HH@H @[@IG0Ht}IG H HH HIH}m1HHLIHAULP1AVD$dPT$dH dL}IGHut}Lt u DETEuH9HQHCIG HHHHIH}0HLIHPAULP\1AV D$dH HEHP HgHH[HIH}40HLIHđAUpPAVMo(H}/HLvIHtAUPAVLx(MLh("Lx(Lh(Lh(Lh(\IG Hv HHj HIH}u/HLIH>AULP1AVD$dPT$dH dL}BIG HHHzHIH}.HLoIHAULP1AVtD$dPT$dH d"HCX]IG Hq HHe HIH}y.AULIH%LmP1D$TL}PT$TY^dMoPIG H HH HH}I-HLwIHیAULP1AV|D$dPT$dH d*L}y1H9H9H9H9h1H9AtH9]XH9HMAF9t\Hu LRU$R VqHLKHPL޿E|$1袲D|$tH0AdEL0HMHHH9ufHH9H9u1H9M6AL;t$XDl$LHI9\L-aDHH9HhtCLKH*LAQpHLE|$1ͱD|$T_AXAdEM6I9IVD HBEuHHtHH9t HH9J`tLKH2LAQpHw-HA HHHHHH}HT$0q+HT$0LIH~LjR0P1D$TPT$TAZA[dHHM5Ly(U E$HLLIHsHLпE|$P1R肰D|$dH AdELHQHE$HLށM LKHAQRPQRw0HQ(HI(ZHP HHHHIH}1*HL{IHXAULP1AV讯D$dPT$dH d\HE&HEHP HHHHIH})HL'{IH{AWLP1AV,D$dPT$dH dIG HtzHHtrHIH}=)HLzIHs{AULP1AV躮D$dPT$dH dhL}MoMo(Mo(HEHP HHHHIH}(HL zIHeAWLP1AV%D$dPT$dH dMo(kLh( Lx(mIG HHHHIH}(HLyIHzAUPAVLh(Lx( DEHtyIG HzHHnHIH}'HL yIHAULP1AVD$dPT$dH dL}H}htyIG HsHHgHIH}'HLxIHAULP1AV葬D$dPT$dH d?L}H}`IG HSHHGHIH}&HLxIH AUPAV1L D$dPT$dH dL}@IO HH HHH‹ELHMHLyLIHR"Pj@1L菫D$dL}PT$dH dZMo(IG HHHuHIH}%HLwIH׉AULP1AVD$dPT$dH dL}oMo(Lh(Mo(Mo(Lx(Yt$ E|$ HCXtkH0r!H-rH ruH%rH$sCLKHC1L1}E|$H5KD|$DAdHCXEHH@@H H'sLkHH5{LHH H/sHkHH5,HH E!9D$t9LKHL_}1]H5QA蘩D|$DAdD|$DCYLKHLG}1bH5 APD$ mD$ LOHH-ҁLzHP1AjLKHXZLH1بD$DD$ Lh(LLh(I;UIG H HH HLEIL"HL=tIHSuAUPAV[IG H{HHoHIH}r"HLsIHAUPAVMo($Mo(3IHDt$ H\$(HD$(LID$ T$ L,RIJ)2HP HHHH<HIH}!AU@LIHL:`P12D$TPT$TAXAYdLL}MoHJT*\$(D$ \$ ;]LH*HRB\t$(tJT)9tHP H HH HHHJD(H}HT$0 HLHT$8IHLq_RHSP1:D$dPT$dH dHE%LIIG   @uHHu  Ll$DHLLHML}Mo'HP H HH HHH}SELIH!sLb^P1ZD$TPT$T^_d*HHElLh(IG HY HHM HIH}QAULIHTL]P1ԤD$TL}^_Mo(IG H HH HIH}HLYpIH_sAULP1AV^D$dPT$dH d L}xIG HpHHdHIH}cHLoIHrAULP1AVD$dPT$dH dHCXL}D`EfDdE$ ( , 0 4 8 < @ D H L P TIG HHHH<HIH}mHLnIHAU8PAV1LD$dPT$dH d=Mo(`Mo(DMo(IG HHHHIH}HLPnIH AULP1AVUD$dPT$dH dL}HEHP HHHH<HIH}VHLmIHAUPAVIG HHHHЋIH}L$ HLAUL$0IH~LZQP1sD$dL}PT$dH d'pIG HsHHgHIH}xHLlIHdAULP1AVD$dPT$dH dL}L}Dt$ H\$(Mo4Mo(HEHP HtrHHtjHIH}HLVlIH|AULP1AV[D$dPT$dH dMo(Lh(IG Ht]HHtUHH}I]HLkIHa~AUPAVMo(%Lh(Mo(Mo(IG HHHHIH}H*LakIHAULP1AVfD$dPT$dH dL}IG HtvHHtnHIH}sH(LjIHw~AULP1AVD$dPT$dH dL}$Mo($Mo(Mo(IG HHHHIH}AULIH{LhWP1`L}D$TXZMoIO HtKH HtCHH‹ELHMHLqkLIHRPj@lMo(Mo(bIW(Mo(IG HHHHIH}H LiIHlAULP1AV茝D$dPT$dH d:L}H@HxXHEHP HtPHHtHHIH}Li#IHU|ASAUPAV?Mo(wMo(7Lh(Ll$DHLyLl$DHLĂMo(IHP(?Mo(XMLoRH5FuE|$茜D|$DAdEHH;|$tHt HtxLt_LKHL1L3oE|$H5t%D|$DAdoHkXEILpoVQH8uH9XuHkXIG HHHHIH}QLIH{WAULbgP1AV耛D$dPT$dH d.L}IGIG HtzHHtrHIH}HWLgIH"{AULP1AVD$dPT$dH dL}IGMMo(!Mo(Mo(LOH1LzH5VsA蛚D$DfPLKHE|$QLk1H5sQD|$TAZA[AdE-D$LKHE|$1L=zH5rD|$DAdFEDIW(Mo(Mo(Mo(HX($IG HHHHIH}HLQeIHiAUPAVDIG Ht~HHtvHIH}H LeIHhAULP1AV D$dPT$dH dHEhL}HHXyMo(GMo(IG HHHHIH}HLqdIHgAUPAV1LvD$dPT$dH d$L}IG HtHHHt@HIH}HLcIHvAUPAVMo(RMo(IG HtnHHtfHIH},AUZIHuLPLP1豗D$TPT$TZYLl$Dd-Mo(Mo(뜐Lh(xIG HHHHIH}HLcIHgAUAPAV1LD$dPT$dH dL}HEHP HtTHHtLHIH}#HLbIH vAU%PAVMo({Mo(BLh(IG HHHHIH}HL0bIHvAU?PAVIG HtvHHtnHIH}mH=LaIHuAULP1AVD$dPT$dH dL}MMo(OMo(IG HtrHHtjHIH}HL`aIHztAULP1AVeD$dPT$dH dLh(\Mo(fAWHAVAUIATAUSHHH9t!D] A9r M$ A9rEHmH9uHAuHE1E1LiH5bm貔XZqA9_H}GHLM0DE(HuPPETPPEPPELPE8P wHPIH HIEPHHx~DHUuL)ىBA)FPD)E1EPA^$M$M AN tHDHMH@HHIًA)AD;}LrHEHII}PInLpLuRKAąu+L71ɺ1H5kJAHD[]A\A]A^A_HBuPELLL$PHx)p-)LL$IAH:IHDHHHDH@H@@HHHsH9jHBHMMHLgQPATAWE PfDE1H- kLsgHNL1ɺ1HE1.fMPJE1DHRLxx(IHMMHLfDPHHDpHATAWE PH5hj1豑H0HG I]HHt_HHtWHISH-&j1ATHzLeYY^f1IH)LO(H-iLe1HH-iLeHݐH-|iL1ɺH趐cH-UiLv1ɺH菐1AŅu1L1ɺH5[D]A\A]A^fHٸHmL9IA[]DA\A]A^ÐATUHSHHHdH%(H$1pAąH1ULpHL H¢=kXZu/AH$dH+%(HĠD[]A\HH]xIٹ1LaH5럍@A,H\kHcH>fLY`1H5_蜊@IL>a1E1H5n(fLj1H5_HRRME1PL\1H5ڄXZWH"fAUATAUSHdH%(HD$Hu"HD$dH+%(HD[]A\A]HHHtH5τВtHHAH9tL-9f.HH9tHCuHx@HtHKH$HH9sHI@Ht>H1Ht6H9t1LNRL[1PL1E1諃XZL fHt G[tDuuATLgpUHSH_pL9thHCt.Hxu!HL9u[]A\Ð[]A\f.1ff.AWAVAUIATIUHSHHHt/HxXLppHt HՅMtLLՅMMM9#IHt LՅIHt LՅIHt LՅ\IHt LՅqIhHt LՅIHt LՅAWL1ۅuuDA9_LvgH@IHЃ8uHxLՅuԉD$ L\~1ɺvH51oDL$ HD[]A\A]A^A_M?M9AtnIIŘL9uY@HL9tMH{LՅuD$ L}1ɺ}rL}1ɺd1H5ӀE1aAVD$ L}1ɺm'D$ Lq}1ɺkD$ LZ}1ɺoD$ LC}1ɺiD$ L,}1ɺqD$ L}1ɺsfDATUSH dH%(HD$1HtHWXHtHT$dH+%(uYH []A\fHLfH.H5HWXHH,$Ld$tLHHSXHHHSXff.fATHGXuADA\H%HH5HGXwAąuL |1ɺ1H56ff.fATSHHǰHH7dH%(HD$1D$H9tkFLtYHH @HBH fHH9t0H:uHRHRtHKXHH9ufDH6H9uHT$H5HAąt3D$AuHD$dH+%(u8HD[A\HKXLz1ɺ1H5~Zf.ATAFat1Lt*LSa1ɺ1H5}DA\1E1L@^1ɺH5}DA\ff.AWIAVAUATIUSHHt$T$ dH%(HD$81 IHLƴ l$ +l$LaAA))D9l$DL`1҉)9wпI4ًtDDDI4 Ll$щH1 Ly LxLLHz JLc`H57 |LLE1 HD$8dH+%(HHL[]A\A]A^A_úH5‹L IWIO0L9`H5HHH  PD$IG0PDL$1AG8{XZgL0\1H5l0L_1H5H1{Lu_qAUHǰATUSHHdH%(HD$HH9HHt DHLEu'HT$dH+%($H[]A\A]H8uH@H@L`@MtAD$`uAl$PH$tD9+s+@Hu1L^'H5C,z1c1L1A|$@1HcņH$I$AD$PHL9LJH1ɺPL-M1LZLyXLZ$1ɺLLJvry8QI$HtCL9t>LJH1ɺPL^H5M1)y_AXZL ML 觍8I$HtdL9t_LJH1ɿPH-L1L]HxYL^ 1ɺHLpuxL |DAWLG AVLAUATUHSHHHGPH~Hu@H$1H‰ Љ1H9uLƉ 1к  HHsAH;hcLHL5HD$I9.AELE1uAE9}LDH@IHЃ8uH@H{ Hh1HLE fDH‰ Љ1I9uH 1к  HHtH@H9qH$HHE@HHHH9LJHnL1QL2\E1AvZYE9}LMmL;l$HD[]A\A]A^A_HE1HD$H5`L[LMH1Uv^_\fDL 1Lff.AWL=4AVAAUE1ATIU1SHh._}Cըtv:fDAtfH1AATL[LE1AuXZL蹅H9s4?AHHPq:t:DDfDHD[]A\A]A^A_fDHLAATLZ1E1uY^oDAUATUSHHHGH@@`ItfHH{LhL| HLLH跍H{HHThAŅAHD[]A\A]DHLH+I9uHEHI9tHHsL赉uHHCHBHѐ1qE1LL#ZH5tHD[]A\A]@H1MwE1L(ZH5sXZ"DHM1|H5LYsY^AUIATIH5RTUSӺHHtAD$`t4AHD[]A\A]AtBI9X t6ALY1E1H5rvALYDAL,Y1H5E1frHD[]A\A]ALX1E1H58&r=AٺLY11H5q:ff.fATUHSHH6 { L-YtfCLWYtNHEh@`tA[]DA\HSHCHu{HCHt~H=vL7Y1E1H5A/qD[]A\ALm11ɺH5pD[]A\@Ht HvH{HCAoDAUHATIU1HSHHHu-HH H)L9HL1[H]A\A]HIDI),HjL L{ =_IAX1H5%L!X81pHH H)L9hHH{,DjL { H{H,DI$L I{ H{L,DH$L { H5MIXZAUU1LoW=%oY^1H[]A\A]fDAWAVAUATUSHHHt$L;H9IHIID$@IMLI9tfIHCH@`HI~HLЅuHD$HHtMH5n|u8HCHMLHBHII9uD$H[]A\A]A^A_fHHCHBHI<$t=ID$L#HCID$L(Ml$=DD$+D$ f1'SHHC CH;HC@HCXHCPHHHHHHHHHHHHHHHHHHHHHHHǃHǃHǃHǃH H[ATUH/SHH}LHHPHEHI9u5DM$$I9t'ID$HHxHuL[]A\f.E1[]LA\DHHFIH3GpH3WhH uuHVHFH3WxH3H u]HIL9tJH LLV DHL9t0HBHH(Hx L1L1H uH~HNH3x0H3H8H u1ff.fAUATIUHSHHHtHHHtHxAtHD[]A\A]H/L\|HHPHHEI9u ;HI9t0HCHH@HxH脀uMtA$AE1AtDAWAVAUATIUHSHHHHt$dH%(HD$81G~@ATt*HHH9tHPHHbXH9u1H5cAątADA\1L"e1ɺH5N7hDA\ÐATUHSHH0dH%(HD$(1pD$ t`Ht:HLKHALoPD$ H5P1gD$EXZHD$(dH+%(vH0[]A\@HGPHxODH1HHL9tIH@ tLHpIqLH<$Ht$LHpHD$HHH1HT$HL9uH $HHL9tGf.HqIHpHH Hw(LHqHO(HLHHW(LM9uH_ L9E1L-f.H}AHHG H9tLC uHCH@ HtHHЅuͿ1La1ɺ4 LdH}HHG H9uHEEu7HE1HT$dH+%(H []A\A]A^fHHHHDžH9tHPHH!H9uH}@$>HEHHEHHE@E,E,tgHhLhL-L5zL9t4DLKML=W 11cHL9uрe,LpLhH ν$H5cH=d&qxATLUHSHL9u ?HL9t7HCtHHpHHP HDHCHL9uH}H=H}HEHH_ HG H9t_L%fDH}HHG H9t@HCH@(HtHHЅuLs_1ɺs 1Lb[]A\ff.AUATI1UHSHHXdH%(HD$HHGHLhHHPXHt HRHHxhHH{@^HHH>u%HD$HdH+%(HX[]A\A]fDH|HC@HWHHKH9BLjHEHHH-H@DL ,Hxjm 1ɺHI1L,$LpJ#aA$HZHYH9HC@HHHH9LJHD$HdH+%(1ɺHLJ0fDHH4H9+H@H1ɺ PLwIH5u1M$Y`H{@^AXHKHLfH@HH轸tIMtAI 1LHH5_HC@D$f.Ht HHtH9unL HD$HdH+%(L? H5HX1[]A\A]e_DHI@L-9@LJf.L O@I$HHtI$stAILG11 H5^tff.@AVAUATUSLn`IEHh8HIHt5LHLAąHA[D]A\A]A^@LvpMt)H5^LlutL5_M1E1LG&H5][D]A\A]A^1LZ1ɺ,H5ֻ][D]A\A]A^1E1LJGH5]$@ATUSHHHE1uuID[]A\ÐGauL1L}H56A]t@C`u1A LLGH5\}fDL1H5úA\HAW L=AVAUIATL%ULHSHLdH%(H$1D$\>\HD$@HLD$DL|$HI9t_Lt$THCD$TD$XHx@Ht-Ht$XL}tD$TtL$@9QHL9uD$DHL$\IIHL$HL$THL$ HL$XHD$0HL$(H9r@HCHH@@H@HH4H9+LJH1*LQL-< [XHCHZHT$Hx@+KHCHT$ D$THt$(D$XHx@ |t$@t\D$T9tTtPHUuD|$DEHLE1LPDL$P;1nZA]A^f.L{IG@HOHHCH9:LrLmHEHM1ɺ<LHD$LD1Ll$YAXLAY(a IHfH@ @IOpHt&HϺHL$H5'Z(hHL$HMEQLDL1sYY^HCHH@@HHHH9LJHD1LQL:FE1YXZ6L @L5@LPH $IG`H;At|HMp(LNDU*@HCH@@Ht;HHt3H9t.LJLB1ɺ71L濄mXL I=*t$IG@HtHx8HZ LLLL$8.hH|$HPHHT$_ HHT$Ht$8HpHLIGpoMhAOxoUxAIAH$ALJHxHGPUH}1LH@HH|$HHH9HDHH9<HrH9F@uLl$`@LL软HMAULKCtfDML>DL1@VWMLBL1OV'L\S1ɺL1LsVfDI@H\C2HMLB\MvLL1BVf.H|$HfH H9t8HqHHFI3I3GH uHVHFI3WI3GH H H9uȋt ;H|$LvAHH9M}LHhAH$H@HHXHHfHPHHI9H9uHH;\$0HA,Ht$0H H$dH+%(HĸD[]A\A]A^A_AHCH@@HHHH9LJ/L1L5[T{fDIGpML1bLZA%TLP1ɺ 1LE1T 1ɺ~LLPSD$`L I@L t@HD$@L9HLE1PDL$P=1L(>nSAZA[D$DHMLjL?P1(SH HVHPH1ɺLLOR~PMLd?MH9hff.HATUHS>toIHHtRgtW$LHHt7HX Hu',fuH{?t HgtH[Htu[1]A\[]A\fDfH9wAVAUATIUSHHtI$M$L9t9LmI}hH9tHtHt HGH@PhI]hHmL9uI$8M$8L9t;fLmI}hH9tHtHt HGH@PhI]hHmL9uI|$Ht HGH@PhI\$[]A\A]A^AVfHAUIATUHH(dH%(HD$1)$Ht$HH=%2HD$$,'IHHxhWID$`I}hHIDŽ$ADŽ$ HGIDŽ$AD$PADŽ$LP`HH[L;I|$HGH@H@PHt LЅt,HD$dH+%(H(L]A\A]A^fL5I'L=LOHt+}#t%LOMtAD$,fHLQtLE1)P@1ɺ.LL5L]OL5^IL<L0O[L5.1ɺ1LKLO/L5L<1 LN@I|$@AD$,D1ɺ.LLmKNcff.AUATUSHLg@ML%AHHӹL]1J<#H)DHuK tFL>^LDhD H}@LD L MtMd$HL[]A\A]H-1ɺ1HLJE1MH11L~JMHL[]A\A]fDLTJ1ɺ1H5~gMqfATUHSHHU IHthooKHoS P o[0X0HC@ID$@HCH@8HtHsHtHID$Ht@Md$M$$L[]A\L:1EH5˪LfLHE1rf AUATUSHHLoG C HCE1HPHHt LIHCHP@HNHtLATL -PH}-LP: LDH51LXZH[]A\A]utmAWAVAUAATUHSHLGIH Ip H9gH1fP HH9u1H9tDH H9uI@0Ip0H9t1fDHH9uAEuHD[]A\A]A^A_fDLAUAԹ LA)L9H5%P1RWKHEH}DH DHGvIHHuL~0HN0HILI9A!@HEH HIHP0H9HAG tADDDA# t1LHT$HuI?AIOHT$HLN HOH9H~ HN(MIOHN(HH^(AeAfDHX H H9t[AHHF H9tDC tADDDA#t1HAtHuHHF H9uH1E E1L(8H5vdIXZH}L&c 1LF1ɺ1H5?E1%I ff.HtgSHGPHHx@HHt HHt[@H(HL7SI1H5æHXHZ[D1ff.fATUHHtPH5HA]t+H5ЅH]tH5HE1]AHD]A\ÐE1HD]A\fAWAAVIAUATUSHHdH%(H$1HXfA~PHD$ )D$@)D$P)D$`AFf  A HD$`HIIH9tlL%@LetHH9tKLkMtA}uHL17L1AUE1M$GH_AXH9uIIHD$H9`H$D$HD$D$D$A9LkIL9tLH\PHtHH1RME1H5L6tFLkY^II}p[H|$`LIu 1H‰ Љ1H9uL 1к  HHHxtHt$@L聞 HCIH@@HIHH=H94HBQ L[6E1PLL$ 1H5zELkXZMII9u)@Hbt$LkM$$II9tpIl$Ht}uIE@HtGHHt?H9t:LJH1 UL5H5DA_E1XDL qH|$`L L  HH;\$L IIH9tZL% HH9tHHC@^@uHLHHL) 1E1AL5,DHA[A]H9uIIHD$H9HD$ D$L%D$<HD$4HD$(D$ D$8Lt$fLkD$ H@IEXHH HMuHLSHD$(HIMPIUIEH3QhH3ApH uIUIEH3QxH3H L$@LLśHCLl$p@LHxPHh蟛HCHLL5P LHHH@PAU1AWE1BLkH AE]tyD$D$v2HMMHLPLe5W 1E1qBLkY^HD$L9Xt+MMHL5L1\ E16BLk1LhrLkA}`MuHLRMMII9u-=DHh_t&LkM6II9InHt}uHMMHu 1UL5LE1AXZfDHan@IE@HtHHtwH9trLJ 1E1L1H5>'ALkfD1E1ML1H5@DL mL=1ɺ H5Þ@@LD$4HH;\$D$8Lt$D$4D$<;D$ EyH|$PHt" H|$@Ht H|$XHt H|$HHt H|$`Ht H|$hHt׺ H$dH+%(HD[]A\A]A^A_HCHt @\D$8#fDML3L1o E1?LkHCLE1L2c LHH1U?LkA}`5MMHL2L1i E1?LkfDHMMHLHD$ L06 E11>LkAYH AZIEXH.MMHL0L1< E1>LkPL0LAVHD$(E1C L1V>_LkAXf.1ɺO LL:%>)1ɺL LL:>2D$<U|$ Ϸ HD$@H6|$ 踷 HD$PHIH;\$Lt$H$LkMeHLMLDpD H|$@DL' HHtGHxt@HM HD$L2H5<1"=LkA_E1XMe H|$PIu@1LfDH‰ Љ1H9uL 1к  HHtcHxt\@HLGHD$IE1L1 HCH5zpH1c 1LH5aKHHLEL1H}A[L[z/ Lv1ɺ,1LHzHLL,$E/ LH o$H5H= #E1L1ɺ1L&wܡ w*AWAVAUATUSHHHH|$HdH%(HD$x1HD$PHD$HD$PHD$X脭HHhL`I9twLl$fLuH]M>L9u NfDIǾ*HT$PHt!LpH HT$XL(HPHHD$XIML9uHmL9uHl$PH;l$*D$?L5{fHmH;l$L}I0tA<uIGH@xHvLHhIOpX1ҸL%[sD$LHL$ I $H H1HHHH$H9HD$lHl$0HD$>HD$L|$(IUIM IE(LHT$HAHAEHL$xIwLD$lIEHD$p菬 tA/IEIU HxHHHHIM HHPIM(HHPHHPPH9$HI$HSIHt׋@0uiE}4E|DL AE0t IELH@ HPAE0uEU8EugIUj<IELH@ HPAE0uyfHAuEM1L;-H51A[A]H9$$D$> |$>L|$(Hl$0HD$Ht$ HL$L1HxhiIH1DL$LEDH8AG8A9H1ɺPLNH5|o1h_AXH\$LH{$+ |$?,AH|$PHl$HH9t@HGHCH !HHH9uHD$xdH+%(HĈD[]A\A]A^A_@ML$(IG0I9tXH1ɺPH5nL1Y^8DLA1ɺ1H5nw D$?LY1ɺ1H5^nG|$?AG8HMO01ɺLjE1PH5n1 XZ|$?tL1ɺ 1H5mAL|$(L1ɺ1H5m_IٹL7H5EL1ɺ1H5rm[H i$H5H=$fAWAVAUATUSHHHIHDIHLExIHHtI9tH[]A\A]A^A_fDLL%^RHL1DH)J|%Hڂ t[LLI}@LPQ HCHHBHH[]A\A]A^A_H[]A\A]A^A_@H-6l1ɺ1L H 1L 1ɺ2H 1 AWAVAUATUSHL>Ht$L9III14ALL1LmALLHLvM?L;|$tLI|$LHHu1L1 1ɺH5]kF H1[]A\A]A^A_DH[]A\A]A^A_ff.AWIH1AVAUATUSHxMphdH%(HD$h1Ld$Ld$Ld$莥H$HJ MnXIIHHH9uH~fH0HHHNH1H|$6 HL$L HHHD$HHT$H HHH9t;HLxAuIhHtHGH@PhH HHIGhH9uH\$IIADžIDžHL9Lt$ILfDHHCHBHIlIL{L3MeHCIhIHAIMI9MtA$LHtHGH@PhHCMghH\$AAH9t HULLt$H$HXHH$H9_LIHfDHxHH1HH)HIIIIIIIFH@HzM!I$HL9HrLLЅH}L蛝D$`AoHT$@Hs )L$@AoW)T$PH}BLeIhI9tMtA$Ht HGH@PhMghH}( HpfH@ @HLxHLeL(IhHPHHHII9tMtA$Ht HGH@PhMgh{xv C|sHH;$H}Lch IH0L 1H5g L-1 H5fL1ɺ 1H5fHH;$lfIHD$hdH+%(mHxL[]A\A]A^A_1H5g5LLЅI$Ht L9L >5L 1 H5Af*tDHCXHH@fH5IHChIG@HC`IG`HCpAAGHShH IIwpoAoAg^HS Hs H9H1HH9uHK0LC0I9t#H1f.H6I9ulH9t!HHH9uHFH IL9DHH I9uHPH@LH}H IHH I L1ɺ H5dIhHtHGH@PhIGhH}LY @L$H-vd1L HIIhHtHGH@PhIGhL1ɺ 1H5E1 L11 H:IG@HtHHt H9L 21L1ɺ H5cIG@HtHHt H94L m2L1ɺ 1H5sc\HChHHHH9LJL?1{ H5yL1ɺ 1H5b/HChHHHH9HAE1H9tfHAH9uH PLf1H5{XZn@1H5W1LLЅfLJLJxL 1@H 1Z@n L 0LH5ZfHChHtWHHtOH9tJHBE1H AH9uH PL fLH9Hi01ɺ E1L4H5gaUH ]$H5H= AWAVAUATUSHHL$DH$H<$Ht$DD$hLL$XHL$`dH%(H$1AHtHL|$MttH5"L u\1M>LH5`zH$dH+%(p)Ht$H<$HĘ[]A\A]A^A_4@H|$D$DH|$HD$D@H`HD$0D|$DH$HHDŽ$/ AHhh1L(D|$tSLL$Ht$@XZEfƄ$0L$)$L)$ o#Lt$P)$ok)$ jLD`Dz H=ODL HHt'H@HtuHt$H<$HtWL$lH hHL"PL|$1Ht$@MAYAZ1H<$HL1HD$H$HH$DŽ$H$HEP`HD$ HHL$ Lq Hq Ht$PIL91L$Ll$E1Hl$8Hl$0Ld$MD$H!H@RML) PH1XID$LZLLL$Ht$ H<$L$IHM@(EO(D9I$IH{L9rHrH|$8HPHHDH9;HRQL1ɿVHP1R&H LM'Lt$8HDŽ$D$HHIH;\$HID$H@xH`LIHOHIT$(DŽ$Ht L9H+f.%PHt$H<$҃rKLL$LUH5Z\CfDHt$XE1H$dH+%($%HĘL[]A\A]A^A_H hHIJL8PL|$1Ht$@MA[A\H<$HLDD$EIHoL9fH@HML1P1HIVHHDŽ$AZA[H;\$KDL$HEtDH\$0LL$11LHL11H޿M IMLd$L9t Hl$ @HSLH9HI9uHD$ fH$Ht$p(IG`)$)$Ƅ$I$8H$@I$HH$PI$XƄ$H$XIGhH$)$)$$h$xAoOhHD$H)$AoGx$)$$(}IHIl$ID$IHD$8LmIH9>HLLd$HUhI9tHHHH;Q@HI9uꋋIHHHH9}LHH 1QLv1VH5uWH PFHH H{ HC  HEHC(HEHC(L0ILs(IEMLL9l$8IIH|$8HH7HH9HvHttL9toHRQL1ɿVHAQA1R6H L:D$HHDŽ$H&@H5&@H&H5&k@Lt$8ILL &{@LI1ɺ H5@MLn1H1XUHL%H$H;\$uqfHCHjH@@HtHHH9HRMR@LU 1LA^XHH9\$>HCHo)UoX)]HCHp@^IHeH@hHHHH<H93HBHM LPLd1@C_I?LAXHT$PIEMuL9C@ uHI91@ tIEhHHHH9HBHM1LP0 1L%XIEh IZLHIEhHEHH9H90HBH@2 MLP\fH)$@H$K@H $@IEhHHHH9HBH@L" MP1LY^ML1H5@HD$ L` I$L;d$ID$Lt$HH-H@xHfLIILHHP H H9u lHH9tcL9jhuMIEHtxL9tsH@HM LPHt$@1 I$ID$HBHA\A]HIH;\$t0HID$H@xHCE1CHq"IHHtI ~IHt 贬uiILd$L9tXLl$0H{HEu3Hp@Ht*HZHtxx @|n DHmI9u1I?1ҾHLcMMMI$M9LMI@HII9HIT$HzHG`H9|HH)I9sD EtA蜠tYID$Ht$0L?1ɺ+H@LHH1f.L1ɺ1H5ID$HMLp'H@pHH\$@1H_1AXH޿1LhML9l$11Lt$PL%l$ LLl$0\$H\$lf.HH9vHAAVIL1P1LHEHAYAZHmH;l$H}@L}KuƄ$HUHB@HptDHETHH9HAAVL1PIٺL1kD$ Hm_AXH;l$f\$l$ ݉l$t L臉LO IMI9uHL9H{11"uHCLXLHHHt$01 HD$XH|$`HD$8#tH<$AG,Ht$H<$p LE1m*IHHIHT$8HT$8tkH$u^HBHLIٺLXHID1P1AVY^D$ @H>@H@H$uHBHHPIL1AV1L{XZLAx HRDH1R@H!HD$ D$H|$ HGH@PhHt$01ɺL1HD$8#t*H<$:uHt$0L1ɺHt$H<$ t D$DK NH|$H9HnLhLxM9MehI$Et$TI9H=+HtHxH?/AD$`AT$XAu ! RIL{AV1ɺ)H5y1_AX@L%21ɺl1LLHIT$8L#AVAD$XIPHIH A% к!PH51KH rfHIT$8LAVAD$XIPHIH A% кPĀAD$XA @1A… IcD$X;\nlHOnDT$DA|$TLDT$I$AT$XET$TAL$`I9 H LHHL11ARH5AVRZ(H MmM9~D;EH|$HH JHL$0HH JHL$0L1ɺ}1H5JLL$DLc1H5Jx6IL9uDHL9H{~uHCLLHHHHIGHHt,HRMPHt$@1LXZIG@Ht-HMTPHt$@1LA^XHD$`L8E1gHt$0L\1ɺ\x H$HHx蓆HD$HBH<$1E H KIHL$0Iٹ]LHt$01 Ht$H<$$HHHHD$0HHD$8#tH<$)Ht$H<$ F D$DLL$sLLeeH$XH$H$rH<$L9l^ IG` H $ 7Ht$0L11HEIH@@HtHHt H9tLJL HLGQ1L1AZA[HEIH@@HHH H9LJHIغNQ1L|$LHLD`Db H=7LDl H5 GHHt$0HH@HHt$0ML HILY1AVI@AG,KIHHΟN H$ Ht$0L11 FHD$HƄ$Ht$o0)$)t$ op)$IH;D$t%HHHQ@HtuJ`HH9uH\$pHHD`Da H=5DHމ1k HH HHHHH9uHH9HPB`uH=l IH IHD$8L9iLt$L|$ HD$8LhIm HHDxDO` H=4DH{j HHHXHH+H9E1S L$ c IH L9Hp1L 5AHmH9L}AGauEtH51LJ uHt$0L1ɺ2 Lt$L|$ LG Ht$011L gIH<$vLRH4$HH2 "  Ht$0L611KL /E1LDT$H5 AD$XDT$I$H(I9LJARL-wLLKDT$P1Y^|$pC8I$I9jHaLJPH-LPL1ɺN1\^_DH59HmH9l$p&Ll$PEtuH5LG ! ID$IT$0LHHHID$0AD$82^Sa 1$Ht$@IL1XZHD$8HHD$8H;D$Lt$L|$ L +D$AD$DPt$H$uDT$EDL$lEH$ IGDh1>E1H(D[]A\A]A^A_fHh/tDE=ED$D$uVL3LL9uM6I9HEPIVLHx`u܉D$LQ16H5脿DL$?f.L1ɺ)1H5MOA @M(1LS9HL:IBLs5tST$jE1jHE1H"ZLYJeHLAHuLH3LHLHD$H9HD$LLpM<$M9ufIMM9tuIIt$LuI $ID$HAHH}P6tH}PWL1ɺ=1H5нE1HD$HHD$H9JAdLUH{HD$H1sHLHD$H9tpHD$LLhM>M9u=fDIMM9t,IIvLuIFI6MHFH0IM9uHD$HHD$H9uD$tH蟨+H}PtH}PVHt$LE1y藼E1TL1.H5ikE1(LOH?HHD$17HsLH1D$iLHt$1DL$D$L11?H5ǻDL$H}P脱E1qD$sLH5\L,IHfHD$H1^fATUHLMt.HLJHL6HLId$Xt HL]A\1ɺE1LH5޺ff.ATHE11UHHdH%(HD$1HGPHL$H8Yt-E1|$AHD$dH+%(uBHD]A\HA4LA=IH5616ff.@AWAVLAUATE1UHSHHLHt$$HL$dH%(H$81HGPM9MDHHD$GYz<$`LH3H1ɺdP\$1H5lLAiLY^HL$M9MDHEgLAIcHl$LIL4@I#DLu?IAxZHJ|0HGXtĀt@tLtDHIAyDHl$t\L8oH51胸E1H$8dH+%(tHHD[]A\A]A^A_@Hl$HD$ E1E1HD$L=HD$(HD$ HLI^IEPHxֿ H%H|$ HXHT$(HL$AHPHT$(HHHD$(D9$$ELH1HELHH@H‹UPHXHcXͯ}H11MIH5]1]MAƅHuI}fAƅHEI}H@XffDIEIHAH!PXLIHpX4IDžI}IUHHB HtHHtLI DLJ(H1SLܩE1H5XZDL裒 HH4fI}LpI@I}`xHHH9t1H H9uHHHH9q1HH9uW@I]`H=HHs;i5LHHsLdž1ɺL%1L׉I}LoLI1諉LHp Ll1ɺ1L胉LO1ɺ41LE1cfDHHH*H9ukD8LpLLw4AƅIEHtH@PLHHxpAƅ)MuHMHIH9pHIFPLbHxIHu腐 Hf1LpIaL1H5SoL;1ɺRH5r1E1KL%WL 1ɺL$L1ɺD1H5 \Lń1ɺ71H5؇6L%1ɺ1LL謇I}LLI1耇1LLG1cI}LLI17L1ɺ@1H53o@IFL̃1ɺL%1L܆I}#LLI1谆LHu Ll1ɺL\1ɺY1H5oIvX$AIDžIEXIE`L 1ɺe1H5?{L1ɺ=1H5UH赍 HHfLH0HXH,L%1ɺ1LpL萅I}L(LI1dIEXHǀLi1H5,L1ɺ,L1ɺU1H5VL%L1ɺLфL1ɺi1H5諄 L1H5f肄LN1ɺbL;1ɺo ATUSLGIIH9HE1HPHzG^uMu=IHH9uMHI#@XtID$H@Ht_L[]A\fI|$HH{IUATIL1E1H5腃XLZ[]A\LI|$HLIH|PSLE1LIH5916AWAVAUATUSHHGPL0HGXIH%H-D$ @hHHE1E1H9uf.HH9thD[LEtH:uHBIL$H@HP@cH5藯 L$IMtMHMH9uMGDl$ I w M90HAE M A,I~j蘍 AI~LM A,HE$^ AYLAZIHI~LAEHM A,j H$LAUIUH5G1(H H[]A\A]A^A_D$ ;H54 L$IIIH9 @TL9sHAELM A,I~jK _LAXHIIH9žHAEM A,pTI~j H5;IXZUAU1LIY^H9AD`TL(LԠIH51H[]A\A]A^A_DLIL1LIIIHuH1HIILIH5X141ff.fAWIMAVAH1DAUJDATHUSLHMHLl$@HI9IMH,HHDjL Z LIXZHH}H3jI,DL  Y^ATAWI6=LH5F11"~L_AYLDHN AAE\HD[]A\A]A^A_f.HD11HHII9sMqAMH,LHDjL A H}$,DIL H3 = L<$I1ɺJ1L˟H54}XZDL#MDE}EtH,HHDjL 胈 H}$,DIL H3K =LLI1ɺ<H5|1L<$Y|AZA[@H,LHDjL ܇ H3$,DIL H}複 ^_LH'ATL!SICH51{AXE1AYLlx1ɺRH5{E1}fAVAUATUHLXdH%(H$1ID$XH(TH(HIHLJXID$XLIt$H1L﹀H_L׎H1LHLLAU=vAVL5IL;1ɺ1LzH}XLZ1L_Aą111HVA=fDD$LLJIH581E1zH$dH+%(HĘD]A\A]A^L(|LIfLH5SHHLE1云H5{yefDLAUATUSHHdH%(H$x1H$HHHHH;$<HDH5\H$XDŽ$HDŽ$DŽ$DŽ$Ƅ$DŽ$H$hHDŽ$pDŽ$DŽ$H$XH$`rH$0HL1ɺ1L-RL#L&xHH諣IHH+H.HHY I\$PHXHtI9H_oIL$HI澀1HL9u ML$HH11iAVLLFywH;X1ZLLWLIl$X(LXH$xdH+%($HĀL[]A\A]A^LE1L1vDdL1LZvLs1ɺ1LE1vb1ɺkLLesvILQs11H5dv1ɺ`LLs=vhLr1ɺ1LvifAWAAVI1AUATIUSHLXHHHHH9IHJLH#qXt9v ΉH9sHH9uEMtRLH-pL HI10uI<$1ɺLAąrfAHD[]A\A]A^A_EH9GM^IEXMI%I9MD$Ht LlHE11UL=LLjtA^_9I|$>AD$L1E\$8)E$It$jAAU`RAVUDL觱H AąLp1ɺ$1LsfDL1ɺ1H5sf.Llp1ɺ1HstfDL-1ɺ1LALΘQsLLH+Lp1LE1sHtD$E1bEHE11ULH5ArXZff.HHw@ H1Ht)HVHH9tJ HH9uHU1SHHo`Ht+HHpHtH5r詀tH[]fEatHs@H Ht @|H[]HS@HtLe[1ɺ{H5Yz^/HLYlIH5,1F^L [1ɺH5Hl$^LZ1ɺr1H5~]LZ1ɺxH5~]LZ1ɺ1H5~Hl$]8LoZ1ɺH5c~]LKZ1ɺ~H5?~`]r LZ1ɺ1H5~Hl$+]fDH t5H1L~H5`\1HfDHGHWHHHt H9tHz t.HtH9tHy t8f.GBHHBHQH H@QH1WHQHVH2ff.AUATUSHHH9 HE1L-fLS MI:I9tsHsLHfI9tKLfDHH9t8Hx uPO9ADCPO9HGщD)DA9DFH9uH?I9uHH9lHD[]A\A]HCH@@HtH5xMMHD[]A\A]fDH]H9u'fH{9AąHH9H{MeLH Aąu1L[J1ɺIH5LpMHD[]A\A]f1L*J1ɺDH5L?MHD[]A\A]ÐI}LAątGHA[D]A\A]@1LI1ɺKH5kLLHD[]A\A]HEIE1H9tfDHAH9uH1RLxPH5 LLXZ@AVHAUATUSHH9jHE@O}L HGPHI0HxS IHHHxI~HHHx&AŅOHI<$ID$M&IFID$L0HMt$HxHwX"HI<$HpIFIv(`IT$MfHIV IT$HID$"AŅ HAH!CX[D]A\A]A^DLwH5J1E1K[D]A\A]A^DHP HtGHHt?HI1E1L!wH5DJJ[D]A\A]A^@LH(f.1LjG1ɺH5JJ[D]A\A]A^L{}3f.LG1ɺ1H5I/J DAWHǰAVAUATUSHL/I9hAEL1E1IH@IHH؃8L`MLHt$ID$XHt$HHIHtL ID$XIHDL xXID$XHtL!ID$XAA9mLSEtAEHH[]A\A]A^A_f1LE1ɺH5sHHH1[]A\A]A^A_ff.AWAAVAUATIUSHH_Pt$ H$gHI9t AeD$ L%HHL%GH1LIHLgP1GHYH^mEH;H D$D|$EHD$H$HL(L9L=tfMmL;,$HI}IH1LAVI1MGIuH;A[A^uHI}IHLtAVIL1KGAYAZD$Zf.HxLL%FIfHLNAVI1LFXZH3H1ɺIHHLPL1FXHZH;HD$ D$D|$EhHLILA1UFHHL1IL1%FDD$ H;HEtU tUD$H[]A\A]A^A_fLB1ɺ1LED$f+uHLLI1ED$s1ɺLL5B]E AWLrAVAUATUSH(DwLE HGHAH@t@ uG1LA1ɺ H5dDDH(1[]A\A]A^A_ t tD11DEILAHH@H@PHxOL HPL1HPIAD9ELDDfI A9w1҉AAB*MLA9wͅD1@A9I49tHHRH<HLH9Ao oHJ MZLZHIJAH IH HooHzLQH|$LRHy)$HI: >ML9aEt AɅ:H([]A\A]A^A_L1vD1H5BB1H([]A\A]A^A_H}3HUHHB HaHHUHIH1SH5BLpBY1^둋UL1tƒA9ELwD9ADE1E1E1tmfLDD΃A4A9t/H4RItF[uA9uىA4A9uD9tAAAE9v fHQ&LePHT$ HLu^HPI|$HhHeH IH9@VtlD$ A$@t]D+fAD,N@D$ A$L SLnHAH5?LD1E1@ZYH$dH+%(HĸL[]A\A]fDHD$ I|$HI$HTITLH)H)ÍLHHfIٹLmH5>1E1v?kH踹LmIfL}r1H5>,?!D$ A$D+AD,cTAWIAVAUAATUHSLHdH%(H$HI9+HI9t\1E1LNmH5 >>H$dH+%(HĘL[]A\A]A^A_fLZHIH1HqL; IOPHLHq- IHHt@IGPH5X_H8OIHHLE1SDH ZYtpL舸IwHWLp;@LE1ŷLalIH5<1N=fME1LylH5<=L91ɺ1H5s<E1Mt I~A H([]A\A]A^A_@}LwoIEPH8D$HEH@RfA1uLD$f.Mt I~rA L61ɺj1H5u99H(1[]A\A]A^A_ùLl2H5=99H(1[]A\A]A^A_DMt I~@ Lf61ɺsf.AU`AV11jI}PRLSPD$DPDD$HEEH01ɺ[IL6H6D$fH@|$|H S$H5z9H=9Fff.AWAVAUEATAMuUSLMHL1H1HHH!H LIIĉ1IH1HHH!H LIAt!EtE1D9tED)A)A9DBHD[]A\A]A^A_DI`1LLH1HHH!H LII1^f.tRHwtFu> tɾDΉHҹDщ1HDHH9кGHG uaE1F uP@t AFu=t AF@u*HHv(H(EE1AHDD@E1F t t@tHLHI9LD9A@LAp(tWIH@HrH| f.HHt8HHAP(H9tP(H1H9uHH9uʸHL3,1H55161HL21ɺ&f.AWAVLAUATUSHXLHT$HL$dH%(HD$HHHD$M9oTAo8L21ɺHGPI󋀰D$(Aą6Ht$@L虇AąX9C1t$(EAG(Aхu9vH|$@dHD$@A)SAGHz'H\$Ht 1H|$@IEPIAG(AGHI9iSKL1tmfDHH@HHxHHH1H9tD1ɅuK(P P$H(HH9uc;kLrA0L蘮LcIH531!4HD$HdH+%(HXD[]A\A]A^A_L01ɺFDH5[31E13IAWLH|$ GHG)EDAG8LT$(DL$0D$,`\EGLT$(D$8ADL$0IGH@IEPH5>DL$0DD$(H8PEDD$(DL$0HIGAG81LDL$Hx/RL?,1ɺ 1H5.R/,L,1ɺ41H5.,/L+1ɺ-,L+1ɺJ1H5w..IDfAWLAVAUATUSHLdH%(HD$1M9eMIFAN(HHEfLHP@A)DE7 tD1AAąHT$1ɾH2AŅT$1AFHHI9L@PDHA-%AŅHI9L@P1HAAŅsHH#CXHtT$UfH-D$HCXHtT$U@1HAŅL)1ɺ1H5n,,TDL)1ɺ1H5C,,)f.L|)1ɺ1H5,,f.LL)1ɺ1H5+E1\,L)1ɺ1H5+/,ADAWAVIAUATUSHdH%(HD$1HGPDXH8EulLA_gH->+1H+1L(1ɺH+1HT$dH+%(HH[]A\A]A^A_HHIjE1E11j1Lj2 LL~tL4$L:Pt%LDHЃ8AuAEHPL9uD91ɺJLL5']*|L]lo?DUHSHHH9HAHSIȋBHBtX)A)#EK(AH)DH1HHHH AH[]f9vT)H- )A9wLZ&1ɺ1Hq)H1L8&1ɺT)H1[]H-(11ɺL&HDL$ )HCH@uDL$ D;HwsKL'YIH5Z(1(H1[]H-;(Kff.AVAAUATUSHHLdH%(HD$1HHL$I9ĸLD4|AT$(D$AHAD$$H)HSPHHA9s/AtiHD$dH+%(upHD[]A\A]A^fuAD$8AL$11 H5@''f.AD$8uAD$8@<@LHǰI9\FEALEtmK @I1E1H@HTHt>HRXu2u*IHt"HTHtHRXt AHH9uDtff.S9A)K @PLHH)L@FL)IH@HHHL HH4LLNLPLVLHHtH LHpLBL@HrHAL9u[DAIH)K@HHHRL)HLRI@HNHH4LLNLRLVLJHtHLHrLALBHqHH9u[UHSHHHH9DHWHB HtHHt H@HZ(HğHL$YSI1H5$H%H1[]ff.@UHSHHHH9DHWHB HtHHtHHZ(H4HLXSI1H5<$$H1[]ff.@DEAWIAVAUATUSHHGXH HHHLLL%#M9tkDAFL1ۅtTfDIH@Hƒ8t/LR1ɺvLILvX1#EA;^LrM6M9uH[]A\A]A^A_fDHHH9BL[AC sLAEt[L11fD1HRHITt@HtHRXutBt[A9uDUKDHtHRXu1uHHDHtH@XutLLV1ɺAIH5*"1"A{;CLtrASe9]LÜHSIHB HtdHHt\HHSDJAT1ɺSPH5!LV1*"YA^LeL6V1ɺLIHHB(fAWAVIAUATIUHSH(HdH%(HD$1HIH9øLl$L,$HDHjHC@t{LtZHE1ϛL[V IH5 1X!HD$dH+%(lH(D[]A\A]A^A_fHEPHuHHxOL1ɺ IHHEP1D}`DH8HSj1jH}PAE1AW1ATPP&-H01ɺ HLtHtOH1HLIIH{Ht' AfD' L'1ɺ H51E17 fHGPLHMHHxwADžrHTLT IH5c135ATUHSHHH9>HGH9Ft|$ HtH^(HP HtHHtIL`(H贙SATILTL%1L7XHZM t [1]A\fL1ɺL[1]A\fDH@ Ht7HHt/HH*HLTSIo@H^(fE1E111HD$ D$D$@ATUHSBt L%tLb(HHH9`=HWHB HtHHtHHZ(HtATL%SI1LSLXHZ t [1]A\fL1ɺL[1]A\ff.Ht$ Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$pHt$`Ht$PHt$@Ht$0Ht$ Ht$Ht$Ht$Ht$Ht$Ht$Ht$HHDL$DD$LT$ H9$;HLDD$ALT$l0ff.HHDL$DD$LT$ H9:HLDD$ALT$0ff.HHDL$DD$LT$ H9:HLDD$ALT$/ff.HHDL$DD$LT$ H9O:HLDD$ALT${/ff.HHDL$DD$LT$ H9:HLDD$ALT$+/ff.HHDL$DD$LT$ H99HLDD$ALT$.ff.HHDL$DD$LT$ H9z9HLDD$ALT$.ff.HHDL$DD$LT$ H939HLDD$ALT$;.ff.HHDL$DD$LT$ H98HLDD$ALT$-ff.HHDL$DD$LT$ H98HLDD$ALT$-ff.HHDL$DD$LT$ H9^8HLDD$ALT$K-ff.ATt$A蛚 tDA\ÐALi11ɺ_H5|DA\fDATt$AK tDA\ÐAL11ɺH5,DA\fDHHLL$ H97PLE1-"ff.fHHLL$ H9J7PLE1!ff.fHHDD$LL$ H97PL!ff.HHLL$ H96PLE1m!ff.fHHLL$ H96PLE1-!ff.fHHLL$ H9n6PLE1 ff.fHHDD$LL$ H926PL ff.HHLL$ H96PLE1m ff.fHHLL$ H95AL1E1& fDHHLL$ H95AL1E1fDHHLL$ H9[5AL1E1fDL$C AWAVLvAUN,ATUSHHHH$Jl(HHL$HNd(SLIHHI=AV1LJAWIL=P1LA HuX"HIt$X!XZ苏L胏HHxtHLiu51LO1ɺN Lh1H[]A\A]A^A_HHB(HH\LHB(HEHHtBHLID$HHtPH$L HD$H(H[]A\A]A^A_D1ɺT LL1HfD1ɺW LLe1 fDAWAVAUATUHSHH_XLoPLHLk#I}LpL  IHLHL!,H51hL"%HLL+IHHpI}1Hd)AąMvIIH92AL8H@HE1H @HH9tH9luHL|HH9uMMeLFHL談 AąMeH$HL艇 HAąVIFX1L%H EXH"HEX薦AąLA-HH"=`$HI1S1LHH5XZ2 LGIH51E1iHD[]A\A]A^A_L1ɺ 1H5E1,f.Hh LgGIfL 1ɺ1H5cqf.H L?GI0LL|GIH51y @LE1赊HH誊HH5SILF 1.Y^kLFIH5z1L 1ɺ"1H5KYfAUATIUSHHH?HtH;uAHD[]A\A]@HLAŅH[Ht LLI<$AŅuHI$E1H9t@HAH9uHL ;Rf>@AHI$E1H9tfHAH9uHL:RR1H5XZDH[]A\A]LT 1ɺ[1H5 gfL, 1ɺa1H5 E1<AWIAVAUATLUHSHLt$ dH%(HD$x1M9LDHIAULALH Aą^IDžAIGPHHHH9u aH@H9tWLH#PtIED$ AHD$xdH+%(HĈD[]A\A]A^A_ALE1/H5&b IE1L H5Y 1E1 sHLAąt9HD$xdH+%(IPHĈH[]A\A]A^A_LD 1ɺ1H5 W fHD$PHHD$HD$XHD$P脆 L`C,IH5 1 MM9+AFLLd$`Ld$hH@Ld$`HIGPHHT$Hx HD$ HH$HT$1 AFLH4@IGPHHxc HANLtNIH IH4HH H|$`HHL HL$hHHHHHD$hHH9uHD$`L91@HL9uIGPL4RIHxL HD$(HL1H:HD$`L95D$Ld$8Hl$HHl$Ll$@II}<H5 ILA1 } IGP1Ht$(I}HH9ËD$HEH@L$ID$HHD$0S7D$H|$P`HD$XI,$ID$HD$XL Ld$XLd$PI9uPM$$I9CI|$H膺uL1ɺTH5B  L LWAIH5 1 L܃L(A/IH51e L11ɺlfL1ɺ1H5/ L1ɺ91H5 ALt$PI9uDM6I9I~HxuL1ɺGH54MmL;l$8Ll$@Hl$HHt%HH9tHHPHH!H9uL赂 H5IL@15>H|$HD$ LIc L7@?IH5r1Ht$Lߊ A4LL@BIH5(18LL?8IH51nL51ɺ61H5HI}Ht$0HBI}qL>JIH514L1ɺ1H5S6腓 H a$H55H=FfATHUHH(dH%(HD$H|$@Ld$XHD$H$7tSH}Pj91LHHT$dH+%(H(]A\H-L1ɺ$H1L1ɺ:H1DH-;L1ɺ'HH-fDAUHATUHH dH%(HD$1|$@ILl$XLd$L$$#tOH}PV8LLHHT$dH+%(H ]A\A]H-sL1ɺ$H1L1ɺqH1DH-+L}1ɺ'HH-fDAWAVAUATUSH8HdH%(HD$(1HH9L$HEHIHD$H@H $@uu H<$tuVL1ɺy1H5dE1HD$(dH+%(H8D[]A\A]A^A_HtH\$LL-H\$H\$}LV< LI1jULE1HHH菗 AąHDžHE@t6IGPHHHˆH9uXH@H9K@tHE1L菗AąIGP@atjLt$I9u^fDM6I9tPIGPIvH8ЌAąuLu1ɺ1LH<$oL|Li; LI1ELt$I9ufDM6I9IGPI~L HLiw AąuL1ɺ1LL1ɺ1LfDA1E1L9:/H5VLW11HELfL,1ɺ1LCafD L1Lj:H[AąH$LE1HHD$HE1{L: LI1L|$I9u bfM?I9tXI{IWD1IHAAąuLE1ɺ1L\zAhDL1L9 >vfDAWAVAAUATUHSHH(dH%(HD$1Ht HLpLHH$IHD$AI9ǸLDHHaHDHCPLHHxL IEHH<IA1H 2H L AAGLL$$1uAfIHt!Ht$Nl(H蠽IEHHA9oLLHL,@IINt(cIFHHuL1ɺH51HT$dH+%(H([]A\A]A^A_fD1H xrH L x$IAf1L1ɺH51oL1ɺH5`1A5DHGH@utGL1ҍpADE1@tGL1PADAWL=AVL5AUATUHSH(dH%(HD$1Ll$G\QLHKAąHD$PH8T$ _ D$ KuK}K AeSKu{IKD tPLl1ɺ1H5E1|@HD$dH+%( H(D[]A\A]A^A_fD$ E1=AD2L1L`HPv1ɺLIL61HGPHHL$ E11H8GAċD$ ElHuL5LI1HuLl5IH51Iff.@UHAWAVAUATSHHHuLdH%(HE1HI9E HIA$AD$LH@HHHHHH)H9tHH$H9u%H)H?HEIHEHEHEID$@uqLEubLtL4IH513DUHEdH+%(sHeD[A\A]A^A_]f.AAEYtLOL<@IIEPLHx HEH1HLI}P,A\$LE1L=LmE9fDLH}HEAHHEHCHH]E;l$LDH@I$HH|sLILq01 I$1ItH|lH}E0sII$H|sHLs3AUIL1YDU^hLmL1 L3lH}I$HtCr LIL[M1!IEP11LH8ZHELu1I$L;uLefDL(rI~IrHLATILM1 I~HHHgXAXAYH9H`0rIVH}1ɉLBXrM6L;ubLeET$LE1ELm@DH LL@I$N,LLAJD(LHHS1I$HJT(HBXHZHH%H HBXXZE;t$L"H}DH5j+HH_LK1ɺ1LbE1+f.HLDL!11H5E1@EL11H5pDULE%pI~HpHL2KSI EL$/L1DUMLmlLoLLJI 1CHE1LID$HI#EXH IEX蹉t$AELAJ]EL1L#1DUH O$H58H=Ii @AWLAVAUATUHSHLM9"jG\M AIuHF A9AM8茡AąQEAHE9^EeIHt 8xHI9H@@HJAąHmIUHHB HHHLIH1SL/H5VA[[7tLHmLC.IH51E1HD[]A\A]A^A_L1ɺ1H5cE1f.L1ɺ1H53DHEPHAH,DL Hxj) AYHAZIlIUHHB HtHHtLI LJ(ATL51ɺSL.L1HuX<_HAX菆AąTHEPHAH,DL Hxje YH^HkIUHHB HHHLIS=0@LU1L-1AAXZ f.{kIUIHB HWHHKLIHEPHHDL ,Hxj AZA[ATAUIL+H5 1E1Y^vHEPHHDL ,Hxj HHD$A^XjHDIHEPH,HxDL j H=+HXZ1HL$LL$AUIATUHSHHLI9u7M$$I9t'I|$(HuHL[]A\A]HIHHHID$ !ID$(IH1ɺQH`ID$L(O1H5F III,$I1L)!ID$H5BL 1MHL[]A\A]ÃD1L)H5Lp1ɺ1H5AE16y J1L BH5zTL\f.AWAVAUATUSHLDL$ dH%(HD$x1HH$I9+ ID$HAIMALXAtET$LE\D9%7A$D$D$ID$H@t At$Lt$Le*6 EZuUH< L-Lh*L8,LA_ DL-1L L1ɺ 1LE1HD$xdH+%(lHĈD[]A\A]A^A_ÐH}P?IT$HD$`L|$PHD$ HD$hHD$`HBL|$XL|$Pt A|$L HD$8 ALD$ D+l$LD$DLH蛭 ID$@t A|$LlLL-XHEPH8ID$@A|$LIl$0"H ?HHE$H LHmX L9$$ I$E$HH5 H@H PXHEPH8qID$HL-L1ɺ L1"@HRD9HDT$L-zKcL&LI 1H cL!&LI 1DT$D9LL9$$fMH}PuAąMMLHp AąHH9$XLDd$ EdL1H/AąH}PLxAąu Hp|AąL1ɺ} 1H5(Ld1ɺO 1H5wfL-L51ɺA LN?fL,@HEPIHLHx H:1LHmI$HAD$LHH@HLI$HEPHHx H 1LHI$HHtAD$LHH@HHD$Lt$PA\$L1I$L-EM9Ld$0L|$(MMLl$8H`II`H L;ATI 1LIWLBXHHM!LBXAYAZH9#L!h0H|$01ɉGM?L;|$(nLd$0L|$(H\$`L-"H;\$  Ld$(Ld$8Dt$L|$IfDH_IH_H L:SI L1DIWLBXHHM!LBX^_H9VL!`0H|$(1DyM?AL;|$ oL|$H\$PL9tH{`HL9uH\$`Ld$ H;\$ tfDH{_HL9uHH9$6 t$D$ HyAąHH9$BLL@L1E1L\$ IDILItHyXHVXH tHAHVXHaXHL9uEt?H}Pt H}P}u%H^ L|#I@ADAL-H]H1SIL  L1^_AXlfDHMML|$(]I~H]HL8SI L1 ZYH\$PL9upHL9\H{u1ɺ LLH\LT S IH51@AqAt$L1ɅtH\$Ll$A@DH@I$HH؋tHxAE;l$LrH`\D L?"IH5o1E1L! L-B1L@Lt$`Ht$ I9Ld$(LID\$0H UH$M6IFH@HIEHI9HD$`MnH9tL;t$huӉHLޟIEHH[M6H 8UDL1ɺt 1H5HB[4 L6IE1FL1ɺ 1H53f.Ll$`Ll$hLl$`@H\$`Hl$ H;\$ uhfHH9ZH{u1ɺ LL<-I$HD\$Ll$oH)D$`HpHt$po HrHpfoT$`HD$pHBA9L$LaHB HCHH7LHHL-YHL SIh L1xA[[fL-L51ɺn LN?fH(qEuaHsYHIH9<$?HWHB HzHHnHH~1LHH=FHID$HP HHH LIUH-71SLHAE1^_LEHEL$LHPL1E_AXAYM $D|$$ErAT$LKu9;);$L=I|$OE1ɺLIL 1ID$H@ALT$XHT$PH}(H5iHT$PLT$XHHA|$LC$AvABAI|$LT$PD\$8DD\$8LT$PHID$HP HHHLD\$8LT$PILT$PL1AS5L D\$@SAYAZH\$PD\$8VA|$LhI|$CHID$HP HHHLIHL L1S%\I\$A[A]IHp(|$LA;|$0A;AQLMu9H);$ MyIGD1ۃbL #f.AHLSI HHcхuD LIPD$L$P1XZ-@L=S1ɺ1LL LE1۸IH#LEwL=LIH51WILH(H|$t$L;t$09t$ 9t$ t$$;w8LHt$hL<==/ L=SI11LL|$h(1111LCZ AIE1ou A<$AD$LEZD)9AI|$D\$P|PLAVHT$HLD1RP1H 11LL|$4= IٺLLw11賽=t LL11菽L71LRLPDL$1cY^|$H|$4uRL7IID$HP HHHLH‹t$ 1+t$ LH=`L9d$(I9l$.Hu(L^cLLu(H?5LIID$Hp(;cHID$HH Hn H Hb H$LH$I=k SLAV11AWL=RLGyH |$4ID$H9^Hx(aHu(HAD$$A;D$8D$$A|$LAD$8IH9T$(HJr(BLQHAu9) )HHL=JHDڃEAL4Iٹ LARL2P1蒹A[[1HL$@DLm Il$ImX| I#IE1LO2L8S I21L9d$(5fLDIEPDŽ$)$H8)$t&QE1E1Lj1LjjH OI9l$t+=AL=BL1L1UID$@ tD$ 1A$DT$ t$ HL$|LEIH9T$(HJj(BLQHAu9G)L=PIT$A)ƋBDEt$(HBu 9D$ l\$ )D\$|LD)\$|0$LHKL HASLSLD1ɺOUP1SH L0ASL=SL-P11]A^|$4ID$@ t1LL;0\$ LIHHAD+L$ APL@AHDº`P1裵HL$PE1E1ھL$BAYAZ T$ t$ L趌IH9T$(HJr(BLQHAu9_)ƅoLh/ zLIL 1HL$@11L~D$ A;D$Lr8D$$AD$8ImX1ɺ1H-˝L1ɺH6|H z$H5H=ҫm* AVIAUAATUHHHPt/LDH\AHtIHD]A\A]A^fALy11ɺH5茝HD]A\A]A^D1ɺE1L5H5՜V@USH\$ u.HT$8/AEH[]HHH9hL9t=S$UH-TILH1XLZ1ɺH1袜H1Li1ɺ'腜H1[]@H-ff.@USH\$ u.HT$81BAEH[]f.HHH9ͼhL9tMS$UH-dIL H1ћXLZ1ɺH1貛H1Ly1ɺ蕛H1[]@H-ff.@AWHAVAUATUSHXH$Ht$Ll$0HD$dH%(HD$H1HLl$8Ll$0HL$H9H@HAE@u艝ÅwEu+HHͼ+HH=H1nHHtHtHfDuHzXHtG[uB3t1H1L1ɺH51Hf.H1HtG\tuHB0Hf.USHHHoXH0rt,HHH9HHxG\HtH$ss@L , uwHHSXtHL uJHHH0L #@uL  DL 1L#H5譎1H[]@ L Ef.L eHHtH$r L a뀐HH}H1L VZH-1ɺ1LHL11H1L 1ɺH͍HHH L AUIATUSHHHGHmXHHUXÅt IHpxHHNH1tHH9u HHxxAąIDžLH}PE`HEPHH8!AąH}P&(IEPLH8AąHEPHH8!AąLMH}1LH52<HEPH8脋AąHEPHL BHL_ AąTHUX1fRILH5H@LHH1譋HD[]A\A]_H}Pb% HA[D]A\A]fDHL9IH5)11sLt1ɺIH51f.L1ɺe1H5ňE1̊HD[]A\A]fDO,LA L_IH5w1f.L<1ɺo{DHyhtHy(HHUXHHa0HAhHDžIHUXLMHi1LQH5ևH}Pw&%fMMHx1LH5訉LMH>1LQH5nxATSHHuKHHHt#HHbAąCYuYAHD[A\HE1TLcIH5N1݈HD[A\fHL1ɺqIH51褈HcXnL\1ɺl1H5oGf.ATASHHHHt8t>HcAątgHAHǃHD[A\D1E1LH5@чHD[A\fDL1ɺ1H5蟇ff.fHG@tZHHHuH9u0H9ptHH9t"Hvu9Puf.1DHHkL'IH5e11HDH9ff.AWAVAUATUSHHHG@5HAAHEAąt`H{HSHE1HHH5SIL51DY^HD[]A\A]A^A_HC H@PHx HAAHhDhHEH8HAHL g LAHPHH5HWHHLD1肅;DHE1L.IH51EDx4{HEE1P81LH5kXZDH;HfDL>H5讄gd @AщANL9sJHH> fD3HDB3DB3DB3DB3I9wL΃t#H HH13H9uDÐHDIE1LLIHuHH uGHARVLMV1H5 ^衃XZ1HARI^VLQAUATIH5mUHSHdH%(HD$1H$D$讼 HT$H5>H蘼 AA t@tux$D$AA$HD$dH+%(HD[]A\A]DHEL =HtLL17H5虂HEL HtL=1E1LH5BVZ謗ff.UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$3x/HHcH9s$H)HMHHT$dH+%(uH[]ø贖@AUL-z1ɺ.ATL\L1UHSHDOLDMP11LQ/LHHt!LHHL:1L11ɀ11L:9LL%藀1LHR11L;Lm}LvfLHR9]LwHLL1[>]A\1A]$@HEHH@PHDL ,Hxj褋 1LILBX1Z6ff.fAVAUATL%USOLH1L5L-3A1M1ɺ!L\LHQEL9wHHt]tY1L-f.HH@HDHt%HpH(1AM1L~XZ9]Lw[L]1A\LA]*1A^~UfH1SHyHHHdH%(HD$81H)D$H|$1)$)D$ ֫ HtAH@ Ht8u2AHtH@EHD$8dH+%(uLHHD[]fDHCL HtLL1DH5*}E1?ff.@AWf1AVIAUATL%ULH1SHHXdH%(HD$H1Ll$)D$ Ht$(LHD$)D$)D$0٪ Ht%LHHҶ AąHM0 L%&Vf11LL)D$ )D$H\$()D$0聪 HHT$H5H贷 Ld$GMtf11LH!)D$ )D$H\$()D$0 HHP HHsALHNVAHD$HdH+%(HXD[]A\A]A^A_DLHH辵 Aą+HEL ~HPHHCHtLHLRaDHEL e~HPHHCHtLHLRz1H5E1{XZ/f.L}LIPHH@HHHHXfDHEL }HPHHCHtLHLRWH5_1{^_DHEL }}HPHHCHtLHLRsf.HDžHCIWHL .}HtLHLRjff.ATI1H5hUHHWLLs E1 HHtHPHH5Q1Lst1H5>Ls LAT$(t!HHL]H̛A\鈰Lv1ɺyH5yH1]A\HEHLH@PH1o$L9v1ɺH5Ny@Lv1ɺH5e)yH1]A\Lu1ɺH55xC@Lu1ɺH5 xff.AWMAVAUATUHSHH(dH%(HD$1H?Lt$`Ll$hHT$LHq AąHt$HFIHIEH~HMtAGP1HHAHtY1HtRH9YH fH*HfH*^YI, =D‰HA萑 HD$dH+%(2H(D[]A\A]A^A_f.L\t1ɺ1H5owDIHH $LL$ H $LL$HHLL$H$lOL$LL$AM$HȃfHH H*XfHfHH H*XffDfDH$L1H5vL$LL$ZՋDAWI1LAVAUL-ATIUHպSHHhLvLH|$dH%(HD$X1vHT$(HH LD$(Al$LA9hIx H5RL$GL$D$HD$0L4$E1HD$DDvL4@I$IJt0H$H@PH8EuiLNHLL11KuLD$(fDH|$L HD$XdH+%(Hh[]A\A]A^A_fDHE1E11jjjHL$(ܱH hDT$0EZHL>LD$HPDL$L1tHD$8AXAYL$uM~A?tLLusHQMvMuHL$ H|$(HLH$II)L0AUD$;LHPD$BPD$IPIHIjr(QH WPLL$H1`DD$XH@LH|$8EVsfDI\$VfDHH~HxHHZvu8WrL .b1L]PHtQH5SP-t8$r1ɺpHPHL [PL]1E1`[]]Dt8q1ɺkHPL L`]1AU_A^A_Wt8qL wa1L-]PHrLH5PsILH1c_D$HSLL$LӿH1,_AYAZkD$L zD|$HHL`LEHHD$01^ZY4vbs8p;Iٺ2IH Hm`HEHH APLQPH1q^H D$L5!yL=]HzL9M>ILL>pHtSLAWLL$S LAWLL$S LAVLL$jr8o;Iٺ-IH Hu_HEHH ^APLQPreHE1L׽]]AUATIUHGHWLH@ 1H5LVHE@ t%U82HE@t U<EU@RUDUHt1H5LD)VLAT$(tiHOHL]A\A]fD1H5LU_U8uXHEHL@HHEIAT$(LuLX1ɺy1H5p[]1A\A]1H5LoUuLX1ɺH5[f.1H5CL/ULcX1ɺH5_x[x1H57LTL#X1ɺH58[81H5LT`LW1ɺH5߼ZLW1ɺH5Z@1H5LGTL{W1ɺH5wZ1H5>LTL;W1ɺH57PZPLW1ɺH5)Z)@1H5rLS LV1ɺH5ϻYLV1ɺH5Yff.UHSH8dH%(HD$(1G\ HGP@aAE|HHH9u eHH9t]HCHxtHCHxzL޺IH5t1Y@ ҅H8uK1HT$(dH+%(upH8[]fL/IH51X1HHE1E1jHjjpH t$1m@ATUSG\ HHH9ŸHDtE1AD[]A\tHUHtHR HJXHtHGPHA1H8AątG-E1LI1H5WD[]A\ÐHUHB Ht9HHt1HIL1H5OW+LJ(@AWAVAhxAUATUSHH8HWdH%(HD$(1HHJPHL)HD$ HtTHjfH*A^Y,t Ahx=t@x}A9OA)HRhH:LCH{HT$ ȶAąMHT$ HBp8D@0 ȉ ȃD Ai@B9O;jBD99HBLH(L9tfHH9HEI9tIL%H{HH1ATI1LAUH5E1U}UHT$@H H:\ HD$(dH+%(H8D[]A\A]A^A_fDHWEL>LDH K@HDHI@HDL=GLD$LD@H{HL$L%>HT$LD)HLD$ IH5&1APHL$ LQHT$ 1RAWATE1THT$PH0HB@8fHƃfHH H*Xf.HQXLLIHD$ pH{HgAT1ɺ=UIL 1H5_E1SHT$0XYDLLIHD$ prH{IAV31ATI1H5L+E1SHT$0^_B@LLIHD$ p H{IAWL~1ATI(H51E1$SHT$0AXAYfDLO1ɺ1H5^R~f.L%T/hff.@AWAVAUATIUSH(HGXHWPH$L2H% HD$HD$E1LHd1D$I9IE@\ HPhHpPHL,?AIEHPhHpPHLD$?D$IUD9AL9OH;T$t?HHHD$H|$H9t@HpHHvLH9uIT$PMmHI98L;|$L%Hc@Dž @|$I9kHHD$HL$HRL-gH$4HAELM A,I~j\ 1ɿL۴IXZt$ATL%1AULt$PH |$3H([]A\A]A^A_ÐH|$HD$E1HH\$HHHH9tHHHHILH9uL9|$@HVXHVXHHH9pHHD$H[\HI9H.L%QHD$H{L%HAI~EM A,j.[ HD$ ^_5=#LL11;Oc~/=LLس11Or=ȝLL111NFH|$!IHPH$|$Ht$L%uP`fAVAUATUHSHHDoTL9r1IHuA[]DA\A]A^fH{@AąuHEPHLHDL ,HxjY HIHEPHDL ,Hx$Y H{IXZHHHLtAUI1AVH5SMH D[]A\A]A^@ATIUHHMSU2HthH5[THH[t2H5H [ugEA$[]A\fDE[A$]A\1LH53L11IٹLH5L1D1HvqStqHLW,L jDL׃X L1H5IX1ZL[fDL1ɺH5SK[fAVAAUEATUՉSHHDGTHHpt[EuFu HCHHXD$0ADHǃ[D]A\A]A^ÐHCHhX3@ALH11ɺH5,K[D]A\A]A^UHSHH5}HHXuEH[]f.H5HXuEH[]f.H5^HXuEH[]f.1IٹL:H5YJ1afAUVATUSHHw@H[]A\A]H, HDjL U H{,DI$L `U H{,DI$L )U Y^AUATILY1;H5@1ɺHH51QCDL$LKH&HhHLKH|$ ADL$L?1ɺL1BDL$v@A$%H50uHD$La?1ɺDA4$HH{,DjL M YLw^I1L1BH,jH{DL M _1AXILhL1ALt$ 1L 1LLAAAHDL Hj$M A4$$,DHL H{L H,$LIL1AAZE1A[A$HH{jL=7,DL rL _1AXILL1{@E$_fDHL$8LLHUDEA4$1HD$8IH<HH1HD$PH=v>Ht$H!@HA $H=HƁvH΄tHD$PHH{,DjL K A_L= 1ILsXb1L?HD$PE$R@H4H1HD$(t!w% ) H{L=,DL 9Gƾ9BHjJ AZL¦A[I11lL>HD$PE$fD$Lx;1ɺfH,DL jH{J LNH$HD$PLH()@HD$P7@LѥDfD$L:1ɺWTS@HHH9^ATUSHH9H HHEXt H$H H@L%%uSHHH9HHDAąA[]DA\L%3HaHMPhL1H5TE1HLHeGHH H]HH1HHA11L;H5~J;HFH@AWIAVAUATIHUHSLH(HL$dH%(H$1I@ A@(oHUHLHHEPHD HLt$LLIL覨 H$xHCt4H$dH+%(H([]A\A]A^A_fDH{HCHGH$HJ HrHtZ1HtSH9UHlfH*HfH*^Y,ЅDHKHƉS H)HtZ1HtSH9H;fH*HifH*^Y,ЅhDЉS$HHH9ZHEPdHHH9Ht@H~fH*^Y,ЅDЉS(;HHLIH5G181f.HHL`AVI1H5G8X1ZfHH_1HTH9FHVfH*fDHD$HKHLp IHC@HD$HKH;Lp} XHfHH H*XfHƒfHH H*XmfHfHH H*XfHʃfHH H*X1fHƒfHH H*XffDfDfDlfDHfH*XIDŽ$E1&H. S1HHHt H@H9CtgPLHLǦH5MLDH1SQ&H{8XZHt!HP H{[- LL1[KH5a%ff.HtGUHHHtH5E&F4u]H}@H}HH]Dff.@AWAVAUIATUHSHDEu|H}.- HfLhHHImPHHHPHHHIuX6H[]A\A]A^A_HLI9mE1fDH{HAL9uE9CH11L%DLLz$XLE!Z1ɺsL1[$fD1L!1ɺvH5/$H1[]A\A]A^A_ٰ fUSHHHoPHwHH#HtVHHPHHQH Ht_H H0HPH HH HkX6H[]fDLd 1ɺH5y#H1[]+ ff.UkL SHFH!Ga u/F=ArHD[]At@tHGHDL ,Hxjw. _AXILr1H5"HE1D[]Lُ{1H5\"HE1D[]HGHDL ,Hxj- HHCDL ,Hx$- LyH5I1H,$!YE1^HGHDL ,Hxj- L/IXZAWAVAUATUSHH(DG`AA9HGHx)D9H{DHGH@H@PHt HЅHHEDHt"衜HHEDHyLHHD$I9H\$DMeID$@A$HHHH9HrI$ADH!ID$@HzHHnH9eHrI$ADH4跛tM$I$I9uDM6I9I~ uID$@HHHH9HrI~ADHΟ@HID$@HHHH9HrI~ADHc1ɺD$LH55DL$fDMmL;l$dAH\$HHHD$H9uDLuADHG IvHIiXMIHD$I9Hl$IvHI|$ ADH#IvHI|$$ADHIvHI|$PADHݙjIvHADHI$跙IvHADHhI$d葙AD$LE1t=DI$H@HHڋEAE9l$LwM$$L;d$Hl$HmH;l$AH(D[]A\A]A^A_LL1H5?E1뾉D$L1ɺH51DL$@H5I>@H5yIs@H5iIZ@H5YI@DH1HH[Lv1H5!E1fD$L1ɺ;f1ɺD$LH52DL$D$L1ɺD$Lt1ɺELH5pE1V1ɺD$L$H5EDL$)1ɺD$LH5}DL$IvHHzADH1ɺD$LH5.DL$HzIvHADH~H蚖I$IvHADHaH|Hk1ɺ D$LH5@DL$$1ɺD$LH5xDL$1ɺD$LH5KDL$1ɺD$LH5DL$D$Lw1ɺ1ɺD$LTH5uDL$Y1ɺD$L'H5HDL$,1ɺD$LH5DL$AVAUATIUSG`HGAH@@`tu(E$[]A\A]A^@AI$M$L9t1H{HL9uA9sI$M$1L9tDH{诇HL9uH21AAVLچH5$X1ZFL1Lc#H5W[1]A\A]A^f1LȘ,H51fHG`trHGH@@`tuHÅDA9vHN1LH5)X1ZL1L?H5_1HfDy1LHH5"1<AWAVAUATUSHH $HH $H8HT$HH։dH%(H$( 1D$HtH HD$ E1E1Hl$ A L- #AAFH IHtIcL1LH)H yL- I11LGLg-Ń>Ht$11҉)A9D$AA8HD$AHt fDH$( dH+%(H8 D[]A\A]A^A_@AąPH D$ Hl$ HD)E18&HALPLׄ1[_AXaHD$L HH1LRLh1Y^$@<1E1LH5Y@LL1E1a-(E18&HL PH6JLPLu1AQH rfL1CH5֔GH1LLRjXZ(aYH;H!(8HG%L LIHH_A9HrARHDAPLEtSUP1}H "@SHHH?dH%(HD$1,)u@{1Ht$&9CT$1HT$dH+%(H[3'8|$HL PHLsPH@^H5yP1LH k&8$$HL PHLAVAUATUHSHH8HWPdH%(H$(1L$0LL:HFXƄ$tHDŽ$@$dHF@HH$CHL$L$DŽ$u$H$H$#H$HH5H$1H<$HLH$H$HDŽ$ DŽ$0DŽ$8H$H$H$IHL=1Lc@HMHM5H$HL蚎BK\LCPH$HHpH}PL/IH@H[@HH$(dH+%(H8L[]A\A]A^A_H@ H@XHA1H$LЅ*H$L?LH(fD52RuFjCd11HPDKhDC` ZYK\DHEH1L1H52/K\H<$H |LH iH4$L UHEHHLHID$HH$L9HDHEHKHLII9HDE111`1ɺ*E1L@ H5_a9@LL$1LHULL$ LL$kH}PLιLLL$RwLL$HLHLdL 1ɺH5D1ɺE1L} H5vfL\ 1ɺ1H5rE1lDL, 1ɺ1H5B?f.Hx{L'IH51E1fL 1ɺ1H5f.H{L|tIH51i@Hz LtIS1ɺ'E1L H5<>fLtH5 d@ATUHdH%(H$1H8HHHH9sDH8/tH9rH9a1H1Aăt86D ubH$dH+%(HĨH]A\9fHHeHD$%=@c/@8}HIIHJH HHDHAPL_QPH5Q1H :@#8l}H?IIHDJH sHDHAPLn_QPfDE.HE}IIHHIHDHH APH5L _QP1H mH$dH+%(u,1HĨLH5D]A\ATIUHS LtGuC1I-LsH5)[]A\ t8t}IIHHHHDHH /APH5zL]QP1H []A\ATI/UL%HML~SLHH0dH%(H$(1Qt9H$(dH+%(H0[]A\H$HH uHuHD$H9$uH$H9$uH xT8h 1LIP5HVPL 1{Y^3@ 8T 8I1PHDLPL 1;XZff.@AWAVL5KAUATL%aUHSHL=at$IM9uyeD1L1ML"}TA AwII L HHIL9HMoHtHLuIIG|$HBH_EW1ML|%LDT$ |$ e8 (M1PH*CLPLa 1XZ)fD[8 MO1LPVH{PL 1Y^H1[]A\A]A^A_H[]A\A]A^A_@AVAUATUSHDGdH%(H$1EGGGI1H-71L HcGDL EHcnGDEL571L-;{L%Z Hc?GA~HHP1HtH HIHuH$dH+%(HĐ[]A\A]A^f5*7L HcFu`1L! H 8 1H5 L _zPHYzPLP 1Y^D58L ; 8 M1PL 1LAUqXZ DEu luH1ҿH5ΐI u;HfD 8HL yPHzyL XPHBH5 P1H ff.AW11AVAUATUSH8dH%(H$(1Lt$LL=l5HE1D$ IoL$LH)H${L1sH $L<3H r{L$H$DHHHPITH#sLD=zDDAHMcHH)I׉D uYHAuM1PH'<uH5CPLZ 1^_W ZAuTAKA;\ED$D$,AD$DL$A(Lu1H5C3;11ɺL H5B1H$8dH+%(HH[]A\A]A^A_fHt$;tHD$H9$HD$H9$21D $L" DT$H5 [DT$D $DA>0M1PHt:L PH5A1XZ@A>A<$MIHH<HDHH xAPH5ALQQP1H 1DEDA<$MIHLHW<HDHH rAPH5ALzQQP1E;H UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$E1x"HHH9wHH9tH)HEAHHD$dH+%(u HD[]@HUSH-.tdHoHH)fDHAu.t_t +uI:Hu=DH[]DGt <.uuH[]ø뺸AUATUHSHtHHH HHHtLfHHIHuMH L9uL%muHLHu-L%buHLHuH[]A\A]fDMLa1H5KiH1[]A\A]@IٹLafATH5sUHStpH5sHtXHsLHHHu:H I9uH5ztHHuHH5ot[]HA\[]A\fDATIUHHHt"LH IHt7HL]A\@HHT$UHT$tRHJfHfLUIH5hJ1HL]A\fDHHT$CguHHEXHH!H9tH.H_:H/H(H4HiH%rCH&H_H'H-@uHT$HHlmHHHf.AWAVAUIATIULSHH(D}LH Lt$`LT$hLD$pDHHE0% HHE]PH@P99AsA0EPHH9`H9UL$HD,Hz)HjDL D YLժ^I1ɺH5 1L$fLҾLT HHH)L1$IHaE1 u $fDLhP HHH5G1ɺ1L( zH5zdL 1ɺ1)@1HuaHuLHFPLNHLփL`H(EL[HL]A\A]A^A_11AfDLEHvkLA@Y HEHL$IHHE#L~]LHHH5c1H4$;H4$f6L 1ɺy1H5HcfLLD$LT$H$ H$LT$HLD$HLD$LT$H$HD$HL$uLLD$LT$H$H mfDLL 1ɺiH5baH(1[]A\A]A^A_1L H5D`L 11|H5PbDE1 v0 $_LHL$HPIHHT$H8 HL$HH+HT$LHL$H$t|H5^iLHL$H1A$Yh1HQ`AlDypHAx[L [1oH5UaI>A}HWtLHL$M7 HL$HHǂHLHL$HT$5 HT$HL$PH5[CLp 1ɺH5`<H5(CLRh1HǁxH5x`@H-h`1HLCBH11L JHHLYLHHmH}^LYH5_IHEH@PH/11ɃpHEH@PHM1H5ALYaH5a_DUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$D$0HD$Hl$'@ƒH$H2Ht.HuHHu$/vHT$H2HBHD$HuHD$dH+%(u HH[]}ff.fATI1UHHHt>H_HHtYHxL=A1Eu EH]A\fE1LcX1ɺ2H5@H1]A\ÐH1]A\fDUSHt[HoHHBu6.t1_t,Cըt%/t =t!t:t&t #u]HuH[]1@ATSHH=}btAHD[A\f.H=E1!HugH@bHHoIHt7HLuuH= bE11Ha|L%Md1ALLKd)L1LJdK LV1"H5cAU1ATIH=dUSH1HHLljH9u(ACHD[]A\A]DL-`c8EHL cPH1|LPH ,LMAP1H AątL1L 1ɺ~E1HD[]A\A]fkE18HL cPHqL@wPHu+H5bP1H DH[]A\A]1L2 1ɺH5UbGHD[]A\A]f-AUL-UATD 2L%0NULHP-PY-PBEP154EH un-0-t ]A\A]DE91=1La1 Lp -tV1HvxHNz{]LL A\1ɺ)A]fD1ҾH葹;u=0xL-)xu#Hp"HSaL\ 1L1wNE8 1LPHoL wPL 1qXZf.vfD]LL A\LS1A]C$]LL`A\1A]ff.@ATUS0y11HvÃtD%3vD9V[]A\f}tL 1PH`L EPH5z-1c_AX[]A\11Du8HAٹATH5>-LRY^[]A\fD}HE1P1LRH5,XZ[]A\6*ATIUSuHH5V_LtEMy1LRH5,~ /u[A]A\H8HHHH9t$@H舳H8HHHH9uMv1LQH5,d)HdfSt11:u6AٹLQH5+[>.D+8tHA1P1LQH5u+[XZ-[ff.fATLQIUH-3+YSHHD -dH%(HD$(P(PX(PA@P1D2@H Et3( e(t#HD$dH+%(H[]A\fD11L=]0HH$sA$HLduu1ɺ3HL 5DnEty,t' 't!H=R[?;fD fCH1L kL+O@=reufH=rL%rH$HrI9MHLH9vnHHMSL0P1ɺ=1B^_81ɺ8HPHc!L QrPL 1AXAYXHB1SML&PHZY%DAWAVAULATUSH8dH%(HD$(HL9HH9Hu\AHH}PHGH}Pq6HD$(dH+%(fH8D[]A\A]A^A_D%6D5Eu HkG#1HI9HHH9txHH9uHEPHH8}kAąHEPHH8lKHEPH86uD5HEPH8)t$ $uEEHL9THL 1ɺ1H5NiE1ADHEPHH8_AąHFAąD85EuD5D=ZHt HNHHDOHvSIL NH5h12AXAYfHEP5H8toHHE1E1jHjjH tG $t@H1I9HD}H ONLMI!DHNILoMIL%g1LnL1ɺ~L0 1E1NfHEPHL8!HLI HE1cNL&IH5]g1HE1%NLaMIH5g1BfDE3EuD5QLY 1ɺr1H5fl1L, 1ɺ1H5f?f.HE1uML`*IH5of1~fH8MLDLIH52f1*AUATUSHHdH%(HD$81HD$HD$HD$ HD$(D$0D$ pu#HD$8dH+%(HH[]A\A]@H=UHHHUHDHH1Aău=DMAL-UpL1LKXE1Ҿ#ZDBt}L-_U_1LIPWHPL 1FY^oL-ULJ1@LH|$/|L1L UHl$ LUHIHuPHnLTPH THUH5THD$(PH|$81H H|$1HT$ H5o*DL$ ETHH|$"H|$DMAAoDL-T}WI1PH4LPLk 1XZALSL1xUH5IHuMH5JHu:HLS1Lt$0L UP_AXHL UL1t$0LSAYAZL1LIALIL1NL-R1LHQLDAhlf.DHHBHIX@( H%scH3sDH xPHJHJ t"L[1ɺ 1H5Y7HDH YHJHJ tH HJHJ tff.HH׃Au5HH{cHcHDH WHYHDHG HWHHUcHH;cH5.cHDH!cHDp[ HfDHH׃Au5HHbHbHDH HHDHG HWHHbHHbH5bHDHbHDZ HfDHH%Au;HHYbHbbHDH 5HHDHG HWfDHH-bHHbH5bHDHaHDHZ Hff.UHSHHHAH@X@u tyHt$HHEHaHE H[]fHAXH_DHAtAHAt4HEt(JL~11H5daHH;HH[]I fATUHSHAHH@X@u tyHt&H[HEH`HE ]A\fDHAXL%yDHEt.L%]At!L1ɺ$1H5H;L[H]A\ ff.AWAVAUILATUHSHLHdH%(HD$1HL|$PLt$X H4$HFIHFIHFHVHtZ1HtSH91HfH*HfH*^YA$,ȅDAMHt$SPHcHHaw̫HHHHA\ HD$dH+%(HD[]A\A]A^A_fDAL) 11H5(+HPHhtqIVL3HSIVHI>I^tUHXIVL0HIFH[]A\A]A^A_1LrIH5F 1F AWAVIAUIATIUSHHH\1ɃIILLI)ىL$ Iǃ,t1A?:tIH[]A\A]A^A_I_HL$ IILLI)Iǃ+NtA?:tI_f1uI_H1IغILLHI)fH]Xf.AUATUHSHHL)LH}L`L Ht,LLHHCHC H[]A\A]fD1LGVH5VDH1[]A\A]ff.AUIHATUHSHHQI}L`L Ht,LHHHCHC H[]A\A]fD1LZGVH5CH1[]A\A]ff.AUATUHSHHHHt HHtH9uOL-pLH}L`L8 Ht3LLHUHCHC H[]A\A]DLjf1LFVH5B;H1[]A\A]ff.AUATISHH;LhL蝾 Ht8LLHHsH;H[AątDA[DA\A]D1E1LW 1ɺH5BlD[A\A]1L* 1ɺH5B?D[A\A]fDAWAVAUATUSH(HL$HL5HHHD2HD$CfHM1LLm Ht$LHŨAąHH9\$toH LkHHL$LIHM|LP HL$HIuL? 1ɺ1H5ARH(D[]A\A]A^A_AL 1ɺ1H5AE1 f.Ḻ 1ɺ1H5^Aߴff.fAUATUSHHyHuHAPLMuYHpAHCHC HC@( t"LsA1ɺ 1H5S@HD[]A\A]f.HLeH}LhL Ht0LLHAHCHC HD[]A\A]fDV1E1LbCH5?kAUIATUSHHHAH@ toHB^HPHtWHI}L`LJ HLHHA]HCHC HD[]A\A]@uHAHCHC HC@( t1L@1ɺ H5>*HD[]A\A]@@AHHtH°H9t$fV1E1L"BH5>>AUATUSHHHAhHtVLhHLH}L`L' H~LLHA:HCHC HD[]A\A]@HAHBHB HB@( t1L>1ɺ H5=HD[]A\A]ÐV1E1L2AH5=qAUATUHSHHLMtHLL`H}L8 HtCLLHUHCHC H[]A\A]DAL-f1L@VH5<+H1[]A\A]ff.AUATUSHHHAHt H@HuUHAHCHC HC@( t"L=1ɺ 1H5g<HD[]A\A]fDLh(HLyH}L`L Ht4LLHA0HCHC HD[]A\A]f.V1E1Lr?H5;gAUATUSHHHAHt H@HuUHAHCHC HC@( t"L<1ɺ 1H5g;HD[]A\A]fDLh(HLyH}L`L Ht4LLHA0HCHC HD[]A\A]f.V1E1Lr>H5:gAUATUHSHHHQHB HtHHtHI DLj(L輾HL`L] HtXLLHAtHCHC HC@( t"LK;1ɺ 1H5+:pHD[]A\A]f1E1L:H5: HD[]A\A]ff.AUATIUSHHHAH@uVHAHCHC HC@( t"L:1ɺ 1H5p9HD[]A\A]a L-tAL- t0L<1H5@L-{I<$HӴ Ht~tAMHCAHC HD[]A\A]f.HHHH9HAH@fDV1E1L;H5C8IUL@LIHIT-HT(HL)H)G1L 9M 89r,f L-*AMALLALfL@ATHUSHӋQHVAH-gLX HDAHUL@IHDHLHLHHL)H)Dr1L 9M 89r8uHHCHC HC@( t"L71ɺ 1H56[]A\A&tMtLfLHAPH@hHMII HHE)LHEP HL:1H5S}HAPDH4AwJAAA H-(AE1H HAHEOd$HnfDL91H5ԩ1L 1ɺ H526賩1@MLLmfDAUATUHSHHHAH@ tgHB^LAL-uWH}L HLLH$HCHC H[]A\A]@@uAL-Ī@A L-tA L-x1E1ոL`e@@AHH°H9tHt$f1L7VH5F4H1[]A\A]fDA L-bfDAUATIUSHHHHt}uJAH-˩I<$L HtL$ED$MMIpAfAAwՃA:@L8HfED$AH<$I(M)Y H`DfH 8LhH4vI>H4Lx HpINL0HHINHIFL}EHL}HEBDx uD}IH$EtnHfLXHfE(1ɀ}:AH$H<$LL$E}DI녃|$M9M.Ll$M9u\ 'MmM9IEuIE1Im L=MuI9HEH\71IEH|$I :LHH9tAGtH@H9uA<suLLuHHHDIEP w4Ht$Ht*HF86HH56HpIEfM1Lj1H5,9@IEHI9f.HP !#/H@I9HuMmM9}HD$-L >6A-A-MQ;Qt#I΃ 9BA9DGI9HHHH9uL9HrHAD!I9tHHL /M9 mHtHN / xLJL\@H=6HxH=6HxH 6HHMH<$LE1n H$dH+%(\ H(L[]A\A]A^A_f9FՃEI9HD$E1A1۾;D@A9t91ۃ HI9HHQAAutAt E9pEE1EAfDHD9?AA1i yHz }LRLfH<$" HD$HHD$HHHHHL$ H5)j! DDL@t$cfEt$H.@IMH$H$1A-L MIH9 Hr I9p LJMPHJ1LJ1L-H5(@L$-1 H5(H<$1ܵ i-A-A-H|$Ht$0觲foL$0foT$@fo\$PHD$`M<$)$)$H$HDŽ$DŽ$)L$pM9b1Al$1Dl$LMMDt$I\fC CHct$HH)HHH)H9HOHiҀQIאI$LI9IID$CvCу w$D胯I|$ 1I蹭AOtitSIIڃIDH낍CvS n eH50HcH>IQLDA-l$0D$|'HD$p0D$x 1MLZ)H5x&GMl$Dt$LDl$A)A*A#A-A!H|$pH)HD$ HD$(H$H|$ HB$t Hl$ H|$(H!$<H\$(Ll$ H<$LH$ 1ILH% H訖 H'H<$HXHǠ IHC3$A$DfAD f.? HHHcL)1 H5I$L)&H-$1E1H4L 113HtDŽ$D$|.LRMHHJ1wH|$pD$p%H)HD$ H;HD$((Eك-JH|$pH)HD$ HD$(!H=HD$ H*HHHHH?HH)Ћ$)H@H$H)Ƌ$xHcH9~  $)%HHB8l$xHiŀQIHHBP 'IHiIHiŀ: Il$p)$sl$tjIbHHH)MOHHHHw1ILZbL1ɺ1H5oHD$(dH+%(HD$LLLE1HGH8[]A\A]A^A_ f<1҉ILH=xA1ILH=HHHt$ Hqt|H|$ H5G܃ugCsHEX IEP@A}CSIEP@8A} CCIEPuHHH9rLHH@HHHLVHRHH)fHH9HPB_t9A}tCMCI΂CmuI1/LH< MHthHHH9t/HPHtLzMtHRXHt AGZtH9t8HH9uLMHL1H5lItLHHHPH{HHH9EH<pLIkHI~L;yID9wLJHuHAwHL1H5(lXZ^I$sVAtHOHH6HH9&H@0%HSdA@mDM_vAMI%t=I&T-AI"r9lAHHtI$skt4oHmRHHBiHCu-Hi SsViHHt$ HT$ܽHT$HD$ 1LH54F 0uH1AwHrHAVXjHD$@H B<0A:LJHuHAwHL-MOHLQuHPE1L?uHH5AwHrHiH IfDAUHATIUHSHHAHH H}@AH9ufHH9txH;zuL5q HL1H5\8i1Lf 1ɺH5iH1[]A\A]f.Lp HtaHH҃ⵃxPHH҃mPHCHC HC@( tI1Lx1ɺ H5ZH[]A\A]1@fPduDH[]A\A]E-uOшAfUHHSLHu?HHHHDH5HiHDH[]DHHxHHDH5dH[HDH[]fDu'H(HEHEHE H[]DHHEHHE dff.fATHIUHSn HlH1HfCCHE`%HwHE`HೃzCHE`HൃxCHH9O1DHPHHHH9uགྷpCEP*(&$-ScEatVCID$I\$I\$ @( u[]A\@1L1ɺ H5[]A\@H-Ht຃sDL1H5?\e1L&b 1ɺH5;e[1]A\@-1@HH5ZTݸָϸATHSHHHQPHqH HtMHCAHC HC@( t"L1ɺ 1H5nHD[A\1ɺ;E1L-a H5NdHD[A\AUIATIUHHSLH>AHHtHILL[H]A\A]HeID$ID$ ID$@( t L H51H[]A\A]ff.ATHHSHH7HtJHCAHC HC@( t"LS1ɺ 1H53xHD[A\D1ɺE1L_ H5cHD[A\ff.ATHSHHHQPHqH HtMHCAHC HC@( t"L1ɺ 1H5ӏHD[A\1ɺE1LM_ H5nbHD[A\UHHSHHHHtA\tkHHp HHt\HCHC HC@( uH[]fDL1ɺ 1H5@uH@XL^ 1ɺ0H5aH1[]HWch@AUIATIUHHSLHHHtA\t1HHt4HILL[H]A\A]fuHHXHbID$ID$ ID$@( t L H51H[]A\A]@AWHAVAUAATUHSDHdH%(H$1҅t]HPhHtTD:LrI9tHHLD| HH`Et[uVDADLHrAąAH$dH+%(CHĘD[]A\A]A^A_DHAąuL\ 1ɺ1H5?_fDHHHXAHH$szHHH9ELrXMLME6HR`H$L\ 1ɺ1H5'_fuLrXDH$^L[ 1ɺ 1H5NE1^"tfAVAUMATIUHHSHH dH%(HD$1H4$Sf HH@HHD$HHtulH1EH1AA~AƅtWIGE1LHHT$AHD$dH+%(H D[]A\A]A^fDHPDHt$H<$w LZ 11+H50]L  E1H5U ]LOZ 11"H5HD$Y]:rff.@AVAUMATIUHHSHH dH%(HD$1H4$d HH@HHD$HHtulH1EHAAAƅtTIGE1LHHT$AHD$dH+%(H D[]A\A]A^HPDHt$H<$"v LY 11EH51\L E1H5\LX 11<H5aHD$[=/qff.@AWIAVAUAATUSHHxDD$ dH%(HD$h1DLzpHjpL93Dl$ Lt$ A6fEu90HPHDD$ AąM?I9IGuHHL@1 HHH AąIG@AHHHL$LpH9t{HD$ HHD$fDM~pMtMH|$L1Ҿ@ HHH臣DD$ DLHIFxLpH9D$uAHD$hdH+%(sHxD[]A\A]A^A_@HHD$ LHD$I9ufDHmL9HELPAB\tIIH9{L9xXt L9uH|$L1Ҿ@LT$ LT$HHCHLT$LT$ODD$ 1DLH]1ɺ}E1LV H5#YfDEIMI9D|$ Lt$ AHmL9HEtEt1HHL@ HHH诡HE0HPHDD$ u1ɺE1L4U H5UXLU 1ɺb1H5/Xf.LT 1ɺ]H51E1WLT 1ɺ_1H5NWf.LT 1ɺj1H5W`f.1ɺlE1LMT H5nW/f1ɺnE1LT H5>WLT 1ɺy1H5W1ɺ{E1LS H5kVLS 1ɺ1H5JVLS 1ɺlff.AVAUMATIUHHSHH dH%(HD$1H4$3^ HH@HHD$HHtulH1EH1AA^AƅtWIGE1LHHT$AHD$dH+%(H D[]A\A]A^fDHPDHt$H<$o L~R 11H5UL_ E1H55cUL/R 11H5HD$9U:jff.@AVAUMATIUHHSHH dH%(HD$1H4$\ HH@HHD$HHtulH1EHAAAƅtTIGE1LHHT$zAHD$dH+%(H D[]A\A]A^HPDHt$H<$n LP 11H5TL E1H5SLP 11H5AHD$S=iff.@AUATIHHUSH1H?HtJHHcI<$LhL/[ HtzLHHAFlHCHC HD[]A\A]HTAHCHC HC@( t1L1ɺ H5HD[]A\A]ÐV1E1LBH5uAUATIHHUSHӺHLHtWHHbI<$LhLFH1[]A\A]A^A_fDLl 1H5FH1[]A\A]A^A_L ff.fyptHpDHWHBHHB ff.AIхtH0IfL鳇 H֋鲈 fH֋Q 顈 H֋QL鑈 IҋQLIrv0HfH@@_tttH@Hǃ8tHA+PA@ t 1ADLL H֋uHFHFHHF  ff.HAHIPu+u HFHFHHF @DYLEtHAKE1H IHLfDHH9tG8uHxLHǰI9EfIyu AvHAH9uDEt E9<L H֋Q$ HAH@uHEHBHHB ņ DLIH1IA II H9tfDHH9uIA0MA0I9t1fDHI9un ff.LAH1I@ I I9tfDH HI9u' H֋Lu At HHFHHF @HHH1H9t%@L@HMAIH9u隅 f.HA HHtPxx HWDHBHvHB @AVIAUIATE1UHSHH9t H{臱HAH9u[D]LA\LA]A^ fHLH1I9t@HI9u HHH1H9u 2fHH9t(L@ItA@\uHAH9uk ff.HH#AXHtHHH92cP1[DAVMAUIATIUHSHHdH%(HD$HAH@ttW uPHHHuIH?ID$HID$ HT$dH+%(uNH[]A\A]A^fDHCHtHSC(HL$MCLHLHRPLD$RHAATIUHSH@Htt; u4H\Hu0H?[HEH,HE ]A\HCHtЋS(SLHL[]A\ AUIATIUSHHdH%(HD$HAH@t  u|HĒHHtHHH$蹎u=H\>IEH{IE HT$dH+%(ufH[]A\A]E\u"H$LL} ǐHkf.Hu1H<$uHEPC(HH$_Qff.@ATIHUHHdH%(HD$HAH@ttz us辑HHtHH$趍u:HY=HEHxHE HT$dH+%(u-H]A\H$HL | HPDAVMAUIATIUHSHHHypdH%(HD$1Ht'H5f; gIuH{A1Eu4HHt!HHtYH5'; (IuDHLHMLHH$HT$dH+%(u-H[]A\A]A^+HOATIUHH8H9dH%(HD$(1HL$ HtH8u3HD$ LHGHT$(dH+%(u;H8]A\HLD$HT$HL$THL$HT$LD$tOATIUHHHHq@c 1HtHHH@H9tHH9uHLH]A\+| ff.ATIUHHHwHLH]A\{ AT1IUHHHdH%(HD$1HT$LHD$QHT$dH+%(uH]A\N@AT1IUHHHdH%(HD$1eHT$LHD$HT$dH+%(uH]A\M@ATIUHHQHdH%(HD$1t/HT$LHD$HT$dH+%(uH]A\H M 89r~f1L H5,41hAMALL=lIff.AUIATIHUHHdH%(HD$1H$uEZuXLLu (fDHHH$HtԋP LLfv HT$dH+%(u1H]A\A]@HHŰ1H9HDHH$HAUIATIUHSHHYXdH%(HD$1H$H r:H4ID$HID$ HT$dH+%(ulH[]A\A]fHtHEPH H8sHHtH$LLHs fDHAPHHH8 uH]X`Gff.AUIATIUHHSLHdH%(HD$HAXH0rjH%rH-s<7HILLHH$?HT$dH+%(u\H[]A\A]@H3ID$HID$ HHH9SHB^nwFff.AUIATUHSHHHHt0uoHHCP1HH8?IHtoH8 HHtZHHtu8HHLLH[]A\A]H@HPXfDH@H@XfD1L H50H1[]A\A]AUIATI1USHHHHt8ueHCP1LH8THHtlL7 HHtWH1Ht0u3H HL5H[]A\A]DH@HP`fDH@HH`fD1L* H5+/H1[]A\A]f.DHH\Hq@HH s\H9u<@HH9t0H;puHCH51 AuBmHH H50AtH5<HfH5$Hf.HA`H׃Au8HHHHDH z0HHDHG HWHHuHH[H5NHDHAHD萼HfDHA`H׃Au8HHHHDH /HHDHG HWHHHHH5HDHHDHfDHA`H׃Au8HH~HHEH Z/HHEHG HWHHUHH;H5.HEH!HEpHfDHHAHHAH91fDHPHHHH9uEu;HHHEH5.HHEغHfDHHhHEH5UHPHE蝺HH9H5 .EtH5@HA`H%Au6HHHHDH -HǾHDHG HWÐHHHHH5HDHHDHfDHHHAXAH rĀtz%u9HHWH`HDH53-HaHD腹HHHH'HDH5HHDLHfH5,HtH5DHAXHHAu4HHHDH ,HHDHG HWHHHlH5_HDHRHD衸HHAXH%@Au6HHH%HDH +HDHDHG HWÐHHHHۿH5οHDHHDHfDHAXH%Au6HHHHDH h+HHDHG HWÐHHeHHKH5>HDH1HD耷HfDHAH׃yHtTHHBHHW H9unHG@( tdL1ɺ 1H5V@HQPRu>HHHEH5q*HHEöHfHWH`HDH5?H6HD腶HHAHBH.HB HHAH׃yHtTHŽHBHHW H9umHG@( tcL1ɺ 1H5T?HQPRu?HHoHEH5R)HHE褵Hf.H7H@HDH5HHDeHH@HBHHB HHHAQuSu/HHɼHGHW H9ttHf.H @HGHHG HËQuqHpHYHEH5<(H;HE莴H@HG@( tL/1ɺ 1H5TS[HHHDH5׻HλHDHHHAQuSu/HHHGHW H9ttHf.H>HGHvHG HËQ(uqHPH9HEH5'HHEnH@HG@( tL1ɺ 1H54R[HϺHغHDH5HHDHHHAQuSu/HhHHGHW H9ttHf.H=HGHVHG HËQ,uqH0HHEH5%HHENH@HG@( tL1ɺ 1H5ϯQ[HHHDH5HHDݱHHHAQuSu/HHHiHGHW H9ttHf.H<HGH6HG HËQuqHHHEH5$HHE.H@HG@( tLϯ1ɺ 1H5O[HHHDH5wHnHD轰HHAHHPHAuTu0HH:HGHW H9HHy;HGHHG HËHȷHѷHEH5.[H#HEH@HHHH9CHAHP&fDHG@( ILc1ɺ 1H5CN"H6HHDH5 HHDTHf.HHQHHRXH%s yHH0s xHAu"HHHGHW H9t'ÐH :HGHHG @HG@( tH1Li1ɺ H5KMHfDHAPH̼Lp8@" fH@PLH@ ff.@HHH#AXAu9HHHHDH !HRHDHG HW@HHHHsH5fHDHYHD設Hff.HAXH׃Au8HHH'HEH HHEHG HWHHHH۴H5δHEHHEHfDAHHHt*t$HH BuBHOHW @HaH H H5KtH薬H@H5+ff.@HAHH@H)rzH*r#HHGH HG HXAukHҳHHDH5GHHDHfDHH@HHH9?HAH@XfHWH`HEH5=H8HE腫Hff.HAHH@H)rzH*r#HHGH HG HYAukHҲHHDH5GHHDHfDHH@HHH9>HAH@XfHWH`HEH5=H8HE腪Hff.HAHH@H)rzH*r#HHGH HG HZAukHұHHDH5GHHDHfDHH@HHH9=HAH@XfHWH`HEH5=H8HE腩Hff.HAHH@H)rzH*r#HHGH HG H[AukHҰHHDH5GHHDHfDHH@HHH9H1[]A\A]fD1fDHHLlL!L`aظѸʸø@ATAUH- SHHQHRX u+QAH-"f.H?L HDArcHUL@IHDHLHLHHL)H)Dr1L 9M 89rHCHC []A\AtMtLfLH HH?HMII HHDLH H+1LVH5ݛ"=[1]A\y$A$H ͬMIIHHEHf.MLLff.AUATUHSHHA`AL-H}L Ht-LLH(HCHC H[]A\A]1LbVH5<H1[]A\A]fD1fDHHLlLL`aظѸʸø@AUATIUSHHHAH@H)9H*rRH AHCHC HC@( t"L 1ɺ 1H51;HD[]A\A]D\Aw}EH-HWAHDI<$L HDAANtMMHCAHC HD[]A\A]A H-AtL1ɺ[1H5/A& H-Xf.HH@HHH9u/HAH@fV1E1LBH59HUHxHHJT-JT(HH)H)D1ɉ΃LD5L79rAH-fDMLLLfLUHSLHHHt4ot+HH5u4H H[]HH5 tH5H5UHSLHj8tNHAPHHt u5HFHH5 zH[]fDu/HHHEHU H9tLU HDAAHCHC HT$dH+%(H[]A\A]A^0AL%tHstHAL%&XHEXH AH)A L%1AI>L%~Lx H#1L VH5e/1#I$HxHHKT,JT(HH)I)D1ɉ΃M4L79r@AL%~fDtyAH6HAPAL%H8B DA $[ALfLKAL%aH%AHuUHQPAL%B8A L%B0AL% ^fDHHCHC HC@( t"L1ɺ 1H5Ȍ .AL%- +fDA $ALL?@HH]UH<$AL%yHHuHAPHP0A fDHHBH&HB @yHHuHAPHP @ fDHHBHHB @yHHuHAPHP(@ fDHHBHHB @yHHuHAPHP8F@ fDHGHBHfHB @yHHuHAPHP@@ fDHHBH&HB @yHHuHAPHPH? fDHHBHHB @yHHuHAPHPP? fDHHBHHB @yHHuHAPHPF? fDHGHBHfHB @yHHuHAPHP? fDHHBH&HB @yHHuHAPHP> fDHHBHHB @yHHuHAPH> HHBHHB @HAHH@H)r:H*s,X@ H7HFHVHF @HH@HHH9HAH@DHAHH@H)r:H*s<? HHFH֒HF @HH@HHH9IHAH@DHAHH@H)r:H*s@X? H7HFHVHF @HH@HHH9HAH@DHAHH@H)r:H*sD> HHFH֑HF @HH@HHH9]HAH@DHAHH@H)r:H*sHX> H7HFHVHF @HH@HHH9HAH@DHAHH@H)r:H*sL= HHFH֐HF @HH@HHH9qHAH@DHAHH@H)r:H*sPX= H7HFHVHF @HH@HHH9HAH@DHAHH@H)r:H*sT< HHFH֏HF @HH@HHH9HAH@DHAHH@H)r:H*s8X< H7HFHVHF @HH@HHH9HAH@DHH5|Hff.@AW1AVAUATUSH(_L;^LuvN8II9O8uhtsLL@1I=DIHǃ?u9HMDAwPHOI9Hu"Ap;wuHL9t!A<tf1H([]A\A]A^A_III1HL$IHD$HT$H9fHH9D$uH;l$ HD$1HH9u19uHL$H9L$tTHD$L`HD$H9YI@MmL9CIuL uHD$HHD$H9D$uAF$AG$AFPAGPtZH[I1HHH9t6<uILDH|HDOEHLHIxLH9uH([]A\A]A^A_H;l$1fDHH5< Hff.@AWAVAUATUHSHH5HHhdH%(HD$X1HT$/Ld$ L-ݓ11fLL)D$0)D$ )D$@H\$8#fH)D$0)D$ H\$8)D$@1LLv#Ht7H@ Ht.8GMLd11H5U"HEL 7 HPHHCHtLHLR5@L-1LL"HLHG D$ IHL=f11LL)D$0)D$ )D$@H\$8"fH11LL)D$0)D$ H\$8)D$@f"Ht7H@ Ht.8MLc11H5T!HEL ' HPHHCHtLHLlRH@AL1/H5̑YHD$XdH+%( HhD[]A\A]A^A_HEL HPHHCHtLHLREH5a1E1ZYDHEL M HPHHCHtLHLRBDLhA}1 LLH1H\$8 HuRD$ DHEL HPHHCHtLHLBR>+f.HEL HPHHCHtLHLR;f.LxHEA?H$H$LL`PLHLpMLLƅH LhMD$LmXLLupETmILAauIMXH}D$ HOXuJIHExIHUxIAHIHIHEHM0IMXI@u}HgXH$HSHHHH% HtHQMLPKf.H$HSHHHH HtHQMLڛPOKLmhl } fUfH1SH6lHHHdH%(HD$81H)D$H|$1)$)D$ VHtAH@ Ht8u2AHtH@EHD$8dH+%(uLHHD[]fDHCL HtLLf1@H5iE1ff.@AT1UHH51OSWTHHHCXH5&HHPH1AąHCpHPHC3t4H5H1sAąAD[]A\f.H5`H1?AąuLt 1ɺ]1H5DALI 11ɺYH5ό\D[]A\@1L 1ɺZH5/D[]A\L 1ɺ_1H5r(f.ATUHH5SHHHHPH1VHH5H16AąH5H1AąHHt HPHH5dH1AąHCXHt HPHH5DH1AąHChHt HPHH5)H1AąA[]DA\DL 1ɺ1H5OD[]A\AL 11ɺH5OD[]A\@LT 1ɺ1H5_OgDL, 1ɺ1H57O?sf.L 1ɺ1H5OCf.L 1ɺ1H5Nf.AUHATUSHLHdH%(HD$1HHl$@Ll$H H$Pt2AHD$dH+%(pHD[]A\A]@ukHHUHPIUIU@Ht H;HH9HuWA뛐AL 11uH5_qAYHMHtM1HtFH9Hx}fH*HxOfH*^YE,tz=D‰AAHЃfHH H*XDHȃfHH H*Xnf.댸Mff.fATUSH D%dH%(HD$1Et/D%}HHEtFD%gHtXEHD$dH+%(H D[]A\fHLL$LD$H5d  8&uHL$HT$Ht$ H="7 t<$AHtH1E3'jD%_D%tEHL$HT$Ht$ H=$AD%"uD$ b tULE1ɺ1H5pfDL 1H5 |$L 1H5 D ff.AVAUATUH(D%jdH%(HD$1Et'D%t$HD$dH+%(H(D]A\A]A^ÐLt$Ll$Hl$ LLHH=DRAąu D%fD%Et$LLHE1H=T A@Ly 1H5 DHGHIHWpHp0HGH@PH8]f.HGIHWHHp0HBPH8]ff.HGHWpA Hp0HGH@PH8p DHGHWpA 1Hp0HGH@PH8p HGHWA Hp0HBPH8ip fHGHWA 1Hp0HBPH8X1Z*L ;]tCL t7L t+Ln1H5qAL ,1L|1HHCE1HHH9tHAH9u1H1-Lt|L11H/L\|H0HL ZLEL?|11}HH1[L031]Zf.ATIUHSHH@dH%(HD$81LtHW8H5YHf11HH2)D$)$H\$)D$ P HtKLH MtBEP1HsuLEPHD$8dH+%(H@LHE1[L]A\f fDHEL HPHHCHtLHLRU1H5yLXZHD$8dH+%(uEH@1[]A\HEL HPHHCHtLHLROPAWIH5:AVAUATUSHHHLHPH1LHH5:LH@HPH1$AąHH5YyL1Aą&sTHP:L1HAąDAAHYAtAH H HDH5yL1AąDAALHI91L-yA~uLAW(AąLL1Aą|AG0fo fAnG0f89fA~G0AF/IFH5EyLHPH1Aą5AG0PAW0xH5~{L1Aą$M6I98A)L 1ɺ1H5;HD[]A\A]A^A_DALa 11H5l;tfLمH5F;1E1IL 1ɺ1H5;kf.GAVH5xL1AąL 1ɺ1H5:IF@\LHH1E1LuH5z:fLL 1ɺ1H5W:_f.Lf.1҃H5wL1AąDL 1ɺ1H597L 1ɺ1H591E1LH59@LkH5HnAG0YL, 1ɺ1H579?f.H5vL1Aą>L 1ɺ1H58?L 1ɺ1H58L 1ɺ1H58Ln 1ɺ1H5y8ff.ATIHSUHH5{uHOLHHEA|$Lv!At$81HSHHQHU(tHLHH"u]A\ fDL 1ɺyH5H1]A\L| 1ɺbH5+sH1]A\LL 1ɺfH5raff.@AUATULSHA@LLl$0LT$8ItALҾLAX8?HX8DELHLH[L]1A\A]CIpLHFPLNHLփLvuLw 1ɺH5&r6f.I@LH5qLHH1TH1[]A\A]L 1ɺXH51P1L 1ɺH5qH1[]A\A]fAWAVAUATUHSHH5ݝHHdH%(HD$x1Ld$8HD$0LD$(D$$UL}Ll$8IPLfHLpMLH5gHAŅ LmLd$8I}PL`fHHpHH2AAŅLH?AŅqHH5H AŅ(HUTH5H= AŅrLd$@L-11fLL)D$P)D$@H\$X)D$`HvHt$0HPHf.L 1ɺ1H5%$f.L| 1ɺ1H5%DAWHAVMAUATUHSHLH(HT$L|$`Ll$hdH%(HD$1HL$At8HIAHD$dH+%(4H(D[]A\A]A^A_MIHHH9IFrT1HHDHHHIH9H1HtRL9H]fH*MkfI*^Y,r=D‰MefAL 11rH5$ HH}H,L jDH}HD$HD$ ,L $H0DMI~HXZ;LT$1H5_#I1{ARL)USHL$ L!^_HAIEDHЃfHH H*XfLLfHH H*X})ff.@AWAVAUATIUHSH(D =ldH%(HD$1E\MtM  lt7!A$kHT$dH+%(H([]A\A]A^A_H賵 HtnHh HteL-L5!DL}A?HmHt9}tL ̜1ɺ1L$sL迿HmHufDDkHLH-zL5o!WfHI9KtuU1ɺL31L ZLV71Y^j뱐HL$LL$ jLD$H5jH%L5 LfD9D$w u(D$9w C OjHL9&CDHs L61ɿL1L m_AXHH5HsL$u HI9u8DHօtZf.1ff.fAWAVAUATUSHH-dH%(HD$81L$XIHHt$4ILL7LMGDt$4AusTaFV1LLIHH1LHpHD$HHCHPhHHPHuH91WcHD$D[T1DD$HHD$ATA oHEٹ=h L7H5B1AYAZLF 1ɺGf.L, 1ɺH591E1iH5Pq`1ɺU1譴 LS HHǀbf.Až LA HDHlLPL 1LSIG^_HHH9Aw1 L 1ɺH5}L 1ɺP[DLt 1ɺKH5E LL 1ɺH5% L 1ɺH5_L 1ɺSL 1LAźqLů 1ɺ1Lܲ2ff.fAWAVAUATUSLH(IEHT$Lt$`dH%(HD$1H*IM^HLHHHaEUEu8H{hHC@[t#HHtHPBfI>}LoLLAHT$h LH$HLHDH&HHHH9ǸHDbHCHHH9s78@H|$Ht$H"D$@r]HLHpHHd LHH#I>}LgbLLAD$4LPu7ML$L+g1H5OADŽ$AHD$dH+%(H(D[]A\A]A^A_@HIH=I1LOH5 DL 1ɺHH51E1qHH- 1EhHLeYL ^1ɺH1{LHHLe19DT$H5N[DT$I@-LdLHHH51$E1@L 1ɺH5 (H2LcLHHfD$L 11MH5諮DT$'Ll 1ɺH5= gHIHI1LdH5 lL 1ɺ^#fD@LOHRLcfDL 1ɺ H5 fDL 1ɺ1H5h eHYLcLHHHf.USHH\$ HH8!HHxHHHHǀH1H)HB HD$(HBHB(HB(HHB0HHHHBHHHH[]@H-` L1H H11LM CH1[]9 ff.HUSHH?tZH5tO+0tUH5KH~AEt+1tLH5LH]AEt 2t;H[]CuH[]f{t{t뽸fATIIHSHHEAt$ T$(Eɋ\$0DɃDEɅtDAɄDEDʋL$8t$@Dd$PDEDʃDDDʃ H5GDEDʃ@ED'DE1HpAAu6AHH5HDH?L%EHDH5FIDASQLt$XP% H IHtuHL[A\fH8CHHtClvm2_fC7H@H2HH JuI\$HL[A\1L`H553HL[A\HGH@\AVAUATUSW HLpHHLйHLhLqIHLLH_LjHH~H5SIHoHtH}_:HE tH":H5:fDD$ A$bfHt7HE1H<-tA.McABHuA tJuV1Ht1LZH5|C耣1HfHD1LZH58C<1HDATUH(HIHtH(HHt HL]A\Ð1ɺE1L H5B΢@LV1H5B褢fHGXHtHtH$sBE1H"rH!rHt61HL$HT$HH5S|$Eo AHl$pL-AAHH54?LH?UL }AULVLEH5a$1XZI|$XЮHxID$XHADŽ$fL\ 1ɺuH5| qLE1Vb>L, 1ɺH5L AL 1ɺr1H5' |$%H-,QMLWU1H5^#LU1ɺ1H5 誝ILNUH5#ff.@AWAVAUATIUHHSHHdH%(HD$8H^=HBHBHD$HBHD$HH=HD$ HBHD$(XILHHZLƙ HHjE1E11j1jjH HHfHx`转H=<aHE`HoH謈AŅLL=} LTLI1OHEP@AHP L4HII9`H)1LH議D$H\$IA$L+LLHHG:H4HKHx 1HL$_HL$HH A $H1ɺMPL;1LHhXZ|$t_D$UfL 1ɺH5A 1E1,HD$8dH+%(HHD[]A\A]A^A_fDAH^L 1ɺ1H5ߘ ϚDH1RH58 LRA^_M1LhS1ɺLE1qD$HHDH^LRH5A_0腯gAŅL 1ɺ1H5 ff.@AWIAVMAUIATIUSHHHdH%(HD$811HjLE1P1AQ$ PD$lH HMH"$AMA<$EuMtAEAHA $LsIFAN IvHD$H@PHt$DHD$1IFA~$)HD$ILXXI'rAH_MIAAqHEHuHHgLxHP H;uHpLhHH9ts ELHuMtMC A)MKIF@Y@HD$LHx(iHD$H@ H@@Ht LЅHCHxM1ɺ PHD$L.Qp(L% 1L蕗XZ8HUPLHr0HT$HT$A$L%_ L% 1ɺ1LA6H[HD$8dH+%(HHD[]A\A]A^A_I9H9fDHu1E1E1zfDA4$HUPAEHt[BtUz0Hz0H}HH}HLO1H5L 1ɺk1H5? E1,I@AFL+FAF(HD$HH54LFH5v2L/HD$H5ȓ H8賧HD$HtL% LZ 1ɺLsfDEf.HD$H@ ?H*H$PH%UCAHr(LH@HH  bzZf.AdA`IH@LL 1ɺb1H5o E1\)E1H;HSL(CAH;HSL蠺CAH;HSLwCAHCHxH\$H1LLLK(PH;HSL蠿CA@H;HSLg]CAL%L L 1ɺL+L%% L 1ɺLL{IvH;L| IvH;MLL_W7CAL3 LuIHfHHLHHL@LH52@1M1H52LLmLLL 1ɺ+L%# 1LL% LΎ 1ɺLLcACL%ˏ L 1ɺL誑LL;f)D$ L\IHLfLt$ HHHMH51LH@1ўM1H51L#KPLLL 1ɺ/L% LǍ 1ɺ!LL 1ɺ%H5ǎ 輐L 1ɺ1H51Ž^L% LU 1ɺ'Lnĥ1|$ -t 11L/ID$ALcCL 1ɺ1H50BE1DHHAA1dH%(HD$81Hj1jjAPE1H Ht=HS$uHT$8dH+%(uCHHfT$11LJ 1ɺH5o _1趤fD9tHH1H9H5 萜t9HD i9A~H1jLHH5Č 蹎X1=/9ZfAWAVEAUATUHSHĀL$H|$ L$L$DD$L$LHL|$dH%(HT$p1EIHEH51 1HT$HӺUILL$LHjAVDL$(H A$-HL|$ ؞H H5"LpHtsLuZ1ҹEHL貣HuD$dHLLLjjD$$PDL$(LD$ HL$0~H A$uH3HHuH|$u`AHD$hdH+%(HxD[]A\A]A^A_@D$Lȉ 1ɺH5 1یDL$@HH}LLjjD$$PDL$(LD$ HL$0H iD$La 1ɺD1ɺD$L< H5h ]DL$)计f.@HuAH@Hto"oj'o@HoB oJ0HH8HtooZ_ff.ATIISHHBH@PHBHP LR8MtTH_1@u8HL_LgSA@$)LHLPVH7AH H[A\APL+PAP(fHHtLI fDLH(1LNh H5 1ff.AUIATIHHUJHt58HuIHL螤L]A\A]DLHIL| 1ɺ(1H5 E1茊f.AUIHHATUHSHŝIHte8u(HI]Me0HCt0HL[]A\A]HLLHHLcHuHE1[L]A\A]DLĆ 1ɺ(1H5 ׉DAWAVAUATIULSIHHHT$H$H$Ht$HHL$L$HT$ DD$,HD$8dH%(H$1MD$LHD$XHD$PHDFHT$LT$HD\$,Iſ EHt$`jHE1jMLjjHD$PH HDL$`EMtD$tAHD$0D$(HD$LxMMHL$ D$(MI~M~Mv Ht!HHH9LHCH\$MtHtHt$H|$襝H|$tIE H@@HtЅtIE H@PHtHT$PHt$LIL$MRI|$HT$`RI$LD$ _AX(t$(D$L0HL$ Ht$PH|$Xu =t_ tYtM1HtFH9ffH*H*^Y ,ȅDDHD$ @HHHH9HHHHHH9H8LdIH- 1H蔆E1@D )Eu<"(HT$LT$詏HT$LT$ 8D )fDL$(HD$ $ I|$H- L{HIE1хAH|$0DL$IDL$D$,uGH$dH+%(HĨD[]A\A]A^A_HD$ 0rMDDL$DL$tHD$81ɺRHL 1E1bHXL_bIEH- 1ɺ1L HDL$迄DL$D1ɺ,D$H- Le H芄DL$LL 1ɺ1H5o _E1L 12H5 ,DL$H-! L 1ɺHE1AH- 1ɺB1L HԃE1 fAUIATUHSHHO u6HGH5fL`LߘH5TLȘH;0H:fH@(@@IUXHH%sPHLhHHH {@HH(H HHH[]A\A]H0IIH9HHaH@HHHHPH°HX(H9tHc@ WLH` 1ATI1L_H5& XZH[]A\A]@L`f 1H5 ܁H1[]A\A]L_} DUSHxdH%(HD$huHu4ǃHT$hdH+%(Hx[]f.1Ҿ\uŋt;Hl$PHt%1HL$HT$HLD$ H55zt51L,_1ɺH5~ ԀǃK|$t v‹7|$wff.AWIAVIAUEATE1USDHHHT$AAAG\ EtYA ItAG\tTIFuADDED DEH[]DA\A]A^A_H|$tPAfAuAIIH9ԢHZPfDLtIGXH%r@uIH1AD EDEff.AWAVAUATUSHHHjt$ HdH%(H$1HD$0H9+LHEP1L$0sL(L1D$,HLeAH$0H8~HL E^IWPIwHL6 IHM Mt!IHt0LhIDž L=L| M11Lt L&~D[EI11L HL$p@ljD$HHL$HDT$HL$I1I?H<HHuDktSB8苏A<$HPHPHJPML  L1X}H MLj\L1 1}AH$dH+%(HD[]A\A]A^A_@HEPHUHH>1L膆IHH cHیLHD$ΌHT$LLTLLT$dIHHT$1HوHt$1ML rH LHryLr1&H5&|fDHh LZIH5z 1{E1fD蘈KHT$,LLiD$,HT$01LLD$,HL0dA…[|$0xDcEu H{ tC$Lt$@f1Ht$PLLDT$D$H$0HD$`[ HD$PHqHD$X)$)$)$)$)$)$)$)$ (X DT$HHgL$DT$L=Ht.1HL$8HT$4LLD$ LILgY1xDT$ D$ Lxu 1L$ 1xDT$ ]D\$0HHLSILX9 1LxY^DT$ DT$ H-zH Ȍ8IA<$MLIH HEH vHAPL QP1w|$,H 萄A…A}謉A<$ML HDH PHPS@L LOVIcLL$PL11 L>wfL@m1H5 wL$0LQV1ɺ+ DLn1!H5vD;d$4; L肊HtHL/V1LD$ PHlSATP1AUL$OvH0LCc虋Ԋ8A<$MLIHwARHH IAPHDQL  P1uH RPHPHJfDAWAVAUIՉATUH-kSHHDO(Ht$dH%(H$1HHDEHGLGIIH9IEPfH|$`L)D$`oHhoPx)D$pHDŽ$)L$@)T$PHHt$@Lyi Lq 1ɺ IHIEPIWHHH;Hu~HHt}HH{E1E1j1LjHD$(PH ODD$EuuAH$dH+%(HĘD[]A\A]A^A_L7L q 1ɺ H51r 1tE1f.E1E11HLHjL$,T$(E1H|$DHwMHK(DLAT UH-q I1HLTsHsXLZLHG,gD$L

D$H%= M1L=$hLSLqHt$H/AąD$H%-`;t$ L=gt1ɿ1L *}LgLqHt誅8_H11AUL |LLgpXHZ趼 HL[|S11A蔼 ,fMLQH5 g1E1vpH$XdH+%(HhD[]A\A]A^A_f.MLQf.L lLZR1H5fozMLLY 1ɺ1H5Z \[1]A\A]A^fLY 1ɺXH5} LY 1ɺATIHUHSHI<$HHoLXY 1ɺ{ HtoIHCPLKHHLC[@tVH^t"11LHKt[]A\DLX 1ɺ 1H5Z [[1]A\HAWIAVAUATEUHSHHLHt$LD$dH%(H$1HEL9wI L5QHD$(fH|$`DLI)D$`)D$pHD$IGPHDŽ$oHhoPx)L$@)T$PH;LHt$@O LW 1ɺ, HNHD$ HD$LH;HPHIGPHd1L\$ LW H/ MDE E1LLHL\$0HD$8 HLLfD$ HAAD$(PIGPt$(HP`E H PHT$PHt$XH|$0H 1ɺ7 HLV HpK(LL%X VH: LAVI1L?YXZHT$(HH`AH$dH+%(HĘD[]A\A]A^A_fDIGPMOHHHt$(HLvAƅHt$H;1lHHtt1EuI 1H<AƅQLU 1ɺK 1H5W X1L9I0L5HD$(TLU 1ɺF fH5V 1E1XDL\U 1ɺC 1H5V oXf.L,U 1ɺ:1H5 E1kLU 11= LX_tmP{U{f.AWAVIAUIATUHSHH$LD$dH%(H$BpD$XG(H?D$D_HHH$I9F(L%*HCHD$IHH<$AW ATI1LXOH5UU EWHD$ZYH@XH2H-H|$H}H$HL$HPHH@PH`IH HT$H4$H}9jIHm A<$IEuBHxxtKAH$dH+%(HĨD[]A\A]A^A_fLLէHuDKANHEF HT$H4$H<$AVE1DLHGPDT$H@`% H HT$AD\$yH|$D\$DT$A E11HLLLARSAS褪HD$@H HHL$ AHWHEAHCH$EH@XH2sE(H4H4$LLM9uvM$$M9t^ID$HPB^tE1ILLHdt$ID$ILLAHHP@uLQ 1ɺDH$H@XH-VH$D$lH|$.H$LHHD$8L9Ht$HwVH'D$HHDHEHT$0HD$(DI|$LMMDI_HC H@H LLI|$HD$HL<t$0e H5"R t$@P1LL$8 THC H H@XHtIWLHJP1H9Ѕ@ M$MLH]LHHgHH88xLHD$HHt$HHHD$QmHD$HaLL< IH5VQ 1DSEED H}1LLH* E1LLLH IIH9ttLd$IHID$Hx"H}LHID$HP:Ht0ID$HxLLHIID$HP8 M$$L9uLd$LL; IH5ZP 1HRI$HtE1LLH*" I$HtE1LLHb I$HQEVEI$huA|$LE1f.ID$H@tbu[I$HtNHTHtDI$HHDH@XHttE1LLHN fDAE;|$LQDH@I$HH؃8bHxHHWXHt BM(tID$H@ 2E1@HLLHL}M 1ɺ 1H5N PL\M 1ɺu[DH$H}1LHH$H@XH-&H $HH9HHH9sHE1LLHHPADž H$HH9?sHE1LLHADžLL 1ɺ 1H5M OL=WQMH$LM1LIH; IGH@7 H4$H}H6 ! IeIIYHLy5ATI H5L 1NAYAZH$H}1HPHH@PHbXIHvH$@\ #H<$H<$HD$H$Ht @\dH|$|H $HAXH%|HHH9qHWH$H\LHLIHADžH$Ht$ HH)ADžLJ 1ɺp1H5K MH $HLL94qHH$H4$HHH9pHHHfDLI 1ɺH5!K 1E1 MRKII$H|fDu(I|$ L6IH5J 1LID$IT$H@P1BtAD$L+BAD$(AT$$H|$ )H H,AD$8AD$Lt$M$$9CƉD$L;d$8H|$H$H@XH%Hs&H$Ht$ HH^ADž-HCXHH0 u6H$H5LxHL@Zu_L_H{D$X1ۃpHL$ U,tFH$@Y tM 1L(H5f lLp< 1ɺ 1H5= ?LO< 1ɺ[NH|$HH}1LϴHH$HPXXL< 1ɺn1H5(= ?^IWp1ɺAL; H5< >.H<$* L%IL; 1ɺc1H5< >D$jI\$PH|$ HLHD$ Dx@hEu ǀǃI荸H<$I聸HL%AWIL: 1ɺf1H5< =7L: 1ɺO1H5; =L: 1ɺ1H5; =H<$HH$HH9`DL<$LHXIWXqL: 1ɺ 1H5 `jH$H}1LH薲IHdLHLHIADžHL9 1ɺ1H5: <L9 1ɺ1H5:  IH5 1:LW7 11 H5z8 j:@L譴L IH5 16:L7 11 H5%8 :L6 1ɺ1H57 9H|$ L蘤H11L6 :H5o fLy6 11 H57 9bLS6 1ɺH5s7 h98H<$誳L~! IH5E7 139L5 1ɺYL5 1ɺS1H57 8EL5 1ɺ1H56 8L5 1ɺH56 8 NLw5 1ɺ H56 8TLS5 1ɺ 1H5v6 f8.L該L IH5 148L5 11 H5#6 8H<$UL IH57 17L4 11 H55 7f.AWAVAUATUSHH $HH|$0LE@IHt$(L$H/HL$8LH H|$(LLT$蔅LT$H1ҹALLT$@L$LLD$"JLD$LT$@HuƄ$IUPLLT$@HHT$HT$LT$@HImHHt AF\LLT$LHD$ۭHH51 HT$I1L( R Z3Y^LT$H|$8LT$VHL$8Ht$(E1LH|$0(LT$L/ 1ɺ' H5 1 2H|$tDGH 8D$MH4IH~H50 HDHJ E1APL SP12H _H|0 LB/ 1ɺ HD$Hƿ1T2LT$H1LL$  LH5'0 2H|$(AXAYAPLpXGHt$(H|$01LLT$zL. 1ɺ% GAWIAVAUATIUHSHHHRHH?dH%(HD$x1ID$PH;IHDu(EH}HLDIHH}H HL@ML$ULALP։T$ lT$ H<$L蚴HHH@HHHPfH@)D$HMLP)D$XH5. HL$`1)D$hD$HP1Rt AVk0H Dl$@HGAT$t9AL$x+E$Ht$HE1E1Q11R1j6H D\$EAD$xHEL$tL PH5- 1/AYAZCHEHGbML'11l H5- A/fDHD$xdH+%(>HĈD[]A\A]A^A_HLE1E1j1LjHD$XP菠H AŅDl$@HDD$@EuAE1E11HLHZL$\T$XE1IwDL?H6L$@tU(L-HLHLAVI SHz, 1AUHh.HEH LHGHG!AŅD$@+AD$Y Ml$H_LBHH5Lx<LD$@1LLH+AŅL* 1ɺ 1H5+ -*f.Ll* 1ɺw 1H5+ -f.L<* 1ɺd 1H5_+ O-f.L * 1ɺg 1H5/+ E1-Dl$\A9\$XLL$ $?AUE1SL$I1LH5* QT$R ,H /Ho.IfHE1D$dH5z* LH PDL$h1[,^_@L) 1ɺ 1H޿3,AfAWAVIAUIATIUSHX $dH%(HD$HHBX t ,H-:$1LLLADžH LLL'H LLLADžKAF EEIIH9uHmH9HEHxvLLHHEHP`ADžuL' 1ɺ 1H5( *H  LLLSAE\ALLLLHADžL`' 1ɺ 1H5( s*"fDIEXH%@H03H4XIIH9u@HH94HCHPB^t1LL9t9HCLLHPtL!LLLHuL& 1ɺ@ GfII9IIH9.MH1LLHP=ADžIH9MH1LLADžrAD$EEN EuJEF(EuAL9I>LLH؝HHtLL%ADž IEXfDH4sIIH9~fAt8IIH9t%HU1LLAADž HmH9uAF tAE[4f.A~,E~(EutIIH9u_HH9tPHCHxG^tAF(-I>LHHCHPǜHLHAF(H9ufDIIHD$H9iHHt#1LLHADžHHt1LL$ADžHHt1LLADžQHhHt0HC@t&E^ LLEE $ADžHHt0HC@ t&EV LLEE $ADžHHt%Av LE $LWADžDKLE1Euf;HCH@tCuLLH[HH$E^$f)D$)D$ D$D$)D$0EtIIH9EHH9IHL$L ADž1L 1ɺ 1H5 !_Lt 1ɺ 1H5 !6LN 1ɺ 1H5q a!L( 1ɺ, 1H5K ;!L 1ɺF 1H5% !L 1ɺS 1H5  L 1ɺ| 1H5  xL 1ɺp 1H5  RLj 1ɺm 1H5 } ,LD 1ɺj 1H5g W LL觜ADžL 1ɺ 1H5+  L 1ɺw 1H5 L 1ɺs 1H5 ~L 1ɺ 1H5 XLp 1ɺ5 1H5 24fAWAVAUIATIUHSH8dH%(HD$(1L|$pL\$xD$$Hz:HAHt3Et.HD$$L1HP$LPASAWH @1L 1ɺrH5 1HT$(dH+%(H8[]A\A]A^A_f.HD$$1HD$P$PASL\$(AWLL$(DD$$蓔H DD$LL$L\$T$$\I|$L\$LL$DD$ӎDD$LL$L\$t$$L1HSLPASL\$(AWLL$(DD$$ H u4D$$DD$LL$L\$AfDAD2AVI@AUAATUSHH=#H8HH!%IHtIfHX@(H(Lp0Dh,H@@a[L]A\A]A^fL 1ɺ1H5 H7$DL 1ɺ1H5 E1f.AWAVAUIATUSHDD$dH%(H$HFH@PH8H|$ HD$D9D$(IHH@L4ILIOAHzCIHCJt0H5I}1"/HHI1HBL0HL$躋JII}1Jt0.HHI1HBL0HL$s1ɺZ AL H54 )z@HrHIG@ I}1Z.HH I1HBL0HL$I9\$L$(tHIH#GXbAfDHBHtH@HtH@@Ht HH9HD$ Mgx"HI#D$XID$PH5xSD$,IEL@LLD$n/H|$H55D$Y/DT$Et LD$2HED$8HD$0IG@cAG$I$D$L1H5T A>&@AWAVIAUIATIULSH8|$L$p=`wL$L$H !LI!LH H<$HD$ HHD$ HL$HD$ IDEHD$H|$HL$t$ 6_tT$fH|$ H|$IHT$HX@D$LAWAGY LHHPHT$%)I_HT$LH1 LHLpL(I_ LL LHLhL(L4$I_(LLLHL`L(I_0HLHHHP(T$H@^I_8H= THTIHTIGL8L=SH8[]A\A]A^A_D$L$L|$D$pH8[]A\A]A^A_*f.] ]L=SHSHD$II9unfDHIH;\$WHIw(L($uIw L$uAGH I]IL,IGHBHH (] (]H-L1H9H11L H81[]A\A]A^A_|$D$$tH}RHvRHD$L;H9uT@ILL;|$?IHs(H#uHs L#űCH 2\HH߃,HCHBHxfD $HQHQHD$HH9uHHH;T$Hƒ{uHs(LHT$(u"HT$(uHs L`"HT$(uHHCH߃-[HBHU耙SHGPH1HWHHHHxKHt>HSPIHHKHL N1HHHpP1ZY[D1L" 1ɺ?H5G 7 1[AULATUH-SHHdH%(HD$1 =7Ht$D$ .7L-UPPH-IPH]L9t`L%IZfEHLM8LE0HM(HU Hu}P|EHUHA,HEHHBHZXHZL9uYHD$dH+%(u0H[]A\A]L 1ɺ1H 0Q AWIAVAUIATAUHHSHxdH%(HD$h1 Hw IAEH5 APLHHDDHRPHL кQ1f XZAG] tII91AIIE AD$E$HEDAAH9-HRBtAuAM $~H $HHOH?HABLHHHUABDAA DHCl5AE1҅H}LL 1ɺvIHHCHD$At7AAAAHCMǀH|$$LʂAŅAHCH{4考H{wH;HD$hdH+%( HxD[]A\A]A^A_fIGXH$H%DfDL萴HD$EH|$1ɺ$L,AŅ]H}AB!$Lk`E1L% DMM6M9MIFHDHLH}HL$XHT$PLD$`EHEp>vHT$P:tHD$`8uHEHMMHpPHL$h_AXMdLs`M9`4$ALXLi1ɺIH5 1D=#EJEm1ELDHC`E1H$MMmL9,$M}IEHpD`LxE2L%9MH}HL$XHT$PLLD$` HD$`8tMtLLsL;LxHELHG HKLLHIHELHGHGL 1ɺ0H5 Lu 1ɺH5 1E1LE1LIYIH5` 1NfML`MMzLk`L9,$zHEHGH9G,DSEHC0HELGHGLI9Lt$L-S"f.HEM$$HGI9ML$1M8H5s cM|$Lv1LLHfuL 1ɺ:H5. #ufDAAELBb LDLLHHAŅ H|$L AŅH`0I#WXuAH|$L AŅoH}辁XHC`D$E1H$MM$$L9$$MID$HLhxMtDXLPE;Mt'MuMtA>tLLLT$TUMuL rt"H IFXHH%|A}IMHL XMHQPHIHHHHpP2Y^D$MLc`L9$$T$^Lu|LF1ɺIL 1ɺ 1H5 H{|H{|H;- HUA1ɿAL H5 E1D k1DL{L| IH5c 1QE1JIGXH%r @4LoI$ǀ$$@L 1ɺ1H5 L 1ɺ1H5 Lp 1ɺ1H5 HCǀHCǀ8MLH5C 3IIưL9#H_I}@L 1ɺ1H5 LEDL1+H5 H}HL$@HT$8LLD$H,LT$H}LHL$XHT$PLD$`LT$LT$MѹL H5  L 1ɺ1H5 HGHGHGHGHHHPHuHpAsMmHT$8LT$(HL$@MuPHHT$HL$ MLL\$HT$L\$HL$ LT$(uUIHMmHIMLڿHpLPAXAYLA0ILT$L WMȿHpPAXAYLT$eIUPIMHM1L wHHASHpPZA]A^.!MMLH5` Pff.UH dH%(HD$\ \tHD$dH+%(H ]ÐH\H~_ H5! HAHHHDC! fo$HD$D $H~\)g\Ex p\tXH-11DL9HHD$dH+%(uWH HLf1ɺE1]RfL1AH5e,[xAUATUH~lLIMIHVHIE H taEUHRAQL x.H5ELLD1A[LXLH5b~H]A\A]t@@tNH$JH1RH5a<L!XLZH5LL1DH5%]1A\A]@H1RL2H5_LAXLHH5K]A\A]隕f.L1H5l{L1$H5ut$Ht$HH ADžLDL11WAD$D$aDAE1 HLUIL)11LD$pY^D$D$MaLHD$@Ll$8Ht Hx,LT$$D$D3D|$( D$l$x Љl$XD$$HD$$HD$pHD$PEPdL1L'=CuLLj11 AH$dH+%(HĸD[]A\A]A^A_fDHxH5 ADžXD$E1D$LD$`I}LD$LD$L!1ɺd1LAM^H5 T @HxH5 fAYIEH-11Ht$H)$)D$pH$)$H!H'H@ H8[H5S I11Ht$Leb  Ht$H1ɺHAL YPL1 A[]IEHt$f11H)$)D$pH$)$ HtH@ Ht 8H1H5R 1jL LF  Y^D$AD$,@LE1QH5fDLT 1ɺ[1LE1hydeoL1LH. fELL1_E1 DH5Q H1ɺHL V;PL 1A_XIEHt$f11H+;)$)D$pH$)$HH@ H8H5*Q 1ɺ1Ht$L :L` aHt$H1ɿHL :PLN1.XZLE1Aa L 11LD$D$/H5P H5sP HxH5ADžuML31L溳11cHxH5GfIEHt$11H)$)D$pH$)$zHtH@ Ht DEHL 11jE1L3 H5O AXAYrL1LpaL1LpKgL1LH#lL1L  hBDx9eDAVAUATIUHSH@H$L$L$t@)$)$)$)$)$)$)$ )$0dH%(H$1fH)D$ )D$0BH$pH|$@D$@HD$HH$HD$L0HD$Xt$t$t$辀H Ht HcuH|$ t$t$t$55ԙ5ƙ{\$PH0HD$Hl$Ht Hx!H\$ foT$0foL$ AT$A $H$dH+%(%H@L[]A\A]A^@H1H=h1t$t$t$H E1Ll$`L5!f.H9] AL;L1  `HELH4HIDH11t$t$t$UH uLH5L1H5gff.fAWfLAVAUATUSHHH|$L9IH1HL9uHcHI$HT1L5fDHCH@@HtmHH9teH=HtHzI$HcL,cIEHH1LPHD$LL1eAl$XZHL9zH[]A\A]A^A_HD$LnLHH571[]A\A]A^A_HD$LH5L1AL$~1I$HHHt$HLUHHHotH|LLfDHLULfDLL"1H5vhLLJ1H5v8LLPff.HH5nHff.@HH5 |Hff.@H?H6H H IfAUf1ATIHUHSHHHdH%(HD$81I)D$LH|$1)$)D$ Hu/A$AHD$8dH+%(umHHD[]A\A]fDLHHAŅt$tA$AIٹ"1LZH5 B RfH1ff.AVf1AUL-?ATLUHSH1H@dH%(HD$81I)D$Ht$L)$)D$ Ht^f11LL)D$)$Hl$)D$ Ht3H@ Ht*8t|MLN 11H5> G L "LOH5A 1E1HD$8dH+%( H@D[]A\A]A^DLpA>tHCLHxPqHLhML5LHLAąt4 $A@L1HAątgHCAHHX WM"1LzH5@@ +@MXLL 1ɺ`1H5? %DATUSHG@HHHH5.HH@HPH1Aąt5HH5HP1Aąt{AD[]A\D1L 1ɺoH5N? 'D[]A\1E1kLBH5? D[]A\fL 1ɺp1H5> ef.AVIAUATIUSILHl$0HxֈLHHHpHHSIHt$8HAHBPLJHDLDL~AąteHHFHHH9HCHH@PF1Hȋ`LHKAątBA[]DA\A]A^1L 1ɺH5= [D]A\A]A^1LZ 1ɺH5= o[D]A\A]A^1E1L' 1ɺH5c= <[D]A\A]A^AVL5t AUL-0XATL%.= UHSHGdH@PHHH`DL ,H{jHƃu1LILYX1ZHH{DL ,j`YL^I11L:L<L怽XL IEHL1P1L<L怽YL IEL1H$1L<L怽ZL IEL1H$1H{DL ,$$_1AXIL^1L溬i LD$0L|AǃD$\T$p HS@f $f$HT$ HnfxHPHߺ載HD$ H Ht$ H豎 HS@Hf L@Ix@HT$hLH LD$hHS@L$HfHHLZHH @G胑 LH5"AóH$HD$hHtH9t H;@tHzHD$hHlH9@HxֺfA @fH5g HLfL%zHL$(LzL$(fLWHLSLH$8L"HLfA($f.Lwf.H5SHHT$8HT$8H5HHT$8L@LD$hfI1LھH5GAfDfA EtI@HhfAhH= RI@H HHD8@HD$nfH5XyHHT$HHT$@LD$8`DŽ$ HD$`Ht HH$HH E1H$1E1H\$8L-`ULAIfDAEEIPE`u0$tAtHLLHHt MHLDA&u$H\$8L})Hl$hH$H|$HD$pHD$xHEH$H|$H5,HD$pH LL$L%Z 11L%L $D$H} HL$Lt$(H\$ALl$0HHHD$7f.1MH _L HH9\$HEHf11L)$)$H$)$HHuL LL1E1@H5wHHT$HHT$@LD$8jLD$8HL$@HT$Htf'fDŽ$ 3fXf(xf111fH|$ 1HPHHHHPHt:uHPHIHQH@H@f.H|$ H@HuLٹqyLD$8HL$@HT$HH5NHHT$HHL$@LD$8-LD$8HL$@HT$HLHHT$HHL$@LD$8LD$8HL$@HT$HH5HHT$HHL$@LD$8LD$8HL$@HT$H H5 HHT$HHL$@LD$8LD$8HL$@HT$HCDŽ$H(Xxf$ft$ ft$ft$@ft$ft$ft$ft$$ !HT$`Ht HH$Hl$hHD$ L1H5KL1H5"īgLL$LE1Lƪ蒫DHl$pH\$HHH;(tuH葻HAEtXuTL 1ɺ1L%L 1ɺUH5d1A6A uE(fLK@MtfAxMPLB1H5A藪:ffO,fLL1ɺ1H5AC{HHHD$pH{ HD$HL$pgH= HL$pH=$LD$(H F111ADžHl$pAHHCH;()LN1H5ǧi L1H5A:rf'Z]L{HT$`LH$DŽ$HK@HT$`LH$DŽ$uL 1ɺLL$L1LHl$pHLHH;(7IH H$H}H0I$H<H$1LHuyI|$^tHLR1H5+ͧpH5*HHT$HHL$@LD$8LD$8HL$@HT$HH5T[ HHT$@HL$8HL$8HT$@H58HHL$8ļHL$8DŽ$7HT$`LH$DŽ$+Lۣ 1ɺ E13L 1ɺH5.AϦHT$`LH$DŽ$ Ln 1ɺxL[H5EQ mH}ĭI|$躭HD$hL 1ɺQ'L1H5P H}qLH1yH5P 돹LH5P ǥUH5HHL$8HL$8u3DŽ$Ht fh$rH5`HHL$8κu{DŽ$HL$8E蠺۹8$LL$HH 77IH H5O A9HDRAPL QP1H +1LaH5轤G7AWAVAUATIHUHSH $dH%(HD$x1  u>D- EtjD-?Et^HD$xdH+%(gHfDAy.1E1L{H58ףHD$xdH+%( HĈD[]A\A]A^A_uD- EtD-EtHD$xdH+%(HHĈHL[]A\A]A^A_<@D- EhD-=EXHHE1L|$HD$Lt$H9u&fD|$DDHH;\$t-HCLLHx@ t߁|$uA@EtcL5711EL&RL脢AELL1XE1Q|@L5]71ɺR1LAL4$H AŅH`HL=]LhHdH H|$ jQH ELc1QH BL 1AUH5QH AWQH ڛS藲H\$xH@1ɋ|$ HT$H AŅ`D$(L1LLéAEHL f11Ht$@L)D$P)D$@HD$X)D$`tHt;H@ Ht28L cGL 1ɺ1H5 L1LL7蝠D@BnH`rWLH H Htt H3:uL 1ɺ1L2Hl$0E1HH)D@D$AAA}T=*Z=+=,L1LLn謟g4OL1LLQ_=$uYLLHPL+P1AQ"_AXL1L4=(HLPL1L)ÞY^|@$EL@MLLD$襮I|$HPHH$@HH$Ht$HH$RH`H`H $HHhX7LHOr H7Hl$0H{Y@oL1L3НH`HLLɶpHL1薝XZ L1LLڵh#L1LL<L1LLL1LLGL1LL踜ff.AWfAVAUAATUSHLH $dH%(H$1D$<)D$p)$)$)$M ILHSD-nLED- ELt$pUL1AWL=031LʛAZH{hA[@LUAŅLMH5LHD$ H5 L۰H'H s(HHDH|$pHt$LDHHL$ HT$HD蚪H|$PjHL$(HVLc1QH qL #QH t$ QH Ht$@VH5QH AVQH AUQH AURHT$xR1觫D$H$HpHL$Ly1+H5B,HD$fL̓ 1ɺ71LfD1L1ɺ~LA赖H$HxmDHLL1LPHL)fDA$ fL1ɺz1LAݕH`HLLpHL1蛕AXAY}ff.fAWAVAUATUSHdH%(H$1HL=IIHLIHL螪u:L;AH$dH+%(PHD[]A\A]A^A_DL=HLNtH CHAH2uD=EtD= EtID$HHl$pI|$ @HHD$%ADžMMHH|$ jH AWL yLcRHH5M1QH jRHCURHGt$@R1ATL$1HP|$ HT$L DL$ADžAAH 1E1LmH5(褓Ll$0ML螣L#efDATLA 1ɺ( 1H5z(T.EAAAA0E]I$H-U11fHt$@H)D$P)D$@HD$X)D$`dHt3H@ Ht*8tgIL 11H5 L1E1M H5'1蕒Ll$0I|$I1LxMtL艢I~LhL)HHtmLLHA=H: t$ML1H5.'XZ]LQC t$ML1E1S H5&近%DAWAVAUIATUSHH(dH%(HD$1@tG>euB~xu D$,HEHl$Ll$ HD$0HD$lHD$@HD$hHD$8HM11t$(LĨ H5,t$(AVMH H5LVD$HLLHL`fHD$pHD$P)D$pM_LLHH@HMIL9Ld$X1IHÐIuH2MmM9uLLd$XuHcH4HD$pHIL9Dl$HLt$H@HuL1HEH@@HtwHH9toH=HtHzHT$pIcL4nIIHt$H1L1AdH5AoD$A^X@HmH9[Lt$HMt$@IMLt$@H=͗It$`t$Ht$8t$8LL$PZ H0D\$x1E~fHD$pHLzH5R1E1'{HD$8dH+%(ZH@D[]A\A]A^HD$8dH+%(3H@H[]A\A]A^H`AtH fDD%D$ED%ELVA ,HLHt;uyML11\H5SA'zfHL5LLoE1H5y@LLH FyH|$jSL sLc1QH sH5z1AVQH sAT菊H\$XH0|$HL$HT$ H DL$ Amx1E1LH5X2yfHl$ Ht H{}H%L1EH5xL1IH5 xAEDD$u8@BlH`p/LH tEHA賥 .L1ɺ1LH5\ 6xA H`HL-H5% pHL1wXZ{s1E1LL?H5 w@AW1ҹ AVAUATUSHXH|$Ld$ Ht$LdH%(HD$H1萍H7H5xLhHD$HtHD$E1@kA91H+LD)DLcNfD1D1VfDHH5/rH|$&AEtH|$H5rHfDTu GatfD1GfDGgAWAVAAUATUHSH(H|$H\$HdH%(H$1Ht$HxJHt,L)HtD5+E~EL%+1LHD9t$H}LhuHcHIDfD1H$dH+%(uHĐ[]A\A]A^fDAVEAUIATIUH,SHHxHtH5oHAEuTA fJHf DH[]HHHf|:A$A\A]A^ÐHHU=DMtEu fHH H@H(H99uAEkfEtcfJHfX9LA H5m1LlfK[]A\A]A^fD L*'f7wVf HL!.ff.fAUfATIUSHH8dH%(HD$(1:-)$)D$I,H׉HtHLHLuN fo $foT$HHHDHP HD$(dH+%(H8[]A\A]u4 fo$fod$HHHX` fo,$fot$HHHPhp rILCH5ljfKCff.AWAVAUATUSH(dH%(HD$1D$>IIAH1@fDA9OAyOAy_LLLzA9u$HE8OuxOux:uALcD$IN|MA9-uAy-tb1L4H5 kLT$iMLT$A9OIL$t1LLLPf.LHL$HT$E1Lt$CtT$A9HD$dH+%(ueH([]A\A]A^A_ÐHjH…t JDHmjHLPH5.j1RAQAhfAMH }fDAWIHAVIAUATUSHHdH%(H$1HH}HHH$HǻI&fHxI|HH A{HuLDLL`H$dH+%(HH[]A\A]A^A_w1IٹLH5igAFfAFH$dH+%(u.H[]A\A]A^A_ATAF|fDAWAVAUATUSHHdH%(HD$81HD$IIHcHD$E1fDHT$fLL)D$)D$ AfoL$foT$ AfAAHHID 0fAII9tPMtjO4L^nAH5gL{u`HcIHA8I9uHD$8dH+%(uiHH[]A\A]A^A_I$8OuxPx:ktfDM1LjH50gefAM.{AWHE1H AVHAUATL%*USHD$HH)fA<$HD$Ic1E1L5H L *MIAIHA)fA9uIcH;fA$Hi3t AƄ$fAt AƄ$EfEt AƄ$fAt AƄ$AAtiHIL+HH(BƄL9uE1Ld*LHL9tuf;uft-L:H4IMHf.D9tH(L9uIIuAHD$(IA;[]A\A]A^A_CƄ!IIYAWIAVE1AUE1ATAUSHH|$3HD$DH8 A thAA tDA2tnAAHDHI#tAtrAEt|pAGADAGuqAA2uDAGH[]A\A]A^A_fDIWH5x 1pP@AWH5< 1o/H5 1owH5 1oKHH5kc1[]A\A]A^A_oATH5FcAUHHwt>H5]bHvt+H5AbHvtH5 cHE1vAHD]A\AWAVAAUATUSHH(GoT$HHt$ D fD$[EtH{Ht( H1H5m nff $L{ E1H-L5m 6D1H5DbUnI?uZ AI(D9EoAIcHHTHLu1HLmI?t +nLDHf Ls E1H- L=l 51H5amI>uND AI(E9IcFIHHTHLu1HLOmI>t mLDH1H;?lD$$$D=+)H5`1 lf+t] lftIH E1DAH(D9~$H}t lH1Hf@t$ f HHH5-`1%lHHHH5`1k $ f |$L E1L-|*MLt$H- EH|$H IL,$ILA AH(D9Lc{KMLtȞft%HŎH4HP(HD; tH(H9uH$fxvH$AuH5z_1L$ kKT$ H5^LT1LjH;KH52_1j+LH5_1jft;1H5^E1jfH u|H5^1mj jT$uH{Ht H( []A\A]A^A_ujD fjH1HAH(D9~H}tE1ffIcH-(AHH,$Lt LaH5]1iH $KAH5]HL1iE1H}u_D AH(B>D9~oLceH $KMD|EtEuH5*]1-i{ DT$QiHDHDT$zfH,$A9K$Lt ZH5\1hKH5g HT1hI>u[E1 AI(D9McfKM|uAtDEuH5A\1Dhf vhDLH(E1@H;?luDT$DT$D$$땐$H5\1gH;萿 H5\1g$@Lt$LfLcd$H+*E1I LH$HDIfA I(9Mc~KM|uft)HH4HP(HDD; tH(H9uH$fxvH$AuH5:[1fKH5e HT1fI>u;H5[1f; fHDL fLDL`H5VZ1KfKfDATUHSHHZHPL%rZ1ɿRL1ILn~ $XH}PY^I,tH}Pt[]A\fDH@HILP#1LG~WX1Z[]A\HYH\fAUATIUHH0dH%(HD$(HFXH%r Hƒ @u\HE1L}IH5cY1*WHD$(dH+%(H0D]A\A]fHHE1E1jHLjjғH z$osuAHtyLX1ɺIL-X1L}V ;sL1H:AąuHL}LI18V {LmX1ɺIskAUIHATUHyteAu D]A\A]@H L%X1ɺIH5W1UHLD]A\A]HAL|IH5W1^UD]A\A]DAT@u4uADA\1E1ADA\f.1AąuLQ 1ɺ1H5WTf.DG[@HHG(HHL)}H5VDH@HkFHкP1xTHff.AWAVAUATUSHdH%(H$HG( IIE1E1D$D$(D$ @IcH\IV@Ht@  IF@AHfx+\+ApAopL)H1PA1L)}H5SQL$ D$XZ~*u6LLAD$ f.gvHLd; 1ɺLQ; 1ɺsLHT$IHT$H9ObHE@L ; 1ɺdZL: 1HE1>QHtH$HHE@Hfh/IE1IdžxIdžHAA)AHL[: 1ɺH޿1E1o=     1ۃe LzHLgSI}L9 1HE1k<.D$x6IGPH@H@@at EvE M1҉É Q9H QLmg1ɺ H5>1Ae<_AXA;_pOL藶LgIH5Y>1 ftGH$E1E11HLLjjjvH t$t$~LݳL cHIH5;1f9Ht$tL4"DL$tEt$lI4DDl$8Hl$XLd$@Lt$HHT$0HD$PHl$HHT$ HHD$@H+HHIDH;\$@uHl$Dl$,Lt$8L|$Ld$0IHl$ HD$Hu1HXPH;HjHLHL9ufM6L9IVH9B@uAD$LE1uIftNXBtE1@u>HPXHJXt.HHHH$HfLhXA$I\$@Htfh/LZHIOHLH=[H1H:ff.AWAVAUIATAUHSHH_@Hf!H!AƃA!1fpm@@ EuvH@LE1HYL DHP膅ZY3H[]A\A]A^A_@fEm@@ @AuMuL=HfDI HL9]LLQ:HtHfh/=vLXQH50*11'vv1L$ 1ɺVH5)'@A`HdyHU@Hft!HLDH[]A\A]A^A_EDf(u1H=WBZYt]A\A]ÐHU@Htf!H5z(11LX8&LDH]A\A]D`HncUf1LWH5(%]1A\A]@ftLDH]A\A]f(u*AUE1IATHL AUHHP.ZYt]A\A]ÐHU@Htf!tH5n'11L W,%LDH]A\A]fAUIATAUHW@HHtU1fHtIHiLE1HDHL IPsZYt$]A\A]fD`Ha@HU@Htf!t5uH5&11L1VT$LDH]A\A]ftLDH]A\A]f(ueAUL-0&ATIUHHB1LILV1k#LHǚtSHE@Ht?f(tLHHE@HtftLHt;]A\A]L1ɺnL- U#]A\A]f.1ɺzLL %#fD1ɺvLL "}HG@HtSATIUHHft'tCHE@Htf(tLHtQH]A\@f.LL 1ɺ%H5$a"f.L 1ɺ)H5c$1"f.AT1HHs IUHHQt%LHr_AEt=H]A\DL 1ɺMH5#!H]A\@1Lr 1ɺPH5#!H]A\f.AW1Hr IAVAUATUHSH8dH%(HD$(1芟:LHLt$HLt$I9ĸLt$LD聑AŅV=ukHLH8 p&LL=" HIT$HHB Ht^HHtVLSD%EHXLH轕 =w=l@HB(I$H5m&HUPH !L LHSBaHmSHDPEVLDL1R1ɺmID$H HPHEX I$tH%H*HEXAD$LH4@HID$H@PHx='HHID$H@At$L1RHӉD$ H{H$H|$H$D$ HL$L3HKHL$HH\$A;D$LHII$HH|HuL 1ɺ1L7HsdIG@H~fh/pHPID$@AH虘XL0RIL=[ 1L1L 1ɺL'L 1ɺH5 HT$(dH+%(H8[]A\A]A^A_Ðj:1fDHؗDLOI:LH$ bH$H|$HB4HD$L2HBHD$HHT$HH5jHEPH8AEH 1ɺLL 1ɺkLLOH%H*HEXI$LU 1ɺ1LlHHs 譖H- HID$@HDHP HtHHt LILH(ULSLi1ZYIT$H5BHdiHDAmot+j ]j71L~ID$H\$@!L9CH{跖HL9u-f.H訕cL7NI =HEPH8EuiCADHHH=qMH1,tH5% L+,#L5rdLL,IHEPHH8IHHHE\LL+taH5dL+tNH5 dL+t;H5cL+t(LL}+tH5$ Lj+fI<$HHA)HHejE1E11j1jjsH HHZHx`%LX*HE`HHOHcI<$H$H8@L 1ɺH5c11LBIH53fL .L 1ɺH5 Hp[(MLH1H5 A,9L 1ɺH5 AW1Hc AVAUATUSH8Ht$ː;HD$H@PL HD$ ID$@H ffh/T$,?HD$ HHxHD$HMl$HI\$HL9i1+DLL*HHD$H8MmL9:fAtMMHL$HcLHHD$!I|$LxLUHHuHD$LD 1ɺbHH-1HM*H-nL_1HH!1L 1ɺHH8[]A\A]A^A_H|$6H=GH1H5@=LGt+H5?+ L4tH5L!u>DjAL﹦hAO1H5WBC_AXIm@HDfDc ECfDLhLsCdLC`LIm@H:f8#LMA7fDH5L1H5<LfL]@1H5oVpf/sDKhEH) HCfHC@HsLuhfh)7H@)HC@H8HS@HL藫AąL 1ɺ1H5U(fDL>H5U1E1@f&A}DLA>DCX@L?DL 1ɺ1H5UtfHC8SC ftXH =( HKKfVL >1H5T1 f&uzL6 1ɺ1H5HTIH!HChHHFff.fAWAVAUATUSHHdH%(H$1HHHHIII1HIHL0I} Z IHLI}HXH6 HH$HxLHHILHLHH) H)։HID$/HID$HHI}LxL HLHHLI$I}LxL H|LLHID$ID$H$dH+%(qHĘL[]A\A]A^A_7/$ ATfTfD81E1L2=H5Ri@I$L=1JH5QI}LE1%HIL<1S=H5~QE1LfL<1BH5KQLID$BfID$2f$ۉATTffDQIօu]t9EHH HHDȸLPHD(DLPH @(f.AVH"3AUIATUHH(HNHdH%(H$1L$LL <xILt$H}PLLGwHtLHT$ L1pAătXL;H5O1E1H$dH+%(H(D]A\A]A^L$ HOL1LOx1LHLHuLOE1亟H5&O'a}ff.fAVLAUE1ATUSHL9tKHE@ELt-HH@HZLd Ct*teHI9uHmL9u[D]A\A]A^H;HGXtĀt @tH<A묐KAfDHH@H%HA{A[]DA\A]A^ff.HHǰH9k$ATE1USHHt HGXuoQLtZHHRHX8H,tDHH9t2H8uHxHGXtĀt@uqAHH9uD[]A\fDAĀtHAyAUIATUSHHIHI$IIID$H9uP@fH@ @HSI<$HPIT$L HPIT$HID$HH9tQHCt닀tI}(dHu1E1L8H5gLhHL[]A\A]L81H55L6H }X $H5 H= DHWXHHǰt]H9l"H:tH1Hu*ÐHzHWXtƀt@tH1HtָGYthSH9u"ff.AWIIAVIAUATEUSH(H9F`D$D$LL\$+L\$D9AtsIVXLHHH9!H:t[EIG@1Htfh/LHLF_AąsAH(D[]A\A]A^A_HJHQXtƀt@uH̀\EtHHH9!fDLE9IVPAHѹH9w L$H9T$0H9P1DHH9u5DL$L$MDHLLT$m`LT$-E1LMAąLn 1ɺ1H5I@H(DAL[H +]LA\A]A^A_\L 1ɺv1H5&I'mfHHH9D$AF`D$1f$ L 1ɺH5H1E1L 1H5 L_ 1ɺҹL\$LT$HI)EA,HAM t$jY=H^IL 11H5 LT$L\$HAWAVAAUIHATUHSHHH}P)XHIEt%HAEYt HNOAE9*HHI7HuIIưL9LMt]AFYtVH9tJLE1LH(3ZAƅu,L 1ɺ1H5F:fHEYu21HPAƅ5AHD[]A\A]A^A_DALH1LAƅuL: 1ɺ1H5LFMHrH5$FILzF1HHL[1]A\A]A^A_鉂f1҅H HE1E1"aAƅL 1ɺ1H5ELl 1ɺ1H5~EE1|L< 1ɺ 1H5NEOf.AWAVAUATUHSHdH%(H$1Ll$LE\u:AH$dH+%(QHĨD[]A\A]A^A_LuHH5KALHtL)L|$1LHHL Ht HH}PL蠉HHxHLRPHpL>1IH5D1"fDHE1UpL0IH5C1fDJfDHpL0IH5C1 AWAVIAUIHATUSHH!DK EH{?tH5) gH0InXHHHHHH{H5R AąIE@Hf)(L01H5BDDCEDH{?7Hs LW Aą!L 1ɺ1H5'B(CChALAIFPLMtH5N1LL $B Cu KhClF9t DQ-DShAwE&E9t1MNHLf011H5[AD$XInXD$t DKdEKC AACu s1҅OLD$d0D$L tEL t9L $t.AL01H5 D$E1H5@11ɺL ADT$ H4$IE@H4$DT$ Hf,AFYD9s E9E9D9LADHLLy&AąK\L Kl=@I11Ll@H5?A)DAL 11H5?HD[]A\A]A^A_f.HH}L  H&H5T?L,LDHH E1P11^_DHInXH LFAL $CE21E1L+H5>@V1E1H-i>LU.H`H1L.@D9AE9LE1]jL+IH5=1E+j=>I11L!.H5=AfAFYAIIH9t1HH9uLH4$iH4$L-I'1<L*1Ht$,AZA[H4$9L 1ɺ1H5;VfIID$H9IFPHHs`D,DL HxjDڃP_1AXIL*1H5h;iD$%H5?;L)H4$:H4$KAWAVIAUIATUHSHHdH%(H$HGPHH$1H9HD!I}L%L6ADžu_H$H@@HtBf)t8(t.L(15H5y:zDAEAEhH0I#FXIu HHCIM HPHq@uH9tu AUD$L}L0LLADžH$H@@Ho fMD\$EEpE Iu AmdIu uAE`HAM(AU,WLPAEtPEM|WH ADž Le=9I11L/H5 9A>f.L8N ADžL 1ɺ=1H58H$dH+%($HĨD[]A\A]A^A_H9A1LN 1H5b8cAMPHC@IH9HPBs@LAUhAMlDt)ЍzEA1A9D$ERAEt qIED$8AE uAEt3I}H5 DT$DT$L(kQAEE}EHCEEHPHHE:t{Lt =I}?H5 HT$ DT$H|$(DT$HT$ H|$(LeDT$HT$ H|$(H5J BDT$AHT$ fDd IAMdH$u uA]`Ee,ML9Z AELH 7LDT$H#HDA9H 7HT$H6HBHD$ XDT$ AELDT$MbIHH9 HGDT$HH H H H HT$(DT$HT$(HLL$ HL$E1H=+DT$褻DT$mLRLr IH5 1 Hp(Ht$L 11 IE KAEpLRHt$1LI 1LQL IH5 1_QLNE IH5 10_LL蠊ADž7 1LH5r "HE13QLH(Q H5C API1SLAYAZLPLP/ IH5 1zHp(L$HPLuK IH5 17I~Pr]LqPL$ IH5 1E1(L 1ɺ* 1H5W LPLR IH5' 1LTH|$0HjADžI~PLADžI~P茩tI~P/o5L 1ɺ~ 1H5 E1#RH|$0H1_ADžtL 1ɺd 1H5i L(OLIk IH59 1Lz 1ɺ{ 1H5 LT 1ɺb 1H5 gLNL"# I4HCHE H5 LuuuHC@  gt+HE H@ H@XHt1HLЅLuLLuaLLtRH5Lt?H5 Lt,H5:rLutUuE IE@H f8Hu HMtHUpLLM|LExQALuLL t>H5Lt+H5 LtH5qLu DIE@HfID$XH0ra@I$IİL9*HL`fDLLHE HLu"I$H9D$HL`ID$X@|H1H +HC@uHx(H5p1ҾL[LuIA>H5LIE@Htf)t M/HE H@u ZHLH[]A\A]A^A_I$H9D$HpHu Epg@Ll 1ɺH5{H[]A\A]A^A_DL4 1ɺH5CIH[]A\A]A^A_H5 LIE@Hf)MH5 L[H5p LDHE L;X LH(1H5H[]A\A]A^A_1LH5[\L 1ɺH5-3HLL$IE@Ht(f)ufufufHuH5 nLFtHE @L ILILHLILH!LUIIE@Htf)Mf?HE H@.Ā%H5 LH51mLlLBHT$4LHQD$,'H|$8nHH@- H|$nHH#- D$,INHH|$ 1H#H{PHT$Ht$ ,HH{PHD$H9XL$(L1L-9?AI1H9|$Ht$8HD$1HdHt$8HH FXHT$HHFX5I1H9|$Ht$HDq#HT$Ht$81HNOH|$8HGPHXH{P蟊H{P>PH|$801ɺ LIL51,IH9D${HAX01ɺ LIL51HH9OL@L3 H51E1虵@L\ 1ɺ 1H5nof.1ɺ E1L H58>ofHD$LE16 H5LHH11L31# H5ԴL1) H5褴1ɺ. E1LU H5pvHD$8< L3LHHL-D1L@H|$&kHH) YH|$i.LLIS 1'H|$87.L L3IxDl$4H.HB AUL-IL2L1葳ZYL-L\ IH5\1[L" 1LE1p 8i1ɺm LL HH#FXL̯ 1LE1x L-HLJXHHpX(-H{P[L{ 1LE1{ 葲LX 1ɺ 1LoLL$ LQ&a H5BCtL 1LE1  QvfDAW>IAVAUATUHSHH(LnPdH%(H$1Lt$ LHHBHHD$dHD$0H$D$T$IH$H$DŽ$HDŽ$DŽ$ DŽ$(H$H$I93HE@H6f(HpHD$Ht$HT$IHTAą8HD$MHD$pMtBL:ht6M L0H51蟰E1{HHð1LH9HDaAąH5-HgH$H.L VLLIHA1ۅmLLH`AąIGXIL%I FXIH9HD$HDQ&Aą61LLDDLL-)LI)=KLHI1AT 1L0ZXZA,AL 11 H5H$dH+%(H(D[]A\A]A^A_HD$1LeI9tLH8AąmLLBIHLeHH# AąHۭe HRL&/HNLtLjL7 H1E13 f.LH( L-I-L 1ɺ 1H5跭fL| 1ɺ 1H5菭nf.L.1 H5[\;L'L- IH5"1!@1ɺ E1Lթ H5L-1 H5̬L9-1 H5蜬{L\ 1ɺ 1H5nE1lKHN1ɺ L H>I1H9|$HD#AąLLHnAąLbHHP! Aą+ H1L-ūLbHH ! AąRL%Lc-LI 1wVL> 1ɺ% 1H޿U4L 1ɺ( 1H޿3LEzt@UHHPAEt]ÐH8%LDIH51]f.AWfAVAUL- ATIUHSDH(Mt$@H$`HT$H$L$L$0.H DL$HD$ dH%(H$HFP)$DŽ$HDŽ$HD$1EHLLDHHH$HMfA.1ҾL&$PA$$TAh/H$XYHEXH%r H-H#@ L+IH5M1LE1H$dH+%(H(D[]A\A]A^A_D1Ҿ=L虄Mt$@$PM5DŽ$T1:fLLIHtH@ 1H$LPXuUMH L11 =@D$L` 11= H5rsDT$ f1H HL&HD$(D$PD$7ID$@HfLL$M HD$H$LH!JL$H|$LLL$8:LL$8HO LhMB L9L9l$ L IUX@( H1HHIHt H$LHL$8HT$A{HT$tHL$8H`A$J>1H LL$!HD$HH|$HX]D$THD$@HD$HHD$XHD$fDH$LLL$HD$`H$H$PMH$HD$pPL$LT$H1_ AXL LT$8- M5 A$HD$DHpXARLLAUL$wY ^LL 1ɅJD$M AD9H1ɺ $L@-PHHHD$H1YL^_L IHLL$pLD$hCLL$pLD$hH$HHG1H|$`VD$dLL$`Ht$811Lu, 薤ID$@Hn fh/` M5 LY[LH D$( D$A$HT$ H|$+.H [LHp D$EE[ HHtHHH9tHHƄ$dL$ H$p$$ L։$$LD$($$DŽ$($HD$ HDŽ$0H$H$H$H$HEPDŽ$HH8$(DŽ$THDŽ$LD$(HH$} H}PLGHD$(H8 HD$($HT$ H|$" DL$E LmPH55I}nIHI}H 1HsIHHH EXLHHH9- @LLxLǀHǀxH k L'IXH1 LmH޿萗=QH޿L 11L| bE1HL1ɿR PHPL$1Ht$X%D$HH LHL9t@L1DHH9uLE1,fDH AH9uAHt$8L11 裖LDL$E1E1T$DL$LH5dAQT$I1R TXZ?H P 1LLqHD$ HBHt$ MH@H FXIImX%I9ID$@MwHf*1L,HL$PD$D$$$I^_L$AOTI1H|$(HHHH ILJzImX*LLVL' tZID$@IuX*H,Dh/$jA11P1L9X AZA[Ll$(/L1 Ht$8E1E1贔IuHH|$IU L L/IHt$81E1E1eRL< ZLl$(IHt$8L 1ɺ  E1 HD$LHPXo1E1|$~1H(H8 Ht$8L 1ɺ 跓L9MQH5L$D$Iz(HT$xLL$pLT$hLL$pHT$xD$H$|LT$hMJ(Ht$81ɺ L1,L9dMQH5kIz(LT$huLT$ht5H? LHR I\HD$H$LLHHX\1LLWLH褌Ll$(IH#Ht$81ɺi E1L@ E1`MHt$8L" 11 <)LH54 L 1ɺ Ht$81L4% L 1ɺ} L 1ɺ Ht$81ɺ E1L 詑H|$@.H$HzӦE1Ht$LLLM|$PeE1IIGLSH54 LHH1 LӍ 1ɺH5 E11L 1ɺH5 躐HD$L LAR1t$`Ht$H胐A[[1HD$L LV1t$`Ht$HH_AXH|$@t1H$1H wHD$ 1LLU1t$HHt$HA\A^L 1ɺc Ht$8E1E1迏H% Ht$8Lw 11 葏Ht$8LX 11N E1E1lYHt$8L. 11 HL 1ɺH5D 'Ht$8L 11 LK Ht$8LI 1؎H|$XH|$@H$HLv 1ɺf Ht$8 E1LvcL= 1ɺH5o R&Ht$81ɺ E1L -HS LLa HD$XAHD$}L 1ɺ] H LL ALl$(IHt$@H2HD$HxIuHHD$HHD$HxەLHD$@Ao] Aoe0)$`)$pD$TD$THD$@HD$HHD$XLOHt$8LI 1܌[fATUHSHH 舔IHHCPHSHHHH肆ID$HHCXHu7AT$ 1AD$u1AD$҃ AD$L[]A\HHH@HPH L1H5f.H}LE1补L 11H5谋\ff.AUATIUHSHHG(@f$f(t41LH5OPH[]A\A]1AIt$PU\HTHALE1PDLHXAXZEu1LÇ 1ɺH5؊놐HE`H}E1HHHuL 1ɺ H5蕊@E1Cff.ATIUHHHvPW\HID$@HQfCHLs 1ɺ:IH51膃fDID$@HfH}P HD$HL(LuPL9M1@IL#L9u @IHSIuHHFH3 H3BH urHNHFH3JH3BH u]tTuJA)HLA)SH[HtH{hHtHWHRRhHChI$LM9`MmL9l$9LVZL)JAL11H5L~ 1ɺd1H5f.HCLt$0LHD$ 1HH=ID$@HtftH]X$DŽ$D$ǀt H;D$HOA$D$(,DŽ$t Hy H]XH: HD$$1HLPDT$EID$@H?f$h/fED$)؉$$AHDL$DL$y='L H591=DL$HD$ EBf1HN HL\OL| 1ɺH5Aqf.Hx fh/u)f1H=S}XZM鋌$ALHL聱u$wt DT$EtdEYtH9D$tKH%HøEYtHS\$L1ɺiLSAA)1|AXAY|$,Hn~Dt$(A9HHHM~S1LAVA)ƺm1EL7|Y^=Aٺ=HL=1ɋD$LL6P1{A[A_ HLDL$ HH\$ DL$H{HS}H\$ HHSHPHSHHCcD$11L_x :H5uv{$DL$}fD$$&D$\$(AD$,Lw 1ɺI1ҾL`1ҾLHD$_H|$H5qIJLH5qD$7|$D$,.D$)؉$ L$,D$D$LGw 1ɺ+GD$\$(A+\$D$,D$1H=?NMPLHAXZ@HD$dH+%(uLhfAWAVAUATIUHSHXH^PdH%(HD$HHG`LHHD$Mt^LtR1M{LH5Z[hHT$HdH+%($HX[]A\A]A^A_HT$HLl THLt$WIHHxLxHEPLHxoHHCLHLŀH}HL)}ID$@Hf8#D#AG=w AGDtpL-hLt1LSg1Ld 1ɺL6g@AL-h'fDAH}PD HI|$E$DA$jL-A$,M$ nrYLj ^I11LfHUPLHHT$HT$HLPMLLT$LT$LLT$LT$HLpLLI31eL-޳IٹLLepLb 1ɺH5eAL-~1ɺ1LLb Lle11Iٺ8LLLT$;e11L(:LeID$@LT$Hfh/HLT$LHELT$HHH9`H@@@u/LLT$LT$tEYDILQ1LN1LT$cdLT$H}PLT$`LT$eALDHLT$IXLT$^1LoIٺ`L=Ld11cfDL-L` 1ɺLcVf1ɺ0LL]` c-H1M!LLScXZ1HLT$H=F7LT$ XLbH1ɺ^LLX_ b(H|$ HD$01LT$Hl$@H|$0H|$8HD$ HD$(CLT$PLLh#bywfAV/AUATUHSH H_`dH%(HD$1HD$L#LkLuHt/LuHtUHHSE1HE1HPMZYHT$dH+%(kH []A\A]A^f.H=DuHtH]`fLXqH}LpLhHLLHzHT$Ht$HHD$Jt^H|$ qLHqH}DtMcLhIHtVHL$HM1HYL9^x6H]`LcLd] 1ɺH5sy`1LXH5JK`1L ] 1ɺH5HD$`guATHIUS"ÅHH:LHH,u>HIT$XHu*Hx%H-HHw (Hr []A\fDHHjLHDHUIL1H5%&_X1Z[]A\DL`AEuHIT$XHx12@L(L4IH51^17f.I$I9$DAVAUATUSH0H^PdH%(HD$(1HG@HofaHHD$HUHHT$HIeLt$HL-HLhMHw1H HLMuXI-LD lPv kI4L9HH1HSE1ALL袲ZYpHEXH%L5'@HegLD$HD$ γNHL$ HT$LLD$Ht$LL$ uLY 1ɺ'H}PƏLY 1ɺHLIHHH8LD$L$ T$H9ǸLL$ t$HDL$Y 1ɺ1LHD$ Ht Hx}cHe=֪LI11L=& c[II9DID$@Hf/L1ҾL.ALUX 1ɺJH5dj[+L,X 1ɺH5;A[@HT$(dH+%(H0[]A\A]A^LW 1ɺH5Zf.HD$1LW 1ɺH5ZtLxW 1ɺfDLZHD$ HtHxa1L:W 1ɺaLSZfHHŰH9HL5HhH_1ɺULIL1Yf.M L1H5Yw1ɺLLeV YHHŰH9HHhH1ɺXLIL 16Y fh/rL*LU 1ɺGH5XfLU 1ɺH5X1ɺ\LLmU XSLL$7LDL5Q1LILL1?EHDAWAVAUIATUHSHHHdH%(H$8HFX"H07H-\H%r @IIH9jHLxIIH9kjLMy1H LH-IGXnH0ID$XH4HE(@f f LLHAvLWLHL=HI1ULH5ő1CA[]AHHH9siLIf.HHH9t51HH9uu L0HtHPB DL耽LoIH5 1 CAH$8dH+%(HHD[]A\A]A^A_HHH9hLhI f.LyH5}1|BnH-sHE(@ffIPTuLL5'}LHrHL1SIL1AIwP_AXHHH9t+1ɐHPHHHH9uPL` L$It$HHؓ L|^ L̻1ɺLIL0 1\AIPkIP"ZLA|LHq=LHI1SL1@ZYLkHt$P HT$$HIEIEIEHD$1HH4IPs+LD$AD$[C$y$h ;fDL; 1ɺH5A> fDLPL2IL5LL=L: 1ɺPLyf.LxM;ML1L:AB=:DHE@Hf$L5 11ɺLL19L1LIL^19L1Lr9DLLHkÅ1LL59HÃ+LyLHn=߇LHI1ULk18A\A] fDL5 1ɺuD1ɺLL5 81ɺLL]5 A8wf.LLHR1ɺLL5 A9811ɺLIL+1H58I$F1L0IH5Ӆ17I$HHH9]Lt4 1ɺ1H5A7yL5j1ɺC1LmL]7D$sL9HH螬X1ɺLL3 78A tIPLk1H5V 6PL1LJ61LLgQ6D$LtHH٫1ɺTLL.3 V6HL$(LL$0HLD$,H5 #rD$(v|$,\N=L5ǃ3Ls11LDL$5DL$LLILH=H1 #t4H/AD$,tI|$@AD$,&I$H21ɿLL, /L EHL$H3H H1ɺLL, /fD$0e=V~LLw11n/IIH9yUHhLH$ğLOAED$0tH4$1HLM=}LI1ɺLb1.Af1ɺLL+ .[HAq@LL1h.E1I$Ht3>#t.HD$-D${AD$,=I$HD$0D$tlLD$ED$uEwfDD$dLq1&H5{-D$01ɺ LL]* -D$p@H3HL$(H HQD$^1ɺLL* :-D$:LHH}1ɺLL) ,`DI|$@D$AD$,"I$D$f1LLR,EH3HL$(Hľ Hp1ɺLL5) ],pL1L0,E1L$LY+D$fDL)L+D$ND1ɺ LL}( +D$aAcLL1D$k+D$L@ATIUHSHZHvPW\H;LLHHHVAăC\uKD$X1LHsAȃAA$HA9DLH9uLLH$dH+%(~HD[]A\A]A^@qDL4$ 1ɺH5CuAC'됐Lٳ1H5uA'klHT$ dH%(H$x1H|$0HHIvHHDŽ$DŽ$H$IF@Ƅ$DŽ$L$hHDŽ$pDŽ$Ht$HfLHHD$H;\$<E1LHD$H-%EI7H|$mAIcAHl@HH;\$ftHhH}@tI1HLlpHI?1HHOpH.II9uDHI9 HJH9A@uH|$JDE*AHIE@IHmfh/_LT$A1AxLH5p"1LEHt$IHD$HHEHt$EI~HL$@DLAfHHPHD$ H$HHHHH1LJRHLOHt{HxttL$1LHHHHHD$ LHHH1dLHLLHHD$1HI~AH$H$pM HAA,$DjHt$ E,=pIH-oH$1LH1 !H$hH5nB LH$pH$hXZ2H$0HHt$0LSLHHt$(HHAI}LA,jM ELT$H%,YH_HH=1_LT$8j LH$L 1ɺH5fQfL=fL 1ɺ.L1Lh 1ɺL@H$xdH+%(- HĈ[]A\A]A^A_IٹLJ1H5 f!f.MMmL(LxIEPLHxHHtLLH0M}HL'LpIEPLHx~HD$HtLLH0AoM AoU0I)$)$fL踑H=H1gPH\$p1LL$@HAXAY@H޿1L=Ll$`11L3LLb11LKHt$HH; $\IH|$@1H\$(LIHD$(H>HD$(H  HLT$0HA$D\$I|$jE$A$,M$ Y^=\IH_ 1HD$`HLI1 D\$LT$0Aw41IH>HD$IH;_ HD$`HI|$E$LA$jA$,M$ LT$ =\LذIXZHt$`1ɺ 1% IvHT$8DLHD$(HLvHD$(H{Ht$`QL] Ht$`L 11V bHt$`Lq 11{ HD$HCH\$(HCHt$`L 1ɺc9 !Ht$`L 1ɺq f.fDfDHHG(Hh\LI4H5YDH@HkFHкP1 Hff.UH-1HLaT H1Ls4 ]ff.fUH-71HLa H1L ]ff.fUH-1H&L) H1L;'t ]ff.fUH-w1H/LA4 H1LS0 ]ff.fUH-1H8LQ H1L9 ]ff.fHcSH5UK*AHO@HLHH@HHDJ(fEIcL[ILfy(A@<fDI(HOHHHH9teIcL @LRIIf.HAJr(ft/Lfp(H2H0rpr p HrHpHrR HpP H H9u[ÐA@<{fDHHMH HDLPH51rX1Z[HfDI(HBAB A HBHAHBHAB A [HH) L LEH51HLE11HAUATIULjHHvPW\HILLH]A\A]p3HG`HE1HHyHtM\QAD1L: 1ɺH5NUO]A\A]@HHw\E1HW`L \PcHfHHW`E1E1HDPcHfHG\LW`~ HcILI HW@Htft9HIHE1ɉG\H`DE1LP*cH1ʐAU1ATUHHdH%(H$1HHH$HD$DŽ$H$H$JHIHILhLt`HHU`E1MHHPpbAXZLH谬H$dH+%(uiHD]A\A]DLD 1ɺ;H5SSAS릐L12H5+SA&ff.@AUf1ATUHH dH%(HD$1)$HD$(HtkIHHHU`ID$u\HE1H MP[aLHAXZ蛫HD$dH+%(u?H D]A\A]fDL1H5CRA>AUf1ATUHH dH%(HD$1)$HD$HHtkIHHHU`ID$u\HE1H`MP{`LHAXZ軪HD$dH+%(u?H D]A\A]fDL!1%H5cQA^AU1ATUH荧HtXHIHU`u\MHE1ɀH1AxfHD$8MhLl;fDMM[LHPIEPHH$Hx8IHtH$LHQ MEHLLD$`LpIEPLHxH$HHt Ht$L Aom Aou0M)$)$L 1ɺeH5=AtfDLjrLI4L=~=LU 1ɺL1AfLHuyT$jALER11| _AXL HHndL=<LGiLLI.1@LAiL*LI1Pf.I$I$H9HL=^<LXLL\$h1ɺLIL 18L\$fDL 1ɺ1H5<AL 1ɺZL=;1LL 1ɺJDL kH5;AIL\ 1ɺH5k;AkfDLgLIL=2;1L.YfLhgLWIL=:L 1ɺcfDLHH%b-L=:1ɺ1Ly L @E11ufDLf}LIL$ 1ɺH53:A3fDL-:LLLAHHJa1ɺLL xfLfL7I<L耢HH`L=k91ɺ1L9 LYc@Le&L7IL 1ɺH5 9A L 1ɺH58AL| 1p H5 H1Lt$L=8LqLXZfL=h81ɺ+LL0 XL@HH_>hL 1ɺB/L= 8L 1ɺKLQ@ff.AUAATUSHBZ@uHD[]A\A]IL-k@HHH9ǸHD!(HHHx. CLH{j1jLAE1p?ZYLq'HHuId$X1L}AŅLAMc%=7I11Ln7H5fHD[]A\A]ÐHcL$WIH5 11E1L[H5jHD[]A\A]@H{bL1ɺ]IH5+ 1+fDLԕeH5 hf1L 1ɺ#H5kHD[]A\A]ÐATUSHdH%(HD$1D$F[HHIHt$HH0&D$0DCL)EuuoH[HIyaAT1ɺSILH51ZYD$tHT$dH+%(H[]A\fDsoH[HIaAT=s5SIH5*L41ɺ1^_|@H`LI1H5I1WfH`L/IfHh`LI]ff.fUHdH%(HD$1HD$t'HHt$HuJtiHL$9uHT$dH+%(udH]H_LIH51Q1DL 1ɺH5)1HHF yu!xuHHFnuxuHF1DUSHHH.HF Eeu'}u!HHCH[]Uet/yt:suE}u?HHCH[]D}yuˀ}tf}eu}tfsu}yu }tyu}su }tyu}uHCMau}uHHC*au }yu}t׃yu }au}tH5HH5C HtwH5C HtdH5HtiH5Y` HtVH5c HtH5ٲHyuHHHCgHHCOHHC710fDUH=] SHHH.Ht%HH=l u*fD1҉CS H[]@HH= AEtI1LѐH5 1L 1ɺH5H1[]ff.HF ruxwuxuF Ðwt8ru6xu0F xru߀xuF 1ff.fATIUHH.H5e HLH HDH(HtH@HH?H]A\L 1ɺH51ff.fATAUHH.H5c Ht>H51 H t+H5G} HtH5D HE1AHD]A\UH.H5^ HAEtH5 H]ATAUHH.H5 Hmt+H5HZtH5 HE1DAHD]A\UH.H5 HAEtLUvtKlu}vtpptSH5LHAEtH52H]fD}gu}u]f.}vu}u]D}u]ff.ATAUHH.H5F HMH5 H6H5 HH5O HtwH5|HtdH5 HtQH5/ Ht>H5+ Ht+H5# HtH5# HE1AHD]A\fATAUHH.H5˭H]t+H5HJtH5HE14AHD]A\ATAUHH.H5HtdH5HtQH5dHt>H5^Ht+H5[HtH5VHE1AHD]A\f.HHH2H8kff.AU>fATUHH@dH%(H$81H|$@Ll$HD$0Ld$@M)D$)D$ HLHHD$P1LH1HL$$Ll$襀IHHHAE1ID$H$11PHATjH$贋AH$H HtHxWHDŽ$LHH$8dH+%(H@D]A\A]fL| 1ɺ=H5īAfLL 1ɺBH5A[vfDLg1JH5dA&A|ff.AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $1H~IHHHAE1ID$HPC11PHATjH$AH$H HtHxHDŽ$LH#H$8dH+%(uoH@D]A\A]L 1ɺH5AfLYf1H5ԩA~ff.AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $Z1HH}IHHHAE1ID$H0C11PHATjH$WAH$H HtHxHDŽ$LHH$8dH+%(uoH@D]A\A]L, 1ɺH5tA;fLd1H5DA~\ff.AWAVAUATUHSHH8dH%(HD$(HG@Hf!f#HUPD=vH:E"LDupHEX1Ƀ}`AA1E1HɃHASATVH5 Q1AQLpAPLSARP1RuHRgH`HD$(dH+%(\H8[]A\A]A^A_@H(FtHC@H1HH*cHC@Htf(tL% 1ɺ1L٦LHLL=L5I9fHI11LL+HCH@ Hxpt;HEPHHHx9o1ɺLILo1HCH@ H@HtHHL9S C$MLLЃEZPME11RHSY^HB Ht HH'LJ(&fDHHE1E1j1Hjj;H HUPD4$LDupE`H:E1ɃHEXDl$E1D\$\$HDd$ EAIL AL 1ɺ1LfDHUPH:HHG@Hf#tIf#uf(Lݤ'1H55Hfu f(tL4빐fuf(*ufufX*ufuf#tf(uFf.HH1E1PE1W0ZY`fH4.L9ff.gATSHHH6dH%(HD$1H|$(t1D$ACC HD$dH+%(u7HD[A\fDAL 11H5DATSHHH6dH%(HD$1H|$et1D$ACC HD$dH+%(u7HD[A\fDAL 11H5`,DHH606HHfSHHt { t [f.1LwH51[Hff.@SHHtS v[D1LH5`,1[H?ff.@SHHt { t [f.1LwH51[SHHt { t [f.1L1H5L1[SHH[t]{ LtaH9Cwu[ Lڠt>1҉A uvSu [L1H5О1[AL!1H5f1[fL)ff.fSHHtS v [f.1LB.H5 1[H@SHHt { t [1LBH51[SHH@t { t [1LmPH5h41[USHHH.U@uUH1tHtH+H[]ff.SH>HF FE1t C AD[@HF H>IGHff.USHHH.H5 HAtUH5! H.uC H[]HSt1{ H[]C H[]DHH> HfUH-4 1SL - HLHhdH%(HD$X1guK11L |9 LH_HD$XdH+%(Hh[]H1ҹPH5{H?HtjIL1H6 1iPHbTILQ1H8 1/fD$O@AW#AVIAUATIUM$HSHH8oM|$HdH%(H$(1H|$HBHL$HA$oJLHD$LAL$oR fod$fol$ fot$0AT$ oZ0fo|$@A\$0HB@ID$@"jr z0HD$PL$HB@B`L$AD$`D$pB`BpAD$p$BpHBhID$hHD$xHBhBtAD$t$BtBxAD$x$BxHI$H$HHI$H$HL$XVH<$HLVLHAV1LLHa1LHLaAŅtVHT$1LLaAŅAH$(dH+%(H8D[]A\A]A^A_LT 1ɺT1H5gDAL) 11QH5ؘ<|L 1ɺW1H5OeDAVIAUIATUHHCt?HEXHLIEXbDAątsHA]DA\A]A^fDHABLHBHbL}UI1H5^XZDH]A\A]A^D1L 1ɺlH5×'HD]A\A]A^AUATUHSHHB[HIHL-j#B=LI11Ls}~HC@u7HspL1ɺ,CAąAHD[]A\A]DHHxhtHx1BHH`0HSLHH@hHeXHDžAąuL 1ɺ1LtHA*ALK|1ɺyIH5T1HD[]A\A]H@H{pH@HLt|UI1LdXZff.fHtoATUHSLgHHMt LuH]H[]A\f.HM)1SL"|H5X1Z[]A\fHIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1LL$ H$$D$0L$HD$LL$/ȃLHcHw@HtH@Hf|(tHHH*Lq ARH5LL1XZHT$dH+%(u HÐLIHcz1@HIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IA@@I=DsHO@HtH@Hf|(ugHH= H=t=(~gt=u@Isf.IsH$L\$ $Ht$H$D$0L\$ʃLڋt9Q/vHHuHHH*LARH5LL1XZHT$dH+%(u H1 ff.HU*HcH H A<t4HOHHHH9tOHvH DH H9t8Htf~(tFHO@HtHvHHfy(t ADAUATIUHSHH^PdH%(H$1Ll$HD$LHHE@Hfh)HH@)f.HL$PH.HPHD$XD$hLE@D$lMfA.1ҾHD$pA$H|$PD$tAh/D$xHT$PHt$Hd0HKXHT$`LH 1LHG/1H LH ?St$lH<LH<H-HD:H1SILvH1g_AXDL$lELv1ɺ1H9L$xu!Ly:H=DH1(V4H5QHEȃttHƃuH5 H#LCXH= H$HEL LMIQLVLP1RH耶L<$LA@@tY1ҾHHt/=lMH(LDq11H5|HCH$dH+%(H[]A\@III*f.1ҾHHrtLA@@Q1ML^pH5 շ1_fD1LoH5܇褷1.AWAVAUATUHSHHhdH%(HD$XHAL0LhHXH$HM@ LcH\f!n!fAF4Afx+t\+FA@HCMFIVHpfLo1"H5螶L=ņ1ɺ1LZ LzLF 11L]H<$uHXHt1H JPHT$XdH+%(Hh[]A\A]A^A_I@uAdžDHSXHgHM@AHFAf1AtIEA9ADHE1PL=LN1LTHM@A[A_HCMFIVHpHcLHLE@MtgfAx(t%EN,1ҾHDȃAF,OfA(tAN,fAtHfEEM~XMLHGHcL@MVEEI}M~`MLHLD$nGHHpLD$HF\ L!vL=0 1L/nLH;H5 IHHKAIHJ *H)sAHHI9uLHH覴 LHIuH IuH AU  HIAMyHӆHcH>IAF4@AdžFAfDMN`L;MLHLL$ELL$HzLXMmAC] rIG@Hu fg L,4Lr IL=B1LLѮ 1ɺ1LE} EH;HG@Hf&1L9 H AFp1AAFpLmn HAAFH ujH;AhA H5m8_AX]Au "IHHWHCMFIVHpIFPIF`HkL=LmLzf.L< 1ɺ1LSfDAA@AEN,DAF0kHHH9.HAH9uLq+LʯD1Ҿ?D\L9IHJE~pE] EKIRAH(\(HD$A‰HHHHAMHAfEL !HͰ L[l,ELDL=1LѮL 1ɺ1L贮RAIH(\(HD$HHHHHAI@ t~AdžEAtIEL=L~Llhp(AFpPHf HV1LATARP1EH0A2MfXM%EEE~xqLlEH|$H|$DAA;HHDHDL ,HxjAIHHDL ,Hx$褸L<$=L=|I1Lk~L1诬EAZA[@AVt9r1EMEAVpnE1DAԅPD)Ѝ9<=L=W|HLk1PL1 EFE)^_EAEtEE IH@H)EfEfEtI@ HHtH5I@tpAH. L@(Hօt IVXH5}IF`MNPH `}I~HHHDMLDH1APLlRVH5:{WP1H0HHtYbtHE(fxCANDLHVHH I~PwHRHIVPjDAH(\(HD$DHIHHHHAA9HHDDT$$L=bzD\$HDL ,Hxj辵=LEH$1L(J 1̩A\A_D\$AMDT$EBfEE4 MfXM' LHAI~XAI@L=u1LeL:I>` L 1ɺ1LfDHIMAHHx3IHL=uL 1ɺL轤GI>EL=tYfL=tLE 1ɺL^fAvptBt<A9v)Avpf. xL_L=!t1L<AV1fD  E)DELd L=s1Li@A HHHH1H1IHHHH9HGI9IFHD$A9LAEM A,MxDT$HMLjH L=rrHt$ IHDL ,Hx$.1ɺQLI1L$$Lo`JXAMZDd$DT$DL=WrL2_1dL L՞ 1ɺ1LHHL=rDL ,HxjeL^LIX1Zi耡rAN IHA^+IF`IVHL lsL8bIH5`qHq(LE11RAZA[tH;HDLL ,L= qHj芬A[L)\A\IL1裠Lo 1ɺ1L膠$AɺB1L=pLA LWfL99IHJA@\IH@ L=7pLY1LfL 1ɺ1LßafDI@ L=oL1L:`耟KA9_D1A-B9Hr(L=uoDHL1LM[#AYAZwf.cD1ҾHAąoH` >LFH|$0jL AULcH 1H5p1蜯L|$X^1_|$0HT$,L" AŋD$,Et AAA1Ld$@Mt I谥LXEf.L=WnL 1ɺ;LfL]L=n1Lٝ@L=mL 1ɺL讝fL=m1ɺ1L\ L|L[7kf.L=wmLz]1L)@HMLVL=)m1L^_DLIAFIFXHJH;+AL=lLX 1ɺLq@LXL=~l1LA@LZ[3fIIL9gHH@HIF`DIFXpL^fI@f.L| 1ɺ!L=k1L茛*HLTIL=k1LNifL 1ɺL\f.ADHt$HM؉jHL褦A IHH DL ,Hx$aIHIDL ,Hx$Y^AUAWIL=}j1LXLJ/_AXVL=Gj1ɺJ1Lܖ LL8LSIkLVbLH,HtH@HD$H ML[ vLLD$cPLHLD${LcLzTILX5@LLLD$0#LD$#LK^LSIL= iL 1ɺ-LL=hL 1ɺL虘7H`L H5- LHH1eL=hL% 1ɺL>YL=`hLR1@LLLLD$-LD$LL=h11ɺRLILR1IHJM2LY HMLPsLA 1ɺ1LXsLXLJRIDHH贬AwAVAUIATIUHSHAH_tqH[PLH *Ht6LhMt-LLH/AătWA[D]A\A]A^DIٹf1L YH5fyA[]DA\A]A^L5f1mLLX9L!MHH tJ1ɺLH uLTL`hLIq1+@L LXLIo1譕ff.AVAUIATIUHSHAHtqH[PLH(Ht6LhMt-LLHvAătWA[D]A\A]A^DIٹ1LXH5Ae A[]DA\A]A^L5e1LLWɔLKHH tJ1ɺLH0uLLfLI1q+@LL9WLI1=ff.AUATIUSHHH/G$E<+<-u2HC 衤HUHDPuH1[]A\A]D1@c LHI芪I9,$tAUuH=vdCH9vVHH9HRHFHCK HSH[]A\A]fDHAf.CHfDSHHHdH%(HD$1HtH$1:u 1{ HT$dH+%(uH[&fDSHH5< HH;dH%(HD$1u1HCHT$dH+%(H[f.HH%tAH$8u8{ t2DKAvU1LUH5Ha11Lڎ 1ɺH5#a1dCUfSHHHdH%(HD$1Hyt%H$8u{ tH9CD1HT$dH+%(uH[æHHdH%(HD$1H t H$8HT$dH+%(uHrfSHHHdH%(HD$1HtH$1:u { tHT$dH+%(u7H[f1L!cH5_茐1USHHH.H5g`dH%(HD$1H1teH5' Hu*C HT$dH+%(uDH[]HHtH$1:u1{ C 5DSHHHdH%(HD$1HytH$8u{ t1{1HT$dH+%(uH[ˤff.ATSHHdH%(HD$HGpu8D`Avu-HHt&H$8u{ tE1{A fvt+E1HD$dH+%(HD[A\fxguL#H5^L蘜t$H5 L腜u!C AfC A뉐HHEAąrH$E18bE1{ AR襣DAWE1AVL5))AUAATUSHdH%(H$1H|$HHcHHD$H*HEl$E9|,EHE)AEIcIH8"yE|$E9}E9IcE)H5IH$DLI H6"HHD$ Q*L=M1ɺ1LAفDH=]F!H H5E1pH+ILNEL1uMcHFKHHD$@AVAUATUSHIՃtNH:1AAI|11EDH9HD[]A\A]A^@H:H5PH|$f9Ps}L4$/LD$8L$4I~HD$IH1/H_AD$>I~HL$4LD$8fAGIFHHT$H<$HHGPHBHGPHHWPHD$fE(JlE(ft AD$<fAT$:fHHHHEH$H@ @ fw>H5OOHcH>Hcft0Hft"H'fetHHhHHD H<$HЅE(fE(HdftH6ftHftHfuHftwfetfnHvHkfdKH8G:~]H1AULMH5SIzXE1ZH$("dH+%(H8"D[]A\A]A^A_HcHIDH$LEH@@H5H1yE1HL$HA)HHL$HcHH]$HHML$0H5vHLvL1>yY^D$AT$It$H L .LHLDVPRH5H1xH E1LKH5GxE1I@HH L K@t4HLCDATPRLDH)z IHz I+H $H5x H=x ޅyfHG@HSfhHtLJ($t H.ftH+t#ǃǃ҉f tH [fDAWAVAUATUHSH6LE@MfA(-t DžAh/fAtp(HXH?H&fAhtDžHDžHE @ t@ t'H 1҈Q9H 1҈QHU JH HH ‰H,H+H HH#H H HE@HHt7fHfHtftH1ҾZHHtH5D} <f1ҾHTZH]@IH$Hf*tzLc`ftyH5 L肊 LQA1ɺ 1LrAH5DtH]@Huw1f.fuH5 L tH5c LnH5L߉ L.AHtf8fh  f%ҾH 1҈OA1EUH 1҈XHHH5u{ HtH5" HHE@HHnfHt)L MA<$NH u HLLLfHHt :H]HLmHI9L= 3LL`hHHtLHL9f0tLMtL,聆H}HuLL-fuL?" H5A1MrAHD[]A\A]A^A_D@L% H@L؂LH}LhLyHLLLH躊LHHE@LHmHU@HfHfDHDž諮H蒮HE@HAHHHHH@HE@Htvft Džft3HH,1ɺ8rH HZHE@Ht%f(tfht DžHfHfHtfHZfH@foH&fqH fWHe=NHe#DHe HeHE8pu$xvuhH{eHE8v'D`AgHEefDL%>HLML;11 H5=LwnfLA f.tLu; LA4 H5;=AnHDž Lt;E1AWAVAUATUHH= CSHHt 8HVLm@M,1fAxxHE(H5o L LڂH5p LÂH5J L謂H5n L蕂t1H5H L肂tH5 LofA8L5AL%;fAxMPLHT$ AT$ HI3H@H$ L1PL &A1L@clH8LXZH@Ht*1 fDHHPHt92HPHHuLH-FADž:Lm@MHt@HH@IHH@Ht)1@HHPHt :HPHHuLHEADžHAv11L @J LL?UkH8Lm@LAYAZMfA8IHH @IH[H@Ht)1@HHPHt :{HPHHuLHDADžHAt$` 1L R?L>1ɿH59jH8LXZHADžAHD[]A\A]A^A_DIL%h911L7 L!jLm@M'fAfAt>HL%91ɺ9 1L>LiLm@Mu_1L%8HeHF SL ">L=L1liA[[@L%8fAtIZffA88HM&L%B8+HPH3HQH@H@THL }=LSLM=@ 1E1h_AXRL0,@HPH%HQH@H@cLDe 1ɺe 1H57WhfH5*i L}IH5l L}2fAHL%-71ɺ 1L<LgLm@MY1HKHFHT$I4$ID$HFHHVHT$0HtHHt H9HH1H56MPL61WbHHD$8Y^H;\$(H\$Hf.1LO11ɺpH5J6L-1bL|$8oHD$8L0M&L9uKI$MM98IInH1HHHPH1HHHu}dW HUHH9HRPL1MR1ɺwH55aIIFHBHXZ_HD$0H@apXH=>IZL~# HHD$(HD$@H\$HL Hl$@L-00L9d$@DML$M1gH543aM$$I9ueDH H@HD$@L WvHHG(HxLYH5 WDH@HkFHкP1`Hff.AWAVAUATUSHHH|$HH$L$dH%(H$1H$H$H$HD$xH$H$L$L$LJVDaHD$HH@@HfH|$H$%=u>11ҾPu,L1 LH5 3z_HD$Hp2H|$Hd HD$HHHD$Ht8Hs7u,L/ hH52^HD$H1HHHt$hHH9t HH9u耳H\$HHHD$HHD$HH@@Hf t$ DŽ$H\$HHH dHH1H9l$hLt$hL|$HfHmI9LmMt1LmtIEH;L92LH11H޿LZ3]1LLIHuA}dDS IUHL9LJH1HPL,31h]HmXZI9FH\$H11L$L=0HMaHH$HD$`L+H9\$hLt$ Lt$hLd$(MLl$HHkHEdHT$`HL詞DKE*)Hs0HK(Hid HS {HHDHHDHHDHt$HL$H$N=/LS2IH)PHt$1VHL$LQHT$1R*\DŽ$D$8H rH$"IHt2II9ufHI9L;XufDI$LM9tvIL HD$Hp2-LQbH5!/1t[H$dH+%(-H[]A\A]A^A_Lt$ Ld$(Ht$HHH9HD$HH+HH@@1Ht 1fH\$HHt$xML$HH$LHt$hHD$8H$H$H$HD$pH$H$HD$`L$L$H$H$H\$hH|$8H{HD$HHHH@H$H$HD$XHHD$PHT$@H;D$8H$DDmfAt_HD$@L9tUIH@Cft6fA9u0H} Ht'Hs HtD}D;{uoHIL9uHmH,$H;l$8uHl$XHt$8H9Hl$@HmHl$H;l$8f}uHD$@L9tIHHIL9tf{uLm0MtLc0Mt܋M;K $uLiLLHn $uLd$M)H{HM L{ HMTHLH $nHU(LC(H $H9M%LHHL$LD$H$mLD$HL$Hs0H$H{MHt$H_ LD$LDHL$H$=ƦIH/)PHt$ 1VHT$H5x+RLD$(WAPHL$(L/Q1AWWH0HUHEHBHHHCHBHH$$HD$pHEH$HEH$L H$L$$HD$`HH$HCH$L(H$L$HD$XHD$PH$HD$@AE/)H{HU0L{0HMtHLHT$.lE1HT$AHM(Lk(HMt1LHHT$D\$HL$kD\$HT$HL$EH$^ MHS {LDHHDMHT$LDHL$ =L-IHHI)H5)P1AWHL$(Q1AUHT$0R UH0HUHEHBHHHCHBHH$#HD$pH$HEH$HEH$HH$H$"HD$`HH$HCH$L L$&Lt$Ld$XHD$8I9Ld$Ll$MHD$@L9teM~0LHMIfDMt9Hk0Ht0DaD;cu&LH $dHLHjH $HIL9uMIM6Lt$L;t$8uMLt$HT$8H9T$PHD$XHD$(HT$@HD$H9=HD$(HT$IpHh Lp(Lh0ft$0fD$HtHHi$Mg(ME1MtLLniE1҅AIO0MDT$HtNHLHL$ >iHL$ DT$u0AGf9D$0u$$tHt$(DNE9OuEDM?L|$L;|$tQI_ H41HMg($MKE1MIO0AM]HtM?L|$L;|$uHD$(HHD$(HD$PH;D$8Lt$HG)Ll$XH-&H$L%Z Lt$}fD)I]0M}(Mu A}HIDMMDMMD4$HSILX,AW=RAV11|RH MmL;l$8EMEtH<$@1LH?iaf.MEIEhU)H{EL$DSM\$ Lk fE9AAElj$MNMNLLDD$0DL$(DT$ L\$#gL\$DT$ EDL$(IL$(HS(HH,HHDD$PDL$@L\$0DT$(HT$ HL$fHL$HT$ DT$(L\$0DL$@DD$PfE9 Hk0MAHX H$LDL(1ɿIH-)H5$P1UHT$RAUPH ^LE*)H5qX HHDHHDHHDIf=BIH)1PH5#1L)AUUSLPHt$HH HHFHBHIIGHBHH$q"HD$pHT$PHH$HFH$HH$H$6"HD$`Ht$IH$IGH$H0H$H$HD$@H$HD$PHD$XMIL$(HS(H HtPHHDD$PDL$@L\$0DT$(HT$ HL$dHL$HT$ DT$(L\$0DL$@DD$PfE9_HHV L{0HDHV MAHT$(LDMHL$ DT$LDL$DT$HA=L'IHHۖ)H55"P1AWHL$8QHT$H1RL\$(ASAUUmNH@I$ID$HBHHHCHBHH$ HD$pHT$I$H$ID$H$HH$H$X HD$`HH$HCH$L0H$L$HD$XHD$PH$HD$@tE@?LDH=ԕ)du@LD1?H=)dAGI_ Io(IO0H$Lt$HD$@H- Hp)L-T L9t$@Lt$Ld$@H$}fDA)I\$0Mt$(M|$ A|$HIDMMDMMD4$HSIL&!AV=vAW11LH M$$L;d$t4EL$E{H<$@1LB?c\Lt$LLt$hLxHt$`LkH|$8H|$pHD$HLd$hHI9u=HI9t.HkHtEatuXH=BEH HI9uHD$HH@@HfH@HT$HL|$hHLmI9"L5XS L%'H)DIELM9IH}uDME )Hu0HM(HU }HIDHIDHIDHt$HL$H$SHt$=șIL&%VHL$L1QHT$1RJHEHUH H} HBHZH}(ZH}0ZHLZIEDŽ$M9HD$HH@@Hif$TuHD$xH9$z H|$H3 L m|1ɺ1L$H5 JIT$(Hk(HQ AHs0DT$0HHDHHt$(HDMLDMHT$ LDL\$蕽DT$0H$A能=dL0"IHH)PHt$81VHT$8H5 RUL\$@ASAUHL$8Q1MIH@H$ Hp2YfMf?fx1f#H|$H$%=%11ҾoL ^H5=HDHZH-ZH  HH]t9= IٺHL1UH-1HH_AX=+j=ƖH-L j1HL>1GH/HD$HH@@H/HD$HLL9d$hH-4H̏)L-PO )IT$0M|$(LMt$ AL$HIDMMDMMDflIt$MHtHHGH9>LIHLB#1HSRAWAVP1FH0M$$L9d$hEL$ET@H1L@=?$^6HBH-9L 1ɺH}F4$ {EHk0HN MAHT$LDMLDL$ =LyIH1HF)H5P1UHT$0RL\$ ASAUEH0pL rCAɺL@<@?H=)]HhM!HK0LQM {MHL$H>M LD$LDH$A="H5IHH})PHL$ 1QHT$1RLD$(aAPLAWEH0YD$E HD$H L1ɺ 1H5pDH fE9Q L{0H mL HHCHBH{L;@1?H=)[EL:@?H=)D$[D\$?t$HCHHHH9HRIHL9LHL$H1LRL1CA[[E1H4$1HLs1ɺLLW@ CH|$HLLE=Ht$HHH1 )=TeH-Me=IٺH-11L9HBME{HJ MLDMLD衶L1ɺIH)H5CP1AWAUs BH Lt$H2(H%J HHs {HDMLDHHt$HDMHT$LDHL$=L_IHE)PHT$ 1RAWHL$(Q1AUHt$0VH5|AH0Lt$@H1L/8?YTE8E/HHEI Hk0HDH6I MAHT$ LDMHL$LDL$&=LPH5IH])P1UHL$(QHT$81RL\$ ASAU@H0E1MA0Lm(HH H}HDL} MHT$LD蕴=vIH߈)1PHT$Le1H5%RAUAWu@H HJHH>H95HRIHL9LH=LLH11R@AYAZ4H|$HbYHk0HG MAHT$(LDMDT$ LDL\$蜳DT$ H$A芳=kLIH͇)PH5#1UHT$8RL\$0ASAUHL$(Q1^?H0EEHk0H G HAHL$HDMLDH$=ߍLIHH:)H5P1UHL$0QHT$ 1RAU>H0cHD$H tLC1ɺ1H5D>LQH5r>=)IٺH-11L4H7> MWHK0HE HkHjL: 1ɺH5=iHEbHk0H E vfHLr: 1ɺHH|$H11HNHH C1HLH|$H1HHHHD$HHH@Htf HH|$HHAHImH|$HgL9 1ɺG1H5i<EE1fE9Hk0HbD HU(LC(MHM\Hs0H/D H (D )L AiiHU(LC(HMHs0HC fL iHU(HC }L}0HHDHHDHT$H $ů=LIH)PH5^1AWHT$RHL$BQ1;H =YH-&L M11L 2Hc;HD$HHH< *L1H5;fxfƄ$@)$ )$0dAHD$HH@@HXfxJHP1Ht+-t!Hc4Huރ L11]H5 a:Hk0H B HHO=IٺH11UH- L0H:Y^fE9Hk0HA HA HHK {HDMLDMHL$HT$LD菭=pIHHҁ)LcPHT$ H5 1RAWAUHL$0Q1e9H0}HS0HG {MHT$HA LD$LDH $ =H5 IHHF)PHT$ 1RLD$ jAPHL$ LEQ1AW8H0"HS0L@ {MH@ HT$L$LD臬1ɿIHր)H50 PHT$1RLD$OAPLAWl8H HS0L#@ f9fHLM`HW;NA<$CL[AfH5 H[FHD$HHH9l$huOHmH9l$h=Lu MtfD;muHLLuLeMt5H|$HL褚t HD$HH@@Hfh/Lu HUHELHBHEGH}(.t@H\$H11H}HHt'HtHC@H]fh/OH} QH*H5P H>Lt$H11HL"}IHtlHLotIF@H*fh/HD$HHH9D$hteHH9T$ht6HJHHI9uHUHEHBHJHD$HHH9D$ht#HH}(Ht H'EtHmH9l$huIL&1H5./ L 1ɺ1H5]/L$, 1ɺtHu(1H= CEIٹL +H5a-=CH $H5. H=(. H;AUATUHSHHHtkHL-QZHtH9uGLo=I=KT%HDPuH[]A\A]fEH[]A\A]ÐLhf.L-YAWAVAUATL%G$USHHXdH%(HD$H1HG@t)t)t)t)Ht'f'tL 1ɺb1L濄l,HUH踂HHHHE1>Hu)GHzG H) HALHDH1P1'D o)LLAHE11H$'Y^LH?LL1E1&M'm1jLL 'q<HuHG@Ht;f,t1HE1E1HP苃ZYH@1L H5&DHHG@Ht?ft51L1ɺ>H5gT&Hf.HH1E1PE1ZYHAWAVAUATUSH8LiHt$AuM}H|$HT$dH%(HD$(1LHH?HhH2HEXH"H!L Ht$ H7H|$1Hv H辣~IUH|$H@AMH ' L KIULH51LDIEt$=sR^AQ1P1$H HT$(dH+%(H8[]A\A]A^A_fLt$/L5MHXHIIDL9u1HMDt$ L4M$$L9tMt$HIFHxH9uHD$L=BiH-hL5iH5iL x LB71H5#L 1ɺYH5#L 1ɺ\H5#HM1t$ L\1H5uY#XZaLMH>L+8ff.AWfAVAUATIUHSH8dH%(HD$(1)D$HD$ ^L*LbLIL3Å)/L6Ht&LH輏IHtHL7L/t3L/HPHLE\3HHPLEA}-A$I<-LA};2LI)02L9A<$La4L3+L2LL07L\$1H}LxLl)HLLH:LHD$1H}LhL8)HLLHQ:1HHD$ IH6HD$HE1LID$H11PAHATjLHD$,H D$ LIU<-IջL1H5 HT$(dH+%( H8[]A\A]A^A_@I4$1Ml$/Md$ILC4HLHoHHxLH5eHMSLfL1H5@/fDMeIL| 1ɺH5Lf.HMAWLv1H5O3XZLH5U@HMAWLv@1MLZH5Ly3ff.fAWAVAUATIUSHHLo@MtfA8M1HHID$(@HfwHHcH>f.LVH5(1E1HD[]A\A]A^A_Il$@1HtftHHCxH f&C1fh/C1f$C 1fC1f tHp HMLH5= E1x2LAƅHh> LDL.HCHH;Il$@Haf))iLHdIl$@ClHCpD$ Hf+fH{$E1HresizeHC$L= GfDG GCIl$@Li1AƅHtfHmanageC<HK41fK@CB@T$ Il$@H&fX'<'ChtP'SlT'Spf'H'HS`H'LCpSl2Il$@HtZftHHCxHt D$ ~DIl$@D$ XIl$@HuD$ H{$1L= HchecksizHC$Gefw GqHIl$@HClCE1;vf)&=hAL 11H5J'HfHHH5 H:/t*H5G& H'/tH5, H/H{4H/C HǃMJCTHCXAqf.(PE‰CPf&tP|&CTtJ&LcEt't"LtDCTf&^H&AHCXH&LAfD1Ht 1f)C[@E11f^1E1H-jLCHH1L]_Lq1H5f LpMH5 LL= -tUH5 LL= ,t;LL,t,H5* L,CH{$<DH{$L-CHC$@f&f&E1'@1ɺE1L H5 1HfLf.Lqf.AUAATUHSHdH%(H$1HHtO1HzIHtbHXHHU`HE1MHPrHLHAH$dH+%(uHD[]A\A]ÐA+ATIUHSHZW\HvP~HHHLHBt@L訏dIL11VH5p &fD[]A\fDHG`HE1HHHHiL 1ɺOH5 LIwcu+1Lz1ɺVH5 []A\1LO1ɺVH5 _:IL#11VH5{ 1 ff.AWAVAUATIUHSHhLjW\dH%(HD$X1HvPHIHHEXt H$UH%r @{HEP @L0uRL1H5 vHT$XdH+%(tHh[]A\A]A^A_fDH萿HE1E1jH1HjLHD$8PDT$ D$^DT$ @HZ(H4H LSI1H5.  XZ1L 1ɺ"H5 L1ɺ1H5K. g 1L1ɺ%H5F @ALf1ɺfHPXWLBX$HPXgLBX4L 1ɺ1H5  f.HЃfHH H*Xf1LZ ~H5U L=I- j L6 11LM L=- L 1ɺ!L fL=, L 1ɺL D!@AVAAUATUHSHdH%(H$1H\$0H41HIHHXAHHHU`E1SMHhZY$Aƅu\LHIH$HtH$Hu_H$dH+%(HD[]A\A]A^fDA.DŽ$ASL%՟ 1I1L+V L濄 H 1H|$jLc1H5SL QH UQH * QH  RHl$XH01ɋ|$HT$ HqLl$ Ht H}{L#D$ g L1LA IٹLLh 1 fL1H5A =A]DIٹa LLAI ,ff.@GAVAUATUHSHH@dH%(HD$8HG@H/f!!D5E-L-L%]uE`E1HH{HpLjHDtZYIHEPM=V3H51HAVAPLuHP1SATH0HD$8dH+%()H@[]A\A]A^HwtD4EHL$HE1E1j1HHjjrDH |$HHtE\t;L-|fDHL%7 vE\HLDbuhHt$ HP-|$ u!f1fDHH LtZݸָϸ L-:L%=AUATUSHdH%(HD$1D$$FYHI1ID HL$IHEQtq|$tjHDCLʼnE蹎.M1PL1H5sXZ|$u61&1L%H5o1HT$dH+%(uPH[]A\A]#=4TMPH5"1sL+1AY^[DAWIAVAUATIUHSLHAA@I@(HMLLPAH!H8EAtOLH责IHXHC(AH@Ht!LL$E1LLLHAƅAEAHD[]A\A]A^A_HHHHHC(LLHPAƅuL 1ɺM1H5fL 1ɺV1H5xf.LLLHPAƅNL 1ɺf1H5x.1LjjH5O|HC(LLHL$HPfL_H51E19@LHff.fAVE11AUI1ATIUSHHH6dH%(HD$1D$ jLL$_AXHHsHHHt&LpMtH{HLIE HSH= HL11RLH5A@XZHHt(>#t#LE,HLHHD$dH+%(uHD[]A\A]A^fIE H=@t HI#VX$LrIE(LHSLLE1P:HAH83 fDL$1ɺH59?@H}@E, @HLKE1D$ H5LP1Y^DIL1ɺH51AkfLKL=1ɺ@LT1ɺH57iGff.@AWIAVAUIATUSHH8DZdH%(HD$(1D$ D$D$E5HH3LjDD$1LL$_AXHH'HsHHrL`MeH{HtLLIG HtHI#T$X9LoHKLLL$ MHLAą HHt3>#t.LE,tH}@E,HLHl$ EEWEH;1E1uHHAƅH3HL$HO LnUAą{LK1LTH5KyfDIG HS LH= LL=H11RLLAXZHHt3>#t.L/-E,tH}@E,HLHEH3HL$H L\T1ɺLL!Iw@L 1ɺH5!0@L;mH=\tLHD$AHL$u HD$D |KEuuKlKH|$HjUCK5KuuL襟LI1ɺH5,^fL1ɺH51 @sgfDH-1ɺ1LHE1LK1LHHD$(dH+%(?H8D[]A\A]A^A_LJ12H5F|苞L/1ɺH5D}IѺLM1L=1AL H3HL$H- LQ 11LH5ADD$LK=LIL=FL11LA\=ILKL1f.L=1ɺ1LL1ɺLL YL%1ɺLL$L1ɺcL=x1LE1H{pt1ɺLLL=6L1ɺLLL$L=L=LLL$LLx_H\$L=1L LPIDIٹLLbQ1!L=aL1ɺLL^LL1ɺw1H5 Ht$0Lx114LY1ɺyH5nML61H5] 9I1LH5'< LL$<LuHH1HA H H9tDP HH9uMt+LϺLL$H5%&LL$Hf LDU11AUHt$@LrHA^E1A_HNHA H H9tP HAH9uH C1DLLH5k ]A]fDH$/L{ LL=L1ɺLLL$ALRkKiff.AWAVAUATIUHHHW@dH%(HD$1H$H1f-f/fffpAft1H7IHHIFHE@Hf!aE@f-t.H5, HAZ#tHHE11LPADHAVDL$T$H HAH D)LBHDAHE=)H4$H5J1RP1H LHHD$dH+%(HD]A\A]A^A_f.EuAFt`@&1E1LH5ActfDEAVLALf1H5bALH541A,ff.AWMAVIAUATMUHSHHdH%(H$HG@H.1fxX$f8&$D0&A1A$1ҾHH5tw=(0uAuE1DH=YHHtۀ8>ts1 HA9uH/Ht@P8t4OI1PH^ LPH5 1wXZ/c1Hx IA9t82_LAQLU0 L PHz PH P1 DH 8IكARL/ WLPH` PH P1H fDUHSHH;H1E1HLI HHQu" t5RՀ4wEIr1H[]fDuAHI9uDEtԅuо<{uEttDESHHdH%(HD$1HH$u8H$H HH%H)HvCHT$dH+%(uXH[DLT1ɺ71H5lgD1L*1ɺ=H5D?1fDSHHdH%(HD$1HH$u8H$H HH%H)HvCHT$dH+%(uXH[DL1ɺL1H5D1Lj1ɺRH51fDAUMATIUHSHHuTHHt<;1HH9u+;LLHxI9H[]A\A]H1[]A\A]HLHL[]A\A]XAWfAVAAUATU1SHxH$H$H|$(H$pH$Ht$0L$8>L$D$L$L$`HT$LL$LH\$ HD$dH%(H$h1LI@D$H)$`HD$XHD$PHHL$dE|LϦ10F;$`H5A%r0N*>H LVM2 x[H3$lH3$dH H|$Aă$tt0HLǼA1j1H5XU_AXL;$xt/H1H56AAUL1Y^H$H9$sH1A$L1H5XZEHD$$H$1ADHIM(HD$PPHD$`PHD$pPL$qH IM@ADd$HHD$DH$HD jjjL$,H LL$XMO|$8H$HpHH H|$ ILLH$WOHT$Ht$0ILL$H|$(H1fH$`H=E1趽HA1PLu1H5B=AYAZ@HAL1PH51A[[7f.$81H|$LRH$HpHHUH|$ ILLH$YH|$H5:} @IHIH$LHH5Ht?He1$LL$ LoH5  A]A^$HLL0D$$؃Eu f.1H$hdH+%(Hx[]A\A]A^A_DEfMh1fDHHXA1AUL 1H޿;A1ɺ $pL'H޿$1XZLHt$`RHA1PL H޿1A1ɺ$LH޿$1Y$AL1ɺ1H޿^$AL11Hc_AXwM1ɺLڶH5661qHML21$XH5HZY,@HD$PLL$D$LHpHD$LL$HH$HD$KT HT$LH9$ILl$L$LLL$(HT$H|$ LLL$(EH4$L|$DҿϦIA?D$ AA9t5jL81ɺULL$(H51AZA[D$ 1@D t$8HHH4$LH;#L}MkM'Mt LfIIHtHT$LH5* HaEpLDH<$wHot$ fD$L$LLL$0H|$ D)HL$(HL$(LL$0AHD$H|$ LLL$0ID$<+$F,H$HT$(LLdHT$(LL$0DT$<_HL1AURt$ AQAjH5H0H<$f.HMLz1$QCL1ɺU1H52-1hfDL1ɺo1H5"f.L1ɺm1H5Իf.L%1ɺ1LLD$ ED$LH1ɺLHLPHjP1AULL$8YD$XH 1H|$H|$H5v IH_H<$HLLJL1ɺ1L`HLQ1t$(t$ AQAj fH1ɿt$L%LL$(LLqD$0HAXAY@Ef1LLv 13H<$zLU 11L D$LMLH1ɺPL1ATL%йAULL$8Lƿ|$XH oAHL]11t$H5AQAj耿H|$ H L91ɺ1LPIH#EtD$L1L%34@E1{LL$1_LH5H1'L1ɺN1H5ɸľHLL$LL<1蜾't$AL1jH5oo[]HFL9w fDIHL>HH5"HR AQI1 1HfAWAVAUATUSHH $HH $HxH|$HHHHt$HT$8HL$@dH%(H$h 1t$0HD$HHE1L$`L$_1DLHAH@BD=EDC>< IIuHAALHt$\L$ LL$YLL$L$ u|AH;L$v|$01HD$@sH0HD$8Ht$H0H$h dH+%(Hx []A\A]A^A_LcC ,L~e@Dl$4DAADH|$LITHTAGHDH9D$THD$`DMHD$@1LHH|$HfDTLc؍HB ttHH=uܹA$`HcAHō;D$0gHD$AN4FE1M\$ 1Dl$$EMHl$(L+ IcA\`L9t*A\$I ttuˀ uL9ufIcHt$L\$ DAD ` Hl$(MIcDD$ Dl$$DD$ DDH;D$D$4A܍C9D$0|$4DfDA\AHt$IATHt$fT4fD#LKH-DA VH|$BL1ɺ 1H51VH|$L̶1ɺ AHt$ATTD$4B C#T$4Ht$HDH|$Lq1ɺ nfAWAVAUIATIULSHHHFPHL$LL~I|$LxLHLLH6IEL{HLFI|$LhLHt`LLHoHHD$HEoKMoS U o[0]0HC@HE@H[]A\A]A^A_HD$H1LZH5耸H1[]A\A]A^A_IEff.AWAVAUATUSHH $HH|$HH$IHL$ T$XdH%(H$1H|$@HHF@H$H f HD$0t H HD$0H$fX HD$ H5 LHHD$lAE}A$tLHt$LK Ht$11L"H$HID$@HD$(H)HD$(fHHD$8H)HD$ H$ HHHD$=$8%= HD$(H$=`f H I\$HID$HHD$H9t&Ld$PIfAM6L9t$uLd$PID$@Hf$fXl H$HD$HH8Ha11(AƅH$H$H$HL{LqH$HH^(HHD9 DDL$b}#H$H$8HUHIDP t$HUDP tH5| HRH9#A#HcÀ|u | L-1ɺ_ 1L3LH$HFH5 HHWoXHt$HHH^oh)\$n,@&F<A$fF@HϦ/HL$HHYHiAfH$HI$1LA$HA$I$1LH$HHP1H$Hߺq I$1H$LH H|$8Hr A$H5}(H|$8H5 H|$8H5H|$8H5tÅ_ H|$8H5DH|$8H5^TI\$@L$Htf$-H$H$L M 1L1ŅH$rL$M LIH$LHƉD9EM1L-_Lo LPLXRfL1ɺ> 1LH$dH+%($H[]A\A]A^A_DIHX1fDHAI92IL$ L$1fLLLL$H5)$ )$0)$@)$P)$)$)$)$达D$HmetadataH9$ $ seqn<Hbackup_fH9$ Hmda_offsH9$ DHmda_sizeH9$ tHmda2_offH9$ Hmda2_sizH9$ THdevice_sH9$ Hdata_offH9$  $ pv_u$ mda_ L-.fD$(_offf$,se$.tHT$@1H5 Lc$5D$$o1H$H5tL L!Ld1ɺL-~1LtML-L11QL1ɺZ1L4L1ɺ f$(il$$*eLLxHD$PLHx赶HHAA[ Et$A H$ f$Df$(et1H$H5 LL*1ɺ1H$H5W L读$@H$f(NH$H$HD$(H HD$@HD$8H HD$(HD$0HD$@f$(se$*t1H$H5 LL<1ɺDMS1L-=LL.fL1ɺDHAjLD$8HL$LHT$@Ht$PA\A][f.f$$uie$&dW1Ҿ-LT$\1HtLT$\蜼T$\H [ $tL1ɺ 1L諣GH\$HyHILP [HD$H LQL'L FxHD$xE1HDŽ$HDŽ$HDŽ$HDŽ$D$xPH$PH$PH$PHT$HHt$ H|$PL$qD$H E j1ۅLE1E11HD$xP$$t$Ht$(Ht$pH0d H$Ht~jE1E11LHT$|R$Pt$Ht$(Ht$pRH0T$pt8D$tt09t,LС1ɺ1H5L1L1ɺ H5诡ECD=fBD:HD$tH|$011HDŽ$HDŽ$HHDŽ$H HDŽ$D$xPH$PH$PH$PHt$ L$L$>o$H 4L-H$H<$HHH HLABELONEϦDŽ$ H$H$HLVM2 001H$HD$0H$1ɺL$A1L3VID$@H f(-D Lù1ɺ1LD$ D$"L$M¨E} LefL$HL$0LHT$HHt$@|L-1ɺ 1L\L| H5HHH$H$LHDŽ$HDŽ$(H(fo$$fo$$$L1L5; H$HrHHfH9]LHL-11ɺ}LL}ID$@Htfh/q1H=ϷgrL9t9LHL1LwE$L %L HL1$LS1L$^_H(qHLIPL1r Y^[HL1L$1L$艚AYAZ HT$tE1E11RLHT$pR1$PjAWHt$pqH0HT$pE1E11RLHT$lR1$PjAWHt$p3H01H$D$L-H!EALL$xH$MM9HL1ɺP1L艙XZHML1UL1bHudA[HXH Ht$(H<$IHLHt$@IILLL HlHnM9E1$  $SL-A*L$H$M9MHL1ɺPHML1ULTH\AYAZ1E1M 1L-LL1LK1ɺrH5D$E1E1L-11ɺj L]L蠗ID$@Htfh/1H=wkL1N L#gILĖL1?fh/H<$HٺHTAEL1Lu裕M LL-~1Lt'c L-TLʑLJf|  ?A<$#@L-L=1 LLL1ɺ8 1LʔH95H'H$HuMLD$  $AL-pL-c1ɺQ1LLDL$FDL$hH $HkHH_H9VHp1H=hAIJL1ɺqOHD$ LH0tL1ɺj H5֌֒E14H5H+MAASDD$t9~X{AH$HH<$LDL$DL$HjQ-f.L-1N LLّL1LO 蹑Lj$  $L-D$pt"Lt$xMtH$L-ZHAPL-H1ɺhAL1LZAAYLAZ1ɺL1*ID$@HffXhL&ALƠL1ɺ L-1L蒐]H<$H$HDŽ$L-iyH$H HHQL1H%LLَ1L)MU^L{_1ɺL1>L! H5LGH$H$LLHH5QE HTHHXH$HHH0H蠥iLPH$CZL1ɺ 1H5 L-11Lċ Lߎ{A?L1ɺl H5谎H<$HDL$L-DL$ILR1ɺ1Li4L01ɺ1LGL-6L1ɺ L L1ɺ[ H5M?L1ɺ. H51辍qL1ɺ1L蜍gL-CHD$8HD$(L-c1ɺ 1L+LKL1ɺ, 1H5*%L-Iك1L$ LLH$H-҆1ɺ 1L H躌H$1ɺ HLΙ fATIfHщLHPdH%(HD$H1H)$HD$@)D$)D$ )D$0H|$AFHD$HdH+%(u HPDA\wAVAUATUSH@dH%(H$812IHILHE@$0H$h/T$H5 HD$\$L$$]u*|$L1ɺ)H5]_Hj.2|$1H}/IHHHLcLHEAA 2H$8dH+%(H@D[]A\A]A^HHqD$1 L$H5A舊fDLL1ɺ+1H5bAYZ@ @L18H5AL܆1ɺ1H5AAAVAUATIUHSHPdH%(H$H1Ll$LHE@Hf-HHL$(fCL,ucH-Lt$lLHt$0:rHE@L$HvfuVLO81H5H$HdH+%(HP[]A\A]A^fDHfHT$8D$HT$(H1H6rIHHHH9OLt$lfDHAH0HPI36I3VH HpHPI3vI3VH HLH$HH$HH$$$aLH躕HE@HtfhH5 H\$Ld$S6H*1H+IH LHH胚LHD$ ).D$ 3H H9L aHU1t$0LL$@LH5٠ˆXZffDHD$(HD$8 fHD$(faf1Ҿ5HaPHE@Htf-%DHL flH$HD$`ZDf-LODLL$(1LEOH5诅DLl1ɺH5聅1fL,1ɺH5JAZ1LH5!,L&Nff.AWAVAUATUHSHHxdH%(HD$hHB@HtHHt H9L5LcpMtH5LDD+LHE@Hf,HH}L,L jD͏"M1H$LȆ1H5XZHD$hdH+%(!Hx[]A\A]A^A_MH5LujHH}L,L jD=MH$11Le,H5T$AYAZHE@Ll$ @HLHf#(DLH DHkp|$ EMLDA)AALHtEHLD$H5LT$D\$ $LD$LT$H2 D\$ $HDHC@HtHHt H9^L 'H1AUH5tW Q1ASAWATARAVAPL`UHPfL@Lr>Mt!LH567H| LD=kMH11ATL(H5vLcpA[A_M@DHTL L%V ELLWLD11HC@H6HH*H9!LJ11L3LL=ɀLspH LDMt!LH5H a LDH1LAW1MLۚgDHYLH_LH9BIM)HH},L jDËIXZML$HH}L,jL D}LL$1LH$L('1A[A^AD+ E2LH% L pLEL11<DHH}D,L jD踊AX1AZILL1<~D11@LÙL~11ELAL~D11LBLl~|$ CL & MELS 11L?~L 11DL"~HE@H2f($)HHL-OH9fDHPLJLHBPHrH1Lp1}HE LL#DH H$Dɉ1Ƀ$1e}HmXZH9t`DMEH1LMDȃP1/}HE Y^HPLҘ1ɺ1L}HmH9uL~ 1ɺ1L|L @Ly1ɺH5Q |@L%Q L]y1ɺLv|OL$1ɺ51LS|fDMLÖ1L*1(|AL1L>1|'II)Hf.LJL1ɺ1L{ fAVAUATUHH(dH%(HD$1HG@AIHfH@1HH$HD$sIHHE11DID$H2LHPAATdDL$]AŋD$+D$L~=$H5z11zXZLH!HD$dH+%(H(D]A\A]A^fD10L~E1@H5AEzF1E1Lz|H5AzbfDL1TH5Ay-4@AWfL=AVIAUAATUHSHXdH%(HD$H1HG@)D$)D$ )D$0Htqf)X$}L Mf L=P11ɺL}L9yHE@Htfx"tf%f1HWIHHD$1LDID$E1E1HH>PATbAXZL$@HH},DjL Ht$0JD\$ $,H}HD$DL D\$Ht$(H+t$0Ht$($,H}HDL Dt$$D+t$ 軃LT$D\$L=L$Lw|1ASSAVPDL$D1wH0LHHD$HdH+%(HXD[]A\A]A^A_fD=ALL{11YwLq{1H50A&wuL1LAv>DL L=ܒf|/ff.@HHG@Hf#tIf#uf(L GD1H5evHfu f!tLFR빐f(ufuf(*ufufX*ufuf#tf(u[f,u=fDH1E1E1Pj_ZYRff,HLz\ L^zWff.@ATUSHYHLb@C@HHLBHHt:LC HK0HS(H膻AEt C8[]A\MtSI$HtJL9tELH=L[ H511tC8[]A\DL 1L: H5edt[]A\f.ATH1AtDA\ALp11ɺRH5 tDA\fDUSHHHt.HOHH:u"9hLrUHDmH9\H[]fDH@Lx!H5LHH1|sH1[]A1'LxH5VIsH1[]LKHL`xH5's1^AWAVAUATUSHHH|$Ht$dH%(H$xHAHD$HB@HtHHt H9L%H|$wL\ NHHD$LxHx&LHuM1ɺ=H(oH[L9uLk1ɺ1H5nfH$xdH+%(HĈ[]A\A]A^A_LbHD$H|$HL@ HH0HP( AEtEHD$@<1 HQLt1H565n;1MLmtH5nHD$@<HL$(HHH9tHx1sHEPHH81L%Lyj1ɺ-LmD#EML1L4ybmL.j1ɺ :Ls@HD$HL$E1Ht$HxLi1ɺIHHD$huHD$hPHD$hHD$HHPHD$Lp Ht$ALHD$HH H|$HHt$HHHH9ufHHH9t=HHQt H{@H9z@t9uHQH9HHWH:HH9uH9HD$HL$H=MDpk[HD$ HHD$ HHX`HD$HxsHD$(HHD$(H@HHD$HHHD$0H9D$@HH]H9\$ 9Mt.HD$LHxHH~H{H趀M,$M9uMmM9IuHtHKX@dXHHL$8HL$8tH sHpLH1I9LDIE|$@HPu#D$@u 9HD$L$HHL$8LL$HL$HxAHL$8MA?HH9H@H@laH{HLUMH$1ҹLHD$PH$H$H$HHD$8H+H|$8H5 {IH HD$XMIy_LL$`L}LL$`H{Hp1ҹLL$pL$Ht$hLLD$`DLD$`LL$pHHD$8HL$XIyH* L)Hp~1~fH[PHt$8HHHpHHHT$PHx@L$H$L;T$PLMMIHL9tiHUHfDHL9tRH;SuLJ@11LrLT$8H5,I)hHCHLT$8HBHH$HmH;l$PuLMMpL%Lm1PLg1LLăgHD$@<H$L9tKH|$HHH H9u9AtHpH9rHL9uH1H9tHH$H@HmH;l$0HD$HH;l$0/D$`D$PL$D$Lt$ DLmM9MtI}HL:|+ D$PIIHL$8H9.H@H@ M@D<3+"H$HH9I HI9HsLtAEY@HLL$@IąSHzH$LHAH\$x$H$HHCHP@HHH}H9tH@MNHPLq1AuH!1H5F geIvHI}PHD$h^_HHD$XHH@HBHIH9T$8 L$L$H$HՋELE1 HL$xLD;UL L4@HIL8uH@HqL@Hv@I9p@uHq HH9t$ILfHH;Y  HHDDxEPDcEtCAAA9rE9wHuAFtDELA9E9vLHT$pD)HL$hDAu HL$hHT$pkL`1ɺ!H5 cL`1ɺ!1H5 cL%{11LLt`cLc`11LzcDH2HBHFH0 HHH9̉M,$HhM9m H\$8LIDHI9$HsL tLLLoIL%z1LbL_1ɺ1LbLw_1ɺ-1Lb1LLejnbtHHL$8HHH9ЈHvIUHL$8FHRHH@XH$HD$@rH\$8HKXHD$LHHD$ iHD$HHHD$HHL$HLHL$ H@L9l$ LIHLd$(ITf.oEoMHHu Hp I<$It$L HpIt$HHmID$H9(LhHuLt H5m `L%x1ɺk1L]L`L]1ɺLgH5x`VL%pxLfLj`L1]1ɺ4H5BxF`fDHmH;l$0ID$PD$MtHD$ HD$H@@H@f82H|$8LD$HH|$ E?$ H|$ 11IIH HD$ H@PHHH|$@H9tMH|$@HoH9l$ @LHLHL$HMI9AVLE1IMDD9H @IHHȃ8uH|$ H;xuIwEwPD`FAw E|$EtHL$8l$0DMMAIL9t'C D9wS$ D9HI9uI~H-@ HLjAUImH18^AXAYL[1ɺ1H^LiL%u1L]D99w#A)0Ml$0AVLMDT$I~ADtS$M@I$I$H971DHH9uL49HL`LI|$HruoLMM6L;t$HHD$ IH@PH|$@HH?H|$@H9Hl$ ADHL$8El$0AILt$H| LD$HIxAULhSIsUH-a} 1ATH{\H >D)LHL$pH$Au DD$hDD$hHL$pH$LX1ɺ!H5| \2fDl$ Ld$(LdL%sLX1ɺCL[n1MLwH5s[HL%sCZ@LH L LDHLcP1U[AXAYzLbL.[4KL%sL`LZ1H-{ 1ɺ}1LWHZL%r1ɺx1LWLZ$LL%rL3g1|LrZL%]rMLZcLƄ$o=ZL W1ɺ1L ZILbLbV]L%qLbLYH IH H|$1LD$HH|$ E D\$`L%cqEHD$LvL L17Y`IHmH9l$8L$L$H$IEPHHHL$XE1HHHQHH IHH9\$8L|$pL|$(Ll$XLl$xH$H$CLE1ubAD;cLQMDH@HHЃ8uH@HPLJ@IUHR@I9uME pIL9txH9M9EDCPMIHBL99H@L MI9MIDT$hHx!APL bVH5x P1QWWD$H0EXHl$hDH@HHHPHJRIFPH5x HL$x$H8IiHL$x$HHHCHI@HxHH@PLCPtH.HH"H9LHW1ɿ1APLksVH5w RB!VKPHHASA E1jLjjjQjjjI9HPHH+1DHHWIIHEIVPE1DIM HߋHEIH(CPAHILIi<AD;cLMWHl$hAaHI99fLt$ Ll$X1LpRH\$FL1ɺ1LADLtO"H5\@ @HD$ LHxEHLHD$HH}L,L jDLT$ LA[Z1LT$LM麑LOARP1,@Y^LT$AHD$ LHxHlLH<H|$ D$DIF@HHHH9HBH5PLO6LD<1ɺ.tDIF@HHHH9LJ>L1LO?DHBHkZ@ML.-L1>#L$AH"HHH9 LJLO1ɺS1L~>HfLT$HH},jL DIHt$(,H}HD$ $L DI_AXLHL$HH=YM1HC(HHkDL댃CML=6LLDIF0HPxHT$|$HT$|$IHu,کLLIgDH= H7 LDCAAHLS1RH5Q{AVATP1t$85H0SAAHH1PH5aQP1APL*SRnt$8L5H0L`xH< MLDAAICHH56 AT1ɺuAPLRVH5PP1t$84H0)MFpMoH5:5L8CSHD$H,HxL @t$IjD,@IN`AXHi7AYHtHQ(=KAHLRPH5 H5PRP1Q1t$84H0WLL$=ÂLJ :11H5O3"MH574LLd$0BMACAH1ɺ_H5E5 LQVH5lOP1t$(f3H AAA+HHHD$DL HxшT$,AHj>H|$IA,@t$AHHH$L Da>ZYH 5IIF`HtHH(MnpMt+LHL$H52@HL$H&4 LDCATAAW=LDQH5!N1AUP1t$82H0^L.1ɺNH5M1:Hj=H\$IAH{,L @t$A$DHL=I^p^I_Ht!HߺH51?H/3 HDATA麉AU= LCH51MS11t$(&1H mACAH1ɺcAPH5LLNP1t$(0H +LON1TH5L0IF0HPxHHT$u5wH[8 I44BHT$IEAUATUSHLaHB`tH[]A\A]@HHHHtHt$tHt$uL-K1I1LML/E1H޺HuHu@#?HL{BSA1L{/XZA$;IٹLLnMG/DAWAVMAUAATIԺULSHLH8H|$L|$ LLdH%(H$(1\;Lt$@KHt$$HLsϦfoMHD$Lt$PD$$D$4Hl$8HD$HL$XL$D$\HD$`HD$hHD$pũH LAD$(1AUL$,Q1AVL53(LL$(L+.H1ɺ AU1ILAL.HD$ ZYH@@Ht]f(-1LnG1ɺ L-H$(dH+%()H8[]A\A]A^A_@MI$HL9HpH=A1wA1AnuJf.HH5@'E1U L>@)-^1_[fh/zHKHSLHt$}>taLHLf>AEL@ 1L,1fDH5Y'@LJ AAWAVAUATIUHSDHH"HsMMgIH[H H $3L$HILLT$,DIGytH[]A\A]A^A_@HMH[L$] A\H )A]A^A_*Qf.L>%L%B1L*1BLL>*dIGL%pBL"d 1L2Y*H}LDIGfDIGfDLc *CfIAWfAVAUE1ATIUHSHxdH%(HD$h1HG@)D$ HD$`HD$)D$0)D$@)D$PHtDhXH5K H;Hc]VtIH@ H@XHt<11HЅu/H-OA1WHL=8)ID=EudHU@LD$PE1HL$HHtE1f"A1Ht$HhHT$hdH+%(Hx[]A\A]A^A_DD5EHH=x:]+D^E%DގEYeH}H70IHM$HD$@LLD$e8H}LxL0HHt$LHAM$HD$ LLD$&8H}LxL/HHHt$L@Ht$1HHD$(HD$HtHE@I\$4Ld$8Hofh)tHL@)L7H}L`LF/H-LLH_@HD$(HE@HfD$0D$XE4@1HcIHHD$ HT$E1E1ID$1ɾHHPAT^L_HDD$`EDL$XEH5 HlnHE@HE1LD$PHL$Hf"ALyfDL:a1H5E>D&Rf.fDH->L"1ɺ.H%f1H6IHzHD$ HT$1E1ID$HAHPATyXLZHL$`|$\1LO"1ɺH5e=d%D$\sHD$ vLW fHD${LWW L9jf.LD$PHL$HE1hfDL&Cpkf1L!1ɺH5<$D1LZ!1ɺH5p<o$}DL f.HD$(LB|9ff.AWAVAUATUSHH $HL-?1ɺLaBt$AdH%(H$1D$$1D$ VL#AYH= AZ3HHNfH PL1c"Y^|$ LLHH9u,H$dH+%(uVHĸ[]A\A]A^A_683 1LPH L 6 PLc1!XZ&7fDAWAVAUATUSHH $HE1L=d L5=dH%(H$1HH1IHL:HHz.tLHHHHLo1RIٹH|8H/_AXt58t2 I1PLgLAW1 YL^?:HHgL7u,H$dH+%(uVH[]A\A]A^A_58\2#I1PH LPH5@<1? XZ5fDAWAVAUATUSHH $HXH-_ HJHLH|$Ll$@IHLdH%(H$H1ZjL11ŅL5;M11L]>9L}LLd$HI9uM?I9IGA L!oA)$oHA)L$fDL$07HyHD$t~HL3M1ATLAM?_AXI9uf.+1H$HdH+%(QHX[]A\A]A^A_ .ATLAUAL}31AdY^DHAt7H1ISL .H5:A\1A]T-S.UAL 1H59[1]fk2HM1ɋLq<5H59P1AZ1A[D+28t/EM1PHfLPL1[XZ2ff.@AVfAUATLUSH0HdH%(HD$(1D$ )$)D$I9tIIIH@HAEL9t-HCHo)MoP)U薍uHAL9uHD$(dH+%(u H0[]A\A]A^1@AWAVAUATUSHH $HfHt$dH%(H$1Hd(D$pD$LD$H)D$P)D$`HHHHD$0H9H$@ILl$PHHD$H$L$H$HD$HHD$ HD$LHD$(@fLpH;GHSHHPHSHHCIHAL98LHt$a11AUL1H5D7EXHmZH;l$0 HELHL u oLNA)MoP1HLA)UAUU2H|$1D$\HH|$D$XH_AXLLt$L$HT$ Ht$(Lx$@tH|$L/9D$HHct$LLHHH H 1H%H ƀ$HE$PtIHHHL9H@HD$HEH5oj H@HHHD$8u(uH|$H5Ij [(#I!H L1ɺ]1H55H=b(E1HtHa(H$dH+%(0HD[]A\A]A^A_H9FHD$)L !F@A뤋l$H\$LAu>(AUL.t$AUSHH541H 6HALb.AUt$UfH$@LH8quƄ$At$8Iك=3gt$11H5S4Lb.XHY^l$H\$LAt$AٹLO-t$ @AUUL1ɺ0H53G]'X=fHA1t$@L-H531t$ SH 'HL,t$A1@t$(H5e3AUUS]H0H q $H5H=$,AWAVAUATUSHH $HfLH|$ Ht$dH%(H$x1HD$`H)D$@HD$)D$PI9Hl$@L=2L$pvHxHعLHHUL LL1L$-L$HعLD$LHLD$HHL_AXLMHT$8Ht$^LHLAAMtIGHt @EAt+L. 1ɺv1H5 DL$ <DL$ E9HELH;$]u1L 2H5 ]QL 1ɺq1H5 AHD[]A\A]A^A_1AfMtIGHt։hff.fAWAVAUIATAUHSHdH%(H$1HG@D$DHD!L|$P1ҾL|$XDt$ L|$PÅEL,1ɺH5)1A H$dH+%(HĨD[]A\A]A^A_fL|$P1ҾL|$XL|$P D$HE@HCfh tH(1_lݍDd$H=N Q/L5i L:/rH= &/6L$Ld$`H= D$LLd$hLd$`LH= HoHJ(1ɿXHD$HL],1. HFHt$11LW,f HLbL1ɺmIHu6~fHXH|$`HT$hL HPHT$hHHD$hLH^HHyH}KHuIEHth LqL-1ɺrHt$1B ArHE@H3fh ft(HHtH5@c ; H$H\$pD$HHH\$xH\$pHD$ H$H$00C LY H5h&Ac fDtDL$@L&*1H5&A IfD>iL-kW 11L@L . - u+12u1ɺLLNv /HY/ 1ɺLLF fhtfH=?AtZHt$L1ɺaA+La)1ɺD=zWAL'11H5$DLT1ɺH5t i@L,1ɺH5L Aj@L1ɺH5$ +@IEHth L HL$LMLHsL$A L9|$P1H HD$HHL$Ld$PHD$DHAI$M9H#HD$>=AVHt$ML>11THIL9EHIt$HmtQMd$u=UHA1ATHt$1Ly+A^XMl$tz=UHt$ML>1ɺMl$Ld$PM4$M9uDML$(T$MD4 HLL$0AL1QT$RAWH HD$ H9$z`< H>HD$Ht$11L H$HD$ IH9 HIt$HM$$I9uꀽ H$HHH9u HH9 fxuD$(ȀIވHL$ H9 H1fDHH9u IL;t$ i L|$8L-2MILt$mDHH9LH=IL1LH11RAZA[IIGHBHHIH;\$ HI$1IWLHuIo}d"A$HHE\Ht_H9tZHhHT$0 HT$0ML= IAR1U1'AXAYTfDL '@H-&Ld$pL|$0I9uLl$ XfDfH@IT$ H$HPH$L(HPH$HH$M$$I9t.I|$ tH}@HuL71ɺLd$pI9ufM$$I9I|$ uI|$HtH@HH  L|$8H$LA$H;\$ t+Ld$ HHS1HHPHL9uHt$L11$Ld$` L$HM.L;t$ L|$0HM@L$`MG(D$(H1LHHuzMwA~dHIlH L9LH=FL.H11RHt$GAZA[@IIGHBHIEML;l$ IIL)IGHWHHKH9BLJHt$= FLE.,11%hMIHL9LHHt$=EL-311 HHHH9Lr,=PEHA1AVHt$L1g^_HIH9tBDHA0Ht,H0HPH37H3WH uHPH@H3WH3GH H H9uNMIHL9LHHt$=DL\>11L|$0L$|$(tH\$ I9Ht$11LtSeH=TtE11H1HYHT$ 1HL$HMH¦t$HÅ9L !L5!ZMIHL9LpQ=C3HA1AVHt$1LXZHL9LpHT$8HT$8=4CALM+1R1GAVHt$DAXAYH$D$(L L5 $L5 lL Lv+1ɺ91H561LC H5A9HH5 H bHL$HFHt$LL 11(@fH=)qIHLt$L11LM1ɺL)L1H}L1Hg .H{H~L$BL AH5X1RAH袉`DL1ɺt Hc@T@L1ɺyKMIHL9Lp >=@@HA1AVHt$1L$WA^XL 8g=?Ht$ML1ɻ L5kHt$ML1H K $H54H=Ee =a?LeASA1ATHt$1s[A\[Ht$LB11GHL1ɺH5= APAL(1ATHt$AYAZL1ɺW)Ht$L1ɺHH$HHL$ H9HBL@@H9tHHH9t L;@uHtAHt$MLn1A,L1ɺAPA1AATHt$LGAYAZyHt$ML11\$pAU1MSHt$LH1iXZWHt$L)1ɺELWAATHt$1A[[1SLATAHt$M1ɺL 1AE1H޺HGLt1Ht$ML vD$DAL8QA1AUHt$;^_UHy1HH@t)j1HE1jE1UeZYtH ]Hyf.L1ɺSH5s$]f.HHyI1IH@t3jE1LE1jLdAXZEtHf.Hyf.1L1ɺH5#/HDHHzE1HAt,VE11E1j1DGdAXZEtHHzf.1L1ɺH5f#HDATUHSHHdH%(HD$1FHtqu_Ht$%PAąHL$9tKAHD$dH+%(HD[]A\f.tʋFuHHxCeLIH5"1@L1ɺ1H5V"`DF\u fUHSHHHZthHu\E[uVHC@HHtf!H!HEH{dH1SIL 1H5!XZH[]fAUIATIUHG@HHt%f!tLLH ^#H]A\A]LXu]A\A]fAUIATIUHG@HHt%f!tLLH #H]A\A]qLXu]A\A]fAUIATIUHG@HHt%f!tLLH "H]A\A]L8Xu]A\A]fAUIATIUHG@HHt%f!tLLH "H]A\A]LWu]A\A]fHHH f.HHH zf.IHHցv@ EEtEH u:LHfDtS@H LHEEt H tt H uH dfEEHjP11MjE1谫ZYH1LGH5%HLLHLfEEt H^tEEtHntH[HOEEtH4tH!HlH!USHH>tVDH5 H AEt H5 Hu)1H[]D@fH5 Ht[H5Mc HtZH5 Ht'H5r HxuTu/v1@H[]ÃETJ1IL 6H5AWAVAUATUHSHIt|HeLxLpLIH@C|/_LDMH]1ҹ LHHBD-A|$H](H[]A\A]A^A_fH`kP H u= _uw$HD@@u>> 1E1L H5H$dH+%(HD[]A\A]A^A_@I$xBHS(HtHW(D$4*fTvb\AE HD$L=^Lpf.L1ɺL螌I A?uAGIu8H|$$@Dž H @ HT$LAL1ɺRH5MADHHtH8HHt;[H}HjHD$H|$HxWL 1ɺH1H5AL1ɺNH5AVfDA1ҾL[AL{HMAL$DL$8f.<,u@AGI<,tLAGIt<,uLH)H$HLD$HT$(Ht$ LD$HT$(Ht$ AH1L=j VLFL YL^1ɺL1 L>1H5`fAU@th;tcD$4I$xBHL51ɺH5JDDL$8fDH()fDHE@HU@H9t,$$ HH9t9H,u9puH(AK1H)@H裍 LH5;@DL$8LYIU8D$D$HNHt$LA_fHICLM}EuHD$HHBCHD$XH>CHD$`H:CHD$@H6CHD$PH CCHD$8H$HD$(H$H$E AFHl$hAIDLl$pHD$ H\$x++I$I7L )HHYH-*fƄ$)$)$HtmoL$L)$o)$LP։T$GUT$LHv_HHtH@Ht H;Xh4H=HH9uoHH vH9UH;XuH_H$HXGH$H|$(HPH8HH$fIL;|$ Hl$hLl$pH\$xL$HD$(I9Hl$HLl$ Ll$H\$(in)IG1H@HHt3}IwLI_1He@Ht H;XhM?I9)tL 12H5A_thELHt[HD[]A\A]A^A_fHD3EuE1EAD}HHՐD}HDD}AHE1AWIAVMAUIATUHպ SHHH5p HdH%(HD$1H5N H; H5A HH53 HSH5& HH5 Hc}fA}u7DeAa(CP@HS(H5n` L1AăLY1ɺL% 1LbLI1E1L HHD$X聟L1ɺgHD$hH`H-{ HH|$PH|$8裎HL$HA@UH|$8膎HL$HA@8H|$8iHL$HA@Ht$pHL$HH8HtH\$8H$H{Lt$HIHtXH{Ht$xIHt>H{H$I@Ht!H{H$IHL1ɺLz1ɺ01H5D 荨pH|$8yHL$HA@+H|$8 \HL$HA@H|$8?HL$HA@L1ɺ/1H5 Lפ1ɺ{Ht$hHL$LHA@1HaH-` L H褧Lk1ɺLX1ɺ11H5" kNL21ɺ21H5 E(L 1ɺX舼ATUSHdH%(HD$1HB1IH7HBH4$1H"HE@HM@H9tDPPHH9uH]PLePM(I9u_HpHt HSH&AHS8C0Ht'HBLExHHHu@H@HHPPHI9HHu@Lܢ1ɺAH51  1Lr ;H5 ̥HT$dH+%(upH[]A\fDڐLl1ɺ8H53 聥f.L 3H5 N袺fAWAȹVAVIAUAATUHSHdH%(H$1ILH4$H1HT$@DD$H0IL1ɺ}H@ILHH\$HHAD$ tBD$pBD$@_T$@|$Ht\HLLH AŋD$@tzLHUKH$dH+%(EHD[]A\A]A^A_fHHUD1M|$E1E1LPHATjSH AŋD$@uHxBHvAiL H5I A董<@HxBH1H& L H5 A:LH?Jf.LH%JL1ɺH5 1AD@HG@HtfɀvfDbfHG@HtKf!tfx"tffft fDff.ffAW1ҾAVAUATUSHHdH%(H$1I1ҾHIdžHS@H1MHDHftHI1VLH1fX D$@HtH5HA̶tD$@E1AADt$DtBH= pB讧IHj(HըHHfH@ @LD0LpLxLpLp蚨Hf@@ @0HUHH|$LpHBHE ЈEL$LHDŽ$LkHL1j$D$DPD$HPD$LPD$HPD$XPDL$\LD$pH$H$ iH@IHaH$HHLBL$LׯH;LhLxHLLH葸HBf.HHxBAHBHHBHHBHzHBHtHBHnHBHBH1H$dH+%(iHD[]A\A]A^A_DL5n HL>L=ئ HL$TD$D$@AYDIVHLH1ҾeHzAŅHtH5HiD$@E1DD$D$@AL- L LHI$HtH86I$HtI<$LE1L 1H5n) 1E1L H5 \FL- L1ɺ L.HAątoE1LY 1H5( LC[fDL 1H5( ƐL|1ɺ(1L蓜}fDL-. L 1La.@IH- 1E1L H+AW1AVHL L- XZfL1ɺ(1LӛfDL-n L 1LHǃB薛w(AWIHpAVAUIHATUH-SHH8dH%(HD$(1Ht$ZHIHLA?/Ht$HD$ ItILL芩tPHtHD$(dH+%(oH8L[]A\A]A^A_DIA/tLL:uHtMA?/u fIA?/tLHLuC<7/uO|7A?/u fIA?/tI}HL$HT$ LLD$ t HD$8t,M1L H5jl H|$ 'H|$HI}HlH蹡HHt@LL$HL$ HHH Li A9H<LD1=xIL 1H5k }}ӮAWIAVIAUATIULSHHD$HHL$@t AB@HH]H9uHH9HsLXu1MH-k L H躘<'lH[]A\A]A^A_HLmL9uMmL9IuLǭuML1{ H5j 1,{H-cj M11HL 5{'[HD$@1H[]A\A]A^A_1ML 1ɺH5i 街HD$@HLmL9ufDMmL9tIuLˬuIH5 H  H-H MtIPM1Li VH5Vi QRH D1MLt 1ɺH5i HD$@HL}L9uyfM?L9thIwLuHԡMtIHMPLs 1H5h 0ZYF@1ML 1ɺH5Ph HD$@1HD$@MttH5BL@u\Lp H5g 蚕H1L2 'fvM L< 1HL '.HHH f.AWAVIAUI1ATIUSHNH/HI襨HH8/Hu H;/t/HzHueLL)蚤I|$HuH9HFI2IHB0LLHCMtI]HL[]A\A]A^A_MLF 1E1H5Ef L1ɺ1H5'f E1ГfDL 1H5e 褓eff.@ATUSHH=i IHtS1HH/HHDHu?HgH{L`LIHtLHH!I[L]A\fDI1LR H5=e E1[]LA\ff.ATIUHHt}H/H蝦Ht(L1HIHtcHL]A\LIHuI1L H5d IH]A\@L1ɺ1H5cd wf.AWAVAUIATAUHSH(dH%(HD$HFXÃ!H-HH9A}HHHLL9HPHRH%Z LI}H5a 虦qHUPHHT$Ht wHDHLE HaH! ,=I11LG H5b 裐LePHH#EXHI9)HPHRHLtGHH IHPHt @HHHH9ǁ HH9uLDdtL))HH L 1ɺ.IH5 1ԏ=LH=I9.L}PMIHD$I9txI9MFLMMHHBLHHM1L1LH ]I@IHH3FH3NH D1Ҿ8LjADžHEXAHHsDHLoCuAf%f=HEPH HD$dH+%(H(D[]A\A]A^A_fHHLpHI#FXL@ELHADž}LzHIoHAVI1Ls H5F` ZHEXYZHH9lM6L9t$DHLq 1ɺIH5_ 1A莍fHLH1AH IHPH| '@HA@ t AEHH9HHHH9uճHHLpHI#FXL1ɺ(1H5_ E1輌HL IH5^ 1E1~fHyH9QHT$HL$LD$HHl )Hp Lg IsHHLټ 1ɺI;fHEPAHxL H5 衋H%uǀ fHHHH5] SILo 1F^_HEPL H5f] L1 U_ff.@AVAUATUHSH9qLcXA A@3A@u ALKHL 11H5\ xHCPHSHHHHNHHC[E11[H]A\A]A^.fDILMIH^ILG 11H5A\ IEPMEHLALHHJ]LcX[]A\A]A^HHXH@L@I ACfDHIHBLq 1ɺH5[ Ak@[Lм ]A\oA]H5 1A^ ff.AUIATUHF[t+HHtL`HI#D$XfDHrAątQ[uA]DA\A]E[tHtHtHLy1L*1ɺXH5Z ?D]A\A]fDL?LH}UL]HIR=RHI1ATL H5Z 1·ZYAWAVAUATIUHSH JuD;6HHAH9L-"L=Y (fuIH{uyHH9tXt12LL„tLɃ1ɺr1H50Y E1ن脍HD[]A\A]A^A_fHsHHtF\t:LaLf1LE1z|>uH@X@[fD蛏fDAWIAVAUMATI1UHSHcHLD$nA$2HCu HHE@Hf/1ҾH&L L H5W ҃HD$XH LE11肅HE@H9DHD$PAbH1AeH5| ^Aƅ1AbHAeH5^ 輋tHE@Hf8##HCHAu @q:AEH,H}AujL D@L 1H5V IX1ZZHE@HL$XHfx\HL$PL  tCL t7L tt+L 1H5H كL >L 1ɺ1H5V 豃G@A $7L\1ɺ1H5U oHD[]A\A]A^A_DAEHtKftAfC1E1Le H5`U  f.1IfHACH\$hH5iHєL1ɺHH5H@ H@XH11HAƅrLK(1H-T L HIL11H,L~1ɺH5UT 1E1H@[AL~1ɺ1H5T 证;f.ATUHSHG@HHfW Af&&ɉMt &CA D AAHVHHHHH HH H HHH HуH u_uZttMDME|=LN(L 11H5R 血EDDeAtFE A蛑 A9rcEt^AD$DuT[]A\f.Et=L8 H5cR 11EH,DDL jH{茋L? IXZ.1H5Q [1]A\@HHNHA1EA D AA0h1L jH5|Q -AZ1A[[]A\ff&"|& AfD1Lr YH5(Q ~1~DH,@DL jH{RY*^IL1( 1ҾHqkHH{L 4ju,D=_IAX1Li %H5JP 1}DesHHNHuMtZɃ AHCJfuA%fAAff.AWMAVIAUATMUHSHHHG@Hf8#I#LT$A2LT$A.HA2I~AA,jM E興L 1H5O IX1Z|IF@HUffU(f%HI<$uHtH5#觑AŅI^HIH1L9uPxHHHteHHLHTWAŅLHL9fpt^IHHtHhfpuLkx1ɺ1H5M LE1x{E1DHHmHxHuM'HD[]A\A]A^A_fDEI$fDHt{H#HHH8t"H5zHIHtXHID$L#IAaLw1ɺ1H5M zRf.AE17L^w1ɺ1H5L E1nzH{Łi1E1H-L L H6zLw11Hz@Lv1ɺ1H5CL E1yHnfDLv1ɺ1H5 L LE1y<1$fcHI$ZLRv1ɺ1H5K E1E1_yf.AWAVAUATIUHSH(F4HT$D$F5D$HtMt$HMl$HM9E1?MMtcL LHIHIM6M9fA tQHH%MtLxfA uL]u1ɺ1H5J pxE1DHH[HxHuH(D[]A\A]A^A_ÐML?H$HI|$H5x 聍D$H$L(MSLd$1MeH5 L#IE Ht DE~L k1LLy H5I E1wH$Hx~-fDLLt1ɺ 1H5I LE1YwHH@UH9tEMmM3ALd$LfLs1ɺH5@I v|@H56LIE HDEH@U H9rE gH$1E1Mt$@MtffA8t(1ҾL̳D8D$ADՈE4AfAXt(1Ҿ!L虳D8D$ADՈE5A1HfHD$AHtD(H<$[L 9~ H5~Lt2IE H8H@UH9oEdH5>}L˯IE H0H@UH9&E1ɺ_E1L rH5}G .u.1ɺLLqH5VG uH$1E1`L .}%L |H5,q L tAIE HttL q LE1H@UH9YENL5D|LL貮tIE HttML5|LL腮t)IE Htك8uH@U$H9E$L5|LLFt)IE Ht8uWH@U(H9E(H5^|L tAIE Ht,8u'H@U,H9rE,gL |L |H5D|L趭t)IE Htg8ubH@UH9EL5{LLwt=IE H8H@U0H9E0L {7L5EzLL$t6IE Ht8kH@U4H9HE4tH zLHجAƅt5IE HyHtr8umH@U5H95HE5&H`zLH芬ts|$HEzt8IE Ht 8uH@U H9E IHHzIL hH51D 1Lq>HW LHt7|$H< tIE Ht8uH@UH9[EPHyLH贫tC|$Hy^IE HB89H@UH9EHxLH[tD|$HxIE H8uvH@U6H9HE6HxLHtX|$HxIE Ht18u,H@U7H9VHE7GL wL `xH5yL薪t=|$@IE H8HpH}8T9AƅtGH5wLFAƅtRML 11HH5/B oLl1ɺB1H5 B LoML5 LL Dxf.AWAVIAUIATIUSH_HHHwHdH%(H$1H\$Ht$H9Ht$fpuuH|$HH\$H;\$u݅AEPA<-IEI9ELV 1UH5A nE1fHHHt1DIfHT$p1HL$0LD$,LH$H5 HL$)D$p)$)$)$)D$0)D$@)D$P)D$`{H$HL$u9MLL\$,gHA$~I9cM1L, H5@ mE1H$dH+%(HD[]A\A]A^A_f.1ɺ$$LMjH5? nmD$1ҾELPHGHXHu9fH[H*L{MtH{ uH;H5脂$uHl$0NfDu}HHH H1@qjIx\MHLLtwMMxf)E)E)E )E0IG uHHHSl H1@jMI1L H5> WlD$Li1ɺNH5~> /lE1a肁fHHG@1Ht $t"1AEtHf1fh/ϐ1Lh1ɺH5> kHDAWH AVAUIATUHSHH(Lb0Lz(L$MLDBtx~BDHG(H5 H8豀AƅvHLu= 1MATLֺL kYCA^fE1E1}@t$Hs H;sD\$HI}AA,jEM EvI}HsAA,HD$ $EM vLH= HXY1HL$=>D\$ET21LH= L,9MnIFIGLHIW+aL`HD$0LHxXHHtLLHiHHKm@IELML;,$I @ID$;D$<H ު$H5QH=Q6^1eff.AWIAVAUMLc ATL%" ULSH1HH$H$ L$DL$4HD$@H$H$dH%(H$HHD$`HHD$XHHD$PHHD$hHHD$pHεȵHD$xHG @D$1}OH$0AHD$8H$8H$0H$ HD$H$(H$ H$L$L$HD$(H$H$HmH_ILhLVIHtLHHgIIHt$LsB; HD$H9$ DT$EH5?0 L[D$4 uLL8K1ɺ  1ɺ L1Ln 9N1LL$ Hl$H9$ *DŽ$L9$L$4 H|$(LHD$@HD$HHQ HD$HDHEt HxgHHDŽ$DŽ$H$HDŽ$H$HDŽ$H$HH$HH$HQKH$HD$H9$  H$H;\$(DŽ$DŽ$ H$@H\$MHD$lHE H۲HD$Hײ=Q/uHL L1t$ I1[L^_D$Et1H$HL+c HLHLH$P\$DD$L$HHALHD$0A_XH$PH$PLD$ H$$VZY<H$tfHt<}#t6LJ H$HtP,tHx@P,AAHL`MH$[%$ $$D$EH$ L|$L9H$0HH;D$85 Ht:}#t4L1ɺ L5AHD$@$HD$HHD$8H9$0$f1ɺLL=@:H$0HH;D$8HD$ L$H$HL$IHHD$ HLfI]I9t?M fM6I9t0IvHUuH$L$L$3MmL;l$8uH$L$)1ɺLL<?HD$ Lz L@L1?HD$HH@@1ɺLLe<?Hx@P,I5t1L><1ɺ LW?HD$@$HD$HHL1ɺ LL;?$1Lxy 1ɺ L>HD$@$HD$H1ɺLL;>D$ 11ɺLLY;>1ɺLL9;a>6SAVIAUA1ATUHHdH%(HD$1H$iHttIHHDID$E1E11H30LHPATj|H|$ H AMLHHD$dH+%(uHfH@IT$HPB\ H$ HEHL$@HH$ HHHBfDM$$L;d$ HVHD$HNtbL{ 1ɺ1H5X 5D bE2H$ H;\$@Hl$Ld$@HsH0HL9uL$ L;l$@D$L$pD$\L|$0MIGHt$0@Ƅ$pHx  IGH@HHjHD$0Hf̃e  MwAF^@ H$Ld$hI^HL9u HmL9 HuH7JuD$pHL$Hi(DfEfAUA\AԃE1H$L HD$(LILT$ IHLt$`L$f.HH(9\$ \$AHEt3IE`/L4LGHpHLELLbIAOH9\$(uLt$`L$H$9L$ HDŽ$LHDŽ$HDŽ$HDŽ$(1҅f_ HH>L$HEIE1D$D$(H$H$D$ HD$`6DHHŘH[HHŠHfHfqHHŨHHHŰHHLlAft.Afu L$(CDL$Et f{ HHDLMtfd f HLlIt AfM f @HD$Hh(AIHA9 IcHfHL$JT=pHBHIFIGL0AD$MwIIIHMF0AF HMFMl$ %IF(LAFHH LD$% AFA.H|$LHHXHIl.87H2MItwIDHAV @(In(LhL-LHHPH\6In(HH-ILHPD$H|$(]IGHsLh-L$11OH5ɢfJ\$L11H5H|$ QH|$ \$IHt蛗L,HD$H5H Hx2tHD$H HtH}HtYH,HD$L HeH9e5HD$PLHYeHHD$0IHL$L9L$pLd$8H-c L|$ IFH@H@HH%HD$ H!jyjIFLhHD$(Au/D$XI]HHD$(HdHCeD$Lt$IL;t$0 HD$IFHt$ @Ƅ$pHxH s<1ɺ HL)L12H5 LLl$@Ld$`IGIHAHHD$(HcH}dE|$EtZID$HL$P1LH|$Lhc@\ID$ET$@Et DhEIFLhHMMH1ɺ HD$XLc H19A[L[H5bH|$H$H|$xAtID$HtDPEDD$D$AH=Q (=LHD$HHH9Ll$@IILd$`IHIE8-uHxL/tMmL9uLLl$@Ld$`LLMLd$`Ll$@LH9L$HiLl$@MLd$`IHIELL9l$H5IHsL.uHHCHBH11L HDH=P 1<D$\D$D9DMDl$\E9L1ɺ 1HL aLtS HPyID$@H~H~L1ɺ 1H5 ,H`^HaHR^HS^HHyaH$t$XD$\L1ɺH5D$D$\QuHL\1ɺ^H5D7H q$H5H=%L1ɺ01H51SD٣o,H|$PްDD$XD$\ED$\AHD$H@@Hf!sVL` 1sHHD$`- H5 L1_AXD$ eD$ D$ |$XD$\<AWIAVIAUATAH5Y UDSHӺ.HH$ HL$1DD$(LP H$H$(HD$xdH%(H$H{H$H{H$H{H$H{H$H{H$H{{H$1O ML$pDH$$H$AHD$8H$H$H$`H$H$L$xL$pH$H$hH$`EAD$D$L$HDLt$ HD$XL$ILhLHIHtLLHb-IILHPHH9\$L3L1L)H$I9uHtxLh,L1L$ILpLIHtLLH,IIHt$8LggLM JH5 D$LQ1ɺO1H5 dH$HuyH$HnyH$HgyH$H`yH$HYyH$HRyH$dH+%(D$H[]A\A]A^A_MLD 1HCH5 D$H9\$f|$Lt$  IG @H\$8H9$AH9$ H|$D$ DŽ$H5 LZL1ɺ^H5X D$@LL RH5% D$DIG @MD$ DŽ$H9$ H|$ML褴HT$H$L" L$I9fL@@ @0IIu]ID$HoH$pAL$oAT$(H$xM4$ID$H$xL MmL$xI9I@eIHQL@L 1dH5 eL1 1ɺqH5 1DD$I]HkHILKK P1iH5S MmA\XI9GDŽ$LwHuDŽ$TDŽ$XH$8u$Huu$HuH$ HuH$0HuH$(HuH$@H$`HD$hH;$!H$L|$PMDŽ$H$DŽ$\HD$hHXHxDŽ$HH|$X蠧D$`HtH7D$`HD$XƄ$H H5H tHD$XH HtH$Ht] \ l$`t!Ht$XH|$P1H$TeLt$XLWI 11H5Q M HHLDŽ$`H$PD$Hl$`D$dDL$hH LHH$AXIE1AYEH$PH$dPH$$htAZA[ M$aL$`$XƄ$D$H$\D$dHD$pHD$(H4sH$`@Ƅ$`HH$HsH$HsH$HsH$HsH$HrrH$HD$(Hxh1eH$HD$0HtHD$0Pt HxHD$(HHtH5 HtH-lrHmrHD$(D$LLHHD$@I9 H$@MHD$D$H$)DHqM6HqL;t$@MfID$@HZHHNH9EHBHD$Ht$@LƄ$@ d2HD$HqHD$HqY4YXH$pD$L9D$ lHt$0D~EtJHFHL$(E1LH|$P@@.M HL$0HAI@t hHD$(t$dHe\$Ht<|$t5D$E D$HN D$LD$HHv1ɿHD$0LE H5 LL$1# XZ\$ =HD$8H9$*L9$pMH$H pH pHpHp H$|$LH=lA HoH$HoH$HoH$HoH$HoH$Hot(L11H5| - H=@ \$Lk,$D\$d9M$Eu$ H$ttHD$XHtA8#t HuL-P H5GL1ɺH5| 1&D$H$pHL9R H-CP 0LJI1H51 HL9 HCHt HHtH9uL 1H\$8H9$L$(1D$ !‰$LG1ɺjH5 \D$H11HD$L1ɺFH5` @1L2H5RL1ɺL1H5 MH=x; &D$L@It$@HfDHL9tHHH9ufL9tHBHHH9uHFHBHD$+H1ɺxPLL$L> 1H5[ ]LA_H|$PHL$0Ht$(HD$xH=: Ãt(L11}H5 H=: &D$L9M؉\$LH$H;D$8L$M$I$L$If.I\$I9t6M MmL9t'IuHuL$L$fM$$L;d$8uL$0D$fDHtH$@HvZvHD$XF@ID$@HHHH9LJ1L< `H5 uHD$0H@@?HH5 pHD$0LK LL$1(Y^HnHD$0LK H5D LL$1_AXrHL(K lPLL$H5 1AYAZ-fL -@1L32H56l O1L(1ɺH5 ML|$P5H=7 t#H$8DŽ$H*f$H%f$fH$ HfH$0H fH$(HfH$@HeL1ɺy1H5 LZ1ɺ1H5 mH=87 "$\H|$pDŽ$H$DŽ$$*$XH|$p$D$H$\D$dH$HD$(Ht$XH|$PH$TH UTLw1ɺ H5 0H$\L?11H5 WH=6 !$\DŽ$9HD$pHH}1L\C 1ɺH58 HD$XHt88#t3H|$P+HD$p@,tHL$pA,Hy@rHt$XH|$P)H|$pD$`+L;1ɺ1H5 PL1ɺH5{ ,L9$p @HD$pHHt?>#t:H|$PPH\$pC,tH\$pC,H{@HH|$PLu1ɺH5 $XƄ$D$H$\D$dHD$pHD$(=L$1ɺH5 9fH=3 sDŽ$Ht$0H|$PIH|$P1CHD$0HrL1ɺ5H5 D$$EL G 1ɺ1H5 11L-=QLD1ɺHHHLSNIHoII1AFbt1#LHHD$0L$H$hH$pHD$(H$`H$XIHtvL9tqLH11Lq6 H5 1HD$xLH$LЃE$.2L1L'l.L P'H|$P@H̟L1ɺ;H5t %nL1ɺH5P :H$H9D$LH$pMILI@IL$HL9HfHL9H;Hu @L9tHBHHH9uHFHBHHC @HaHHUH9LLHL5D 11H5| (ID$1H^HHuH@PH0HHHH#HHHT$ HL$ HT$ It$HL$HR`H$H$H$Ho$o`$HD$xLLHH$ЃDD$D$GueFH$pM$$I9o|$IMED$D$f$uL $L12H5rID$H$HB`H$Hz H$f$$LW1ɺdH5 lD$DŽ$LyL1ɺH5 0CLTA 1SH5[ D$HEHth HD$tHEHth HED$D$IIMLs1ɺ[1ILA H5 MjD$?L)1ɺH5 >L1ɺH5i R$DŽ$)\j賂H 2HD[]A\A]A^A_IF|L' DH,$MIML94$u|@I|$HvfHhH$Io&,H$Ht$IIHPH$H0HH$HH;$HIw1L6HHnMO1L H5 IGIHBHIIIIIGIIL0HMIH;$afH$I;H$Hl$H9t,DI$HS1LHPHH9uH$A$A$@tA0XHD$E1H9t HAH9u1L+6 1ɺH5 I$HT$LIIHD$0L3HH9$LL<$MI@I$LLM9II1HSLHuLKLLL$HHL&# PLL$1H5. HHCHBHIXZ HD$0HIHCILH(I$ILM9PMA$d$A0MH$L9KLl$01ML$D$H$I0A$9 MmM9#I}LHDŽ$DŽ$ t&$tku$\$IEHHHH9LJLS4 1ɺ1H5 YX@IEHtHHt H9 L L84 1ɺ1H5b  fLd$" A}-H4$IHr\$IH$D$\$I9tI;^MIM>I9u*$uIIFHBHIMI9I1LLLyAF@uIv8IH9tHPHHH9uHQHPHI) H$HIHAIHI`L RLl$0A0IH]IH;,$Ld$L5IID$HHH56 HDHH9zLIHL#9 11RH5 v(It$AXAYJHIHHHhPAD$THHmHHt"H5AHHL$0:HL$0ukID$A|s HHHH9LJL2 1ɺ1H5 _AL$TH` I({ID$H HH H9 LJHL$2 11UH5H AL$TH HPXYHD$HHT$0HxHHtHT$0HHHIL$Hf.HHH5[ HDŽ$HDHH9LIH1LZ7 1RH5 AMD$Y^AIIL9fHBHHH3HH3GH HNHFH3OH3GH IHtL9X DL Lb1 1H5 I$ID$IHBHIII $ID$IL8MHA0IIH;$,H@HL9LFHH L]PMM[HMLߺL\$0H5LML\$0ID$H HH H9 LJH1L0 1AS(H5 L\$@mAL$TH|$@}AZA[HhHD$HHxL\$0HHtLHH)L\$0HIL$Hzf.ID$E|qH+ HH H9 LJL80 1ɺ31H5 L\$0AL$TL\$0H I(HD$H@@H6 f( I|$H$L\$0HrL\$0*AD$TH9$ D$HD$0HD$HL\$8HxHH.fH@@L\$8@@ @0ID$HHA8 HH H9 LzLHL$@L\$8HPHD$HHT$PHxbL\$8HL$@HHtHT$PLsHL$@L\$8HH$Hy(Hi HAAD$TN DL$HIDEtIt$0tIII9HIHAIHIL u@L ~@HHH9LHL[, 11H5ݯ A};AL$TIt$`fAuID$H|HHpH9gLJL L e@IHt8L9t3LHL, 1ɺ 1H52 AL$TL H$I9t |$I9F11H5n L?#MM1I9LH\$MH$IMHefuIIGHBHH9t |$k**}AGDIEML;l$IŹLHLJpAG@uIw8HfDI9lHPHHH9uHQHPHHHHHAHHH wt$k$\9TH1ɺPDL$L{) 1H5t %AZA[ @_ID$HtHHt H9tLJL L) 1ɺ1H5 AD$TnHD$HHxrHHfH@@@@ @0ID$HA8HHHwH9nLzLHL$0cHPHD$HHT$8HxHL$0HHtHT$8LHL$0HHy(AD$TuIDIIIfDI} 1I}\?HLphMIH$L;HH9{ILd$0MMHt$IH@H L) PML$ 1H5 9HHCHBHXI$Z@HD$HI$HCI$H(I$ILLM9IL9ktIEHt L9[HSILR& I9*HHHH9LJL( 1ɺ/1H5 L\$0HAL$TL\$0LJHqHHeH9\LJLn' 1ɺ1H5@ AL$TI$ID$IHBHIII $1L{H5 ID$IL81Mz.A$LHD$0ILt$H9tkI|$H^fH@HSH$HP(H$L0HPH$HHH$H9uH$Lt$H;\$t#@I$HS1LHPHL9uA$tA0u A$L' 1ɺ1H5 ^M$DŽ$H$H;\$Hl$Hl$@H̐AG`H9lL{AG`tAwXH=5XLL{AG`L=L L1ɺIH5 1E1L L nDL212H5.d4AD$T1D$0D$HL=iID$HXHHLH9CLJL JID$HHGHH;H92LJH1QL$ H5 ID$I$IHBHI]XL,1ɺHH$HD$ LC 1ɺ0H9$WMLd$0A0 @DD$0E |$HL _L L L Hl$HT$LLL$藟D$E| ILIH91D|$8MMI$MLL9II1HSLHuLKLLL$PHL. PLL$(1H56 HHCHBHIAZA[H$HIHCIL0MJL L wHHL$0LxHD$LHx0HL$0HHtLHHHL$0HHy0DMD|$8A$IH9uHD$ H9$H$I9t |$DL$0EHIH9 Ld$8IHD|$0LJH1QH5 1L It$XZHS7IHH@PHL@HMH5LLD$cAD$T tI|$HHtHt$vHIIH9}HID$H tHHHt H9L IT$H>HH2H9)LH11L H5 hAD$T^ID$HHHH9LJ1 L! H5e I$ID$HBHIH$I$IID$IL0MAD$TAW|[BfDL WHHt4H9t/LHH5 1ɺ1L ZIt$L 9HAٹE1PL 1H5l AX1AYL H5I 1'L1ɺ*I$ID$IHBHIII $1LuWH5 ID$IL81Mt(D|$0Ld$8H$I9t |$IH9qH|$(H`ZAEI]Ld$8Lt$(D|$0HDIHD$L$IM9u`M$$M9tPI|$HBuI $ID$HAHIII,$ID$IL MIL9|$uD|$0Ld$8IHD$0A0IHYIH+IH9\$0D|$MIHl$09^IEMLI96ILKL 11H5 HCPHSE1HsPLAGPEO#_AXxHHCHBHIH$HIHCIL0M4L12H50IT$HCHH7H9.LHL =NIL1H5 LADž7D$0fIH9,$HHH9LUIH9,$LL5 MMIHUH9uHH9H;PuHHHH9|LH11ɺMH5c LT$ HUHEHBHH$HD$ LT$HEH$HEH$L8L$I$ML;$$LHI2Ll1ɺvALV11yH5 iL MLHL$8L\$@fLxHD$LHxHL$8HHtHt$@LHL$8HHy0|$HL 1ɺ'~L L1ɺsMD|$H$I9t |$*A0M(ML6 1ɺ1H5 \I(L=HD$HMILHD$(HD$HHD$8L9t$0!AFT I|$(IH%HD$HL$8HH9IF HH9 HSH9B@uHHHH9LJ11ɺL H5š L\$@nHCL\$@IIICrII E11LISI LH$M o()$op)$IvKHl$(HEIH;l$0tmHD$(H|$0HT{L 1ɺ1H5 Lr1ɺ1H5ٙ D|$IHEHl$8HD$@IE(HD$xH9l$0aD$Ld$A0t ETSH$I9t |$HD$(HxHD$XHwHE1ɺ*L H5$ IHD$(1HD$LEL`hLD$HID$XH@HHD$`nHHz HxHH1HH)HHHLD$HMuPHHHE}XHIE(LC@HD$HIE0HD$hIE8HD$pAEHD$PIHKoo`cHLs Ht$HHHtfH9vHS@H&HHH9LHH1H5#1t$PL qHD$XHY^HH9 HT$hHT$pH9cH|$`(HH fH@ @HXI|$X5ID$XHt$xL狓ID$8HHCpID$Lc`PM D$PE1tWHl$HH݋\$PfDH}`HGH@ Ht#1IEMDHЅ`AD9uHHl$Ho H|$E11H$)$oS)$HuH11LL$8L 6H5N H{@A_X{Eu EtZLL$(11L @H5 D%MH{@Eu$H=D#11LL$(1ɺI1H5 L bH|$1HdLL$(=H5} L) 11ɺQHt$XIIH^#HI HFI H0I H\$@Ht$0H\$8HHH9HD$@qHL$L$W LC@L vL #H5 _HUHEHBHIhH$H\$8HEIHEIHI6HHl$HHS@HqHHeH9\LHL 1H5LL$(L 1-H5 5LL$(L[ LH5 LL$(L 1:H5 HS@HHHH9LHL- 1ɺ1H5>D$Ld$MIHD$ILI9uYfDIvLS=}MNd11L H5ܒ HHIH;\$tzHI~uMN]L H5 GIIFHBHIQH$IIIFIH(IvL$I6LL;t$ mD|$II~LLEIInL9uoDHL9tbH;kuHHEHxH9oLH1L @H5ο[HHCLMHBHIL9ug@HL9t[H;kuHHEH H9LH1L @H5VHHCHBHIvLQ= MNv11L H5 蚾ILML;|$ IMNmL H5 XIIFHBHIbH$IIIFIHIzL L H E$H5lH=}HS@H4HH(H9LHLX1H5蓽L wD|$L;H$Lt$H;\$u7HL9t(HkHtEatuXH=芶HIL4$H- H9$t8ID$(HsI1ɺLH5- 1ܼHAZA[I9uH$I;AL |L xL La 1H5 lHS@HHHH<H93LHL 1H54V1L H5 L11H5ӻ HK@HHHH9LHH1RL H5XZHS@H HHH9 LHL+ 1H5E.gL uxLi IH51LL$(L 1CH5 ,MN1L H5 袺IIFHBHIH$IIIFIH(IcLi 1ɺ1H5 =qL1ɺ1H5k KL L 1H5MML1ɺ|1H5 豹?HH9 Lc1ɺ1H5ʋ vL=1ɺ1H5 PL 4MtDIHt H5vD$ 1ҾHprL$tHzHT$h1HǒHt$xHHt$hHHD$ D$$D$ Lt$hH$L$H$L H$H$H$HD$H$H$HHD$H1Lt$0L$L$UMLLqL$M9D$(^fDfH@IVH$HPH$H $HPH$HHH$M6M91AtIIvHIFHH}VHeLI1ɺHt$1^Dt$$Ht$HlH4$H`H$HL9t.$Hf.HWHSH HHL9u$HD$hL HH1ɺPL= L 1LĒZYD$ H|$hE1蹢HM@Hft"RHH $H $wf!A@d1fAfA&tuAf.fA8%/@fAfA8fAxtfA&ADfA*)AfAmfA(^1fAKL "H5E 1A>H$dH+%(HD[]A\A]A^A_f=@Ѓ@A!5,fAh/1H= $d#tHHt$hHo8E1L 1ɺH5+ 1D$$HH I(HpHt$L7 11"܃H4L$M9ufM6M9I~uI~IFH2H}YHfH@INH$HHH $HH$HHH$HH$o1ɺLLLp 1ɺL= 1LDt$$@L /Lq RLk1ɺ1L肂DLD1ɺ-IVI L AVHIH I%A к(PHt$ 1_AXDt$$H$E1DH6AH9uH1QHt$ L 1Ё^_HHt${H4$H{LL$hML@ 1ɺ1ɺH5LM~uH$1H;4$.OBH$1H;4$$E1-|H e$H5H=轎ff.fAWAVAUIATUSHHHG@Hkf(  NH fFLp H6M-L5Q HLuH5 LؕLMHL赕 L7tH7H AƅfLH5[LhH7u"L= HLIHc`L17HLL% 1Ld|1ɺGL}H[]A\A]A^A_fL1MBaL%ZLH6LHHD$I9H@M|$LCt1LWt%H5c HA@uHL IM$$L;d$uL% HLuK,DHHLHǃLHړuNHL5 H;l$t0LeLtLtM$HmH;l$uрc,DH@RHHHtH5U PuIE(fx{=LL `11H5 }H[]A\A]A^A_HH< LHc`HHHǃHD$I9LHPHHǂH;D$uH4HtH5Ƅ HccI<L L% 1L|"@HHHc`LHǃH9oHPHHǂH9uL@LMH HL謑HI1ɺATH5 L |Y^H[]A\A]A^A_fD1Lx1ɺMH5 {H[]A\A]A^A_LL Cat:L%WLL1MCa@L% LDHML% 1ULL- {XIZL1L6 z=Hc`L@L% ILU LzIHǃHt2H艊H{L`L)HHLHBHHL% LDH`0LHa,H`=L ZIH5 1yDE1H11YAWAVIAUAATUHSHH_@HtBf( NL f t#Hp HtH5 襎AąD%{Et~H5NH_AątQ1HNIHHHD1PHAE1AWLji(H LHAHD[]A\A]A^A_DL 1H5{ |xf.fh/tO1LH=| OLH5=S Hu$L s 1ɺ1L LοaqHD$HE1E1IEHG1LPDHAUj H AHE@Htf tT$uXLHHD$(dH+%(H0D]A\A]A^A_ùL H5 p@f YLp t5H5 Hu"L T L+m1ɺLοDpMtoH5ÁL蠅t\H5 L荅tH5z Lz=þL/ H5 11ofL D$tlL΃Lb 11oH1@L! 1H5c A^otfL΃L> 11-oL  SH5Q HLL$XLL$2L1ɺLknLL$ 1AVAUATIUSHw@HHtmf tNHHH9dE11DHAH9tHPHz@uHH9uD9fxHPLPHHLHL蒃r}I$L5 H(H`LUL11AU[LL mHXHZAHy=RLLL 11ɺcm[]A\A]A^DL5> H_HL5+ 衂H1L 1ɺ:L mID$@H:fh/,}I$fHI$HH1LIPL L1lY^L11ɺPL LdlID$@Htfh/dH1HH= D@ \_DLHHrH%=*L[1ɺH5 ^8L[1ɺH5 ^LH1Lo[1ɺH5f ^f.1L H5. L^sff.fAWAVAUATUSHdH%(H$1L$HL2LILHkI1ҾPH$ $L$HD$ MHD$(HHD$0HD$PHE@HD$8D$@D$HLt$ Htcfh#tYL H5{/ 1%]H$dH+%(! H[]A\A]A^A_Ll$pHT$ HL{tLHtL-11HLbDL$ELHt$pHc^HlH|$p1HH|1HrIH LHHXo%=u=(tHjHt$pH LX1ɺoIHH@H@@atIEH8HIEXt$xLE:e$L^BN$LC7$A;EPtAEPL$M A?t7L6kI}HPHH$bHH H$LHsH 1CD$IH5!5 L"H ELAZHE@Y^Ht%ftHۗuIM`LL AL%E IH9$tL= 1ɺ1L濄'ZAIH9$tLL 1ɺ1L濄YHE@HtTftJH]HL}HI9t=fDft%HHL L HL9uL-LaoH$1LHԴ Ht$pHt3>#t.HX AE,tI}@AE,NHt$pH[ IH H =MPL] R11LXIXZHHE@H f  1ɺLHLp ӻ H5H,M H5|Lms H5 Lm L-2LH"L H5 W@L) f.L=1M1ɺ>L1L WHD$Ld$H$HD$IZDL$A1ҾHZD9MLW 1LR1Weh4$E1E11ATL1H=pW jjAUj?]H0{L#tHUFHt$pHX*1LR1ɺYLUfLR1ɺ>H5 UHt$pL% Ht>#tHTHt$pHxWLL$p1LL* ^KU!Z1L< H5/ ULQ1ɺzL% 1LTHt$pHt8>#t3H=TMtAE,tI}@AE,JHt$pHVL.LH`LL$pL6 QH5W YT/Ld$A.\$L- LLiكLH#L5L9t+HHtLLi_HL9u܃=L L11S!Exy% 1ɺLL=PeS1ɺ]LLPESLHELP1ɺikA-{AIL1LS R!1ɺXLLORuzL LRL1LEo {R1L cH5P RR(L1LR (R1ɺLLN R1LN1ɺ]1LQZLN1ɺX1LQMLH L1QL1L zQL1L WQLL 19QoLp L1QL1#LM1ɺ1LPCfp1L H5&+ IDžPL% LvM1ɺLP1ɺLLGMoPvL L1LPSL溤L$L M8PILd$IIH $HH?HLI8I@L;HCI@HI@HHmH;$uLLd$L5LqL11LO1ɺLL@LhOYH*Q Ha1ɺLLL9OH }$H5OH=O\=֝L L1ɃN1ɺLH1ɺ7H5 7AH[]A\A]A^A_I1L H5 @H[]A\A]A^A_DH{'HL&PL 1H5U @XZ.!ff.AWAVAUATUSHLqHt$ANH* I1E1H$HII?1L,HLHIH9uHH9HJH9A@uHHAM1L .Ht$1?XZA9nWELLN='LL$L H4$K119?H[]A\A]A^A_DH%AHnf.HMA1L 0H4$1L;1ɺI>H[]A\A]A^A_H~ H$H4$1DL >H[]A\A]A^A_ff.fAUATUSHHB`VHHHHHB`HHHH9tHPHHH9uHH=LLz 211H5N =H[]A\A]DLMt2LMH{LhL$EHLLH=VILfD1L91ɺ0H5 =H[]A\A]ILT 1H5 1H1HHE11HD$@HPH$LL$D+A[A\IHDT$4EH@`Lt$`Lt$hLt$`t$MIHD$L9 D$M$$L9d$.ID$hHp@H[HtID$HP@HHHH9LH=L1L .D$qL*1ɺQH$ H$HwDHD$H1H+L$1H$Hˬ L+WD$DH$HxLHHDILHLHH)A H)HL #Z1HY L*yL$L L)1ɺMHDŽ$?L$Lh L$Lڠ zL$L LAi,L0)1ɺHDŽ$H $H5,H=,9L(1ɺH5 A,9L1Lp +L1L +LH$Ht>#tH*H$H}-H$Ht>#tH*H$H>-AL$L* ML L1L$L *LH$Ht>#tH *}H$H,teH$Ht>#tH)dH$HR,1ɺLL'A)*1ɺLL& *{L$L1LŞ )H$Ht>#tH$)9H$H+H$Ht>#tH(H$Hh+*L,&1ɺ>|$IH9|$LGHD$pIp@HPHHH9tMH9uH$@LH萁L%1ɺO1L(fDHQHPHH|$`HHD$hL1HAHD$hHH?HL$hH9|$WHD$pH9HPIHHHH9LHRL1L Q['(YL ^\L1(&ML1L4 )'$ECT&BT ~ML1L .'1ɺLLP$Ar'ECT&fBT L%$1ɺC1L<'[WIكLA1RL 'AXAYTL1L & 1ɺLL#&RL#1ɺ1L&RLq#1ɺ1L&LO#1ɺ1Lf&1L&#1ɺL?&IFHth L:6L"1ɺ1L&aL"1ɺ1L%z1ɺLL"%"L"1ɺ1L%"L RLLH踱$tIg`MghL|IL$ILLD$b5ILpL-HjHt$LH>L1ILJIILJMt8LLD$5ILpL,HHtHt$LH=HIMHl$LILd$Hǹ 1MfL$LcLLT$(4H}HPHHT$ %,HHT$ Ht$(H:=ID$pHC$tHooPH P0H{5{HSIFoH@@obHHdHHHCHHM6HL9t$H}(Z+HHLJ 1ɺy1LIHl$Y#xID$p1L1L ~IHl$&#EL1LIﺇHl$"LILd$Hl$II*HPAo,$*Aot$rHPHHǂH9u$~LLWLwH$Ht>#tH!H$H0$H$Ht>#tHn!H$H#t{$u tHRASL1ɺp1ILJL!1ɺjLLOw!1ɺLL/W!e1ɺLL7! LL9!Ld$pM$$I9nIt$E11HH4QuIT$HHHH9LHLb L1 L1ɺLS{ H$1L:1ɺ1LQ pL1ɺL 1 H$&L M_SHH $HHh dH%(H$1HHpH^xH.x^Hm H.x#H$dH+%(uaH[IL 11H5 dfIL 11H5 <y4fAWfAVIAUAATUHSHdH%(H$1HG@)D$HD$ H8fht fxt0HT$ Ht$HD$ )DT$ EK11H5oH(eAtnHVsN%=uo11ҾH޷uZLH5 H$dH+%(HD[]A\A]A^A_@p23HƵnHp1HL% IHHD$HE11IGALDH THH HPAWjH AăvDL$E8H萛(DD$DL$EHH5_ 11t$(TLa ^_L$LHfD fHt$0Hp2,ÅL6 H5Ț AHCL9 1ɺ1H5 A@L, H5h fLÛ HL%= 1LtHp2H*AL 1H5 lgL! 1ɺV1H5 ?pf.HZvfDHE@HEf7H*NL%? L+ LfDL% 1ɺD1LlL/8d,]I1PH.LPL1KXZ@L| H5 An/ff.AWAVAUATUSHH $HT$HHILD$dH%(H$1ЃD$<ƒ!ˆT$Ht5?t0HHt$>tL$A.L$t Ef|$|$IIH9ufHH9HPHz@uM1ɺ1L H5 D$ H$dH+%(D$ H[]A\A]A^A_@|$IeMI9tIt$HsM$$I9uLAąH> D$ HD$5fuffi!ML9D$,D$$D$(fD5fE2MgLuL ID$XI$HtHH`usulue@u^HC@HtE1f(ADDt$LDu/AT$LH߃D$(D$$@M?L9 l$(tF|$AD$,L 3L PH Ht$ LD11AZA[DL$$Et|$tDA[EI}w|$,HD$HtiHPHHI3UhH@ I3EpH uPHQHAI3UxI3H u8u/p2H$BHp2HK&+LIт=dCHA1SHt$ 1L XZfHt$Lg11aHt$LH11bD$ DL12H5,EA$uHJXHQXutA$pM?L9f.LLID$X HHHHIH$Hf@AE`t|$DILGL HAA1L5 LO 1LLt$ 0AZA[D$ HL$H5D'Eu)HT$8dH+%(sHH]A\HEPHUH1HHHx3HHHjE11jE1ɿjjJXH 1ɺZILHD$EHUPHHMHL MȿHHHpPY^L۽HT 1L1ɺH5 f.HLpLY1ɺH5Ε n@Hht4HeX%HHH9 Hto|$ u(LG9/HHbu,H,tu HuHH#EXt@Hf諈DTGETLD1ɺWH5i1WD GErh AUIATAUHSH$5FÅt8t=HLDHHE1E1PTZYH[]A\A]fu1L1ɺ"H5 H[]A\A]fDAWAVAUATUSHHuHF`HuH-kUHB@HHHIHH9LjHL511AULLL} Y^H;1LHCHLHI9uM?I9IWH9B@uH1LM麾1L5{ `YH^LfHCH}@HH@HDžH8HEp8+L)HCHpH8HD$HHHu]OHH臏1HLML=;DLz H11V_AXMH|$P2f1L H5v H[]A\A]A^A_LH-R1L!HC`t DH1LLH[]A\A]A^A_DHMLDx L1CA[[Mt%I_HtH{hHtHGH@PhHChH|$K1LH5QfH1M麾1LL{x E1XZI@L- b@HE@HHHH9LJL1LBHD$@1MLv L H1M麷LLv XZL R@HMLv ;HMLLv bAYAZI_HH{hHHGH@PhHChAWAVAUATUSH(HLqHt$HH9^II1fDHPHHHH9u(A6uILLfLAFLjH([]A\A]A^A_fDAI$Lt$L蓈M$I9u9M?I9,IoHEXtLHI9IVB|H15IU@Htf(t ĀH`tHL= j1ɺxLILv 11ɺHL {$1ɺ{LL1Y1L#1ɺL<fLMHq1Lu H5H M?I9@Lt$LLLAF=LL$1Lu H5 H([]A\A]A^A_fAFH([]A\A]A^A_éIH}Pp"HiIIFHP HMHHALIH1ɺ1AWL2t H5ANLX1Z Hl$LMI܉ÐL<@HIJ|8G[u(HHJD8H@[hLs 1ɺIH51sHHt3J|8Ht)hLs 1ɺIH514HJ|835HHtJ|8T;]LHl$LM1H|L1ɺ&1H57_HLHL=lj L]1ɺlLvL=1ɺH5RL= 1ɺf1LL.fHhgLr IH5w1LH(HJ|8%gLQr IH541WHJ|8fLr IH51qff.AUIATAUHuHG@Hf,H5_=H3tduKHAE11HH LDHHPjjyH ]A\A]H@+fDL1ɺfH59 ]A\A]fD1Lq `H5 dff.fAWAVAUATIUHSH8dH%(HD$(1HG@D$$HD$HD JEL$ @ څH.f(tLq E<!I4$1H OH5;HIK2{n1H謎IHHD$IFEHU@1Ht$5ID$u IHHL1PAE11AVHj腙L$DH T$ AiIu D$ WILH贐Mf%@Lq H5 1AUHD$(dH+%(H8D[]A\A]A^A_ HE11L$ 0Lo @Hp(f!L'p 8V@=7M11ALPp H5DŽ f!ELo L!o f.HE1HLPIT$sAAV_AXA<L1ɺH5 AyfD=6M11ALo H5σ L!t 1H5 A^@AWfAVIAUE1ATUHSHhHt$dH%(HD$X1HG@)D$)D$ HtD$ELHI9E1fDIVM?AI9uEEubHHH9t1E1@HPHHHAH9uE,Ht$1DH=n hHXHtHT$Ly"1HL@jLE(HfD$P)D$0)D$@iJH}]HL9Ld$0HCLoA) $oPA)T$0HI9uLM,$LM9tYL8@ILHUH8H@M<$ID$H@MHIEH@LM9uH[HAKHD$XdH+%(lHhD[]A\A]A^A_HL91fDHPHHHI9uLH-oB1Lm aHBH1L)m c"L1ɺMH5 1AE1fh/AfL1ɺ@1H5d f.LI9I|$RM$$AI9uHEHIk1AULl H5`AIXZ LKk 1ɺ31H5 !@L1ɺTL1ɺJH5 AL1ɺGH5\ ALL$LK 19H5- AH <$H5H=fAWAVAUATUSHH $HH $H8fHYdH%(H$(!1Ƅ$II)D$`H)D$pCLstLK1LzH HSt4H1<-tHcD4@Hu CHHҘDGED OZEH"NHL?dHLLH$yH|$ jHT$H g Lc1RL 1H5} QH  AWQH AVL|$hH01ɋ|$ HT$L;HAƅt Dt$AALD$0MtIL$L$LuDL$AEeHH5 uvL5Ku1ɺ LLj H`LH]Uu9H`HLLpHL 1_AXHsHL5v| 1ɿ1Lb wLH踳HsHt0>#t+LE,tH}@E,HsL:*cHHt 荖E1H$(!dH+%(H8!D[]A\A]A^A_fDLsLLMML{ H5m{ A1H|$@46foL$@foT$PHt$`I|$)L$`)T$pyHHLKLg PMH5z 1AA[[bDWL11HEAAąLL$i 1 H5rf.LKE1L)g H5Fz Ar[DH@wM$pH$ 1MHLH<$HiLC1LL$ LLT$>5 $ L<$H$Lxu$%=@ubH11LT$MLL|y ARLT$z +XZLT$Ljy 1ɺ1LHLM.L蠓DyBEDUEH5q LiH`Lf?HHLHL$H$7H|$ jHL$LcL 1QH  H5x QHT$H R1QH AWqHt$hH01ɋ|$ HT$H4$BH4$fD|$LD$0HL=E]1ɺHLr>I$8L芻HsHt0>#t+L<EE,tH}@E,HsLcL L=V)Le AHs11iY^PLSd 1e H5do>fDL5v 1ɺo1LL1ɺLLLDc 8H5v AHsMAWLCd ~1AULH k LLc H5ynSfD1ɺLL-1ɺLL 1ɺLLDL)c 1 H5mLL! 1 H5mW1ɺLLLtHLT$REHLPLT$AULau LARLL$A_XD LLb H5 mL|$0Ht H~/LDL$ 1Lb H5lH`WLT LH5lpH1gAXAYTH~L$L$AVfAUATUSHPdH%(HD$H1)$HD$FI1HI4$u;It$1HIc;HpILHA~A)IDI9LHJLLLH}LpLCHbLLH\LH$pH}LpLHOLHL)H5Y'HHD$ AEcIM1D<-tKHcD4 Huރ -H|$ 1a-T$ ˆT$ 1HyIHHHLAIFHE11P1HAVjH AD$LHF|O@L` 1,H5#3 L1ɺH5q 1AHD$HdH+%(4HPD[]A\A]A^ÐL4` H5gq AfDd$LLxL$fHcD$LHD$AMLp H5p A$fL1ɺH5p AfDL1ɺ2H51@L_ 5H51uA<$#t1Hu%L91ɺH5p NfDLH8L1ɺH5o @H$L1ɺDHD$L1ɺLe_ 1H5vo AUHBHL o B`H@ H@LDʃ=&!Lo^ 1p(1VH5o ;XHZ]f.AVAUIATAUHHHG@Htf8t51ҾypAHD]A\A]A^Dft61L=^ 1ɺ3H5n AHD]A\A]A^HHE11PE1LDjHjH AHE@HrfXdLDHA9DLH]A\DA]A^@LT] )H5Rn AHD]A\A]A^fAWAVAUIATUHSHLzH4$LHL$'ALHAL9u_M6L9tPIvL,ztMOHV1L] H5m @HD[]A\A]A^A_fDH $Ht$HLTAątAL9XuH$LXHDžXfDLHtCHXHLE1JHNL\ SI1H5 m XZQLE1IL\ PIH5l 1^fAWAVAUATIԺUHSfHdH%(H$1q D$$HE@Hhfh)؃U~H5 HLm@MtfAh)M@)I4$1H3It$1HIHD$2LHHD$'HoqgH|$1fIHL$E11HHMDŽ$jHt$HD$(AYAZH HME1DŽ$1HjHt$ Y^IH1IGH@HEhHE@HHfh#LL$L-j 1L[ WL^AHD$8#t!H.HD$@,]Ht$HcH|$HD$8#tHWAG,Ht$H(LЦYfDH0 Lm@M fDLY 1H5i AeH$dH+%(HD[]A\A]A^A_fLL$LN .H5{i A뜐LY 1H5Ni AlE14L1ɺH5i A1fDH|$fD$PZ Ht$Hh Ht$H3zHD$HL$1E1HDŽ$HjHt$ LL$8IXZMLL$(}IGH@HEhAD$xAH$AH$AGP$AL$IH$HD$HD$pHE@Ht]fh#tSL7 1H5 _L-g 1ɺd1LLA5LHT$pHLL$(LL$(tLH'XO$H|$讨$H|$Űm$H|$T$!HL$;APtAPL$MA8tELLD$0HPHD$HHT$(Hx)IHHT$(Ht$0H;HD$HD$L  CLH5fDL1_AXf.L1ɺ3H5.f AQfD1ɺLLm}ff*f('fhHt$LjSD$PL;*CMt$I\Ld$fDII9I>11ILLt9uL1ɺ}L-#e ALK1ɺLL]H\$L-d 1Le NLIQ;#t1H^HD$@,tHL$A,Hy@Ht$H  H|$A@I@AG,証HL$A,Hy@茼L-d Lu1ɺiLA+Z1LH5ƠaL,1ɺrL-c L1A61ɺLL!1ɺLLMHD$LLL|$`HD$hXHHL4h H|$hLd$`H{1H8L1H{L8TMMLt$(I$HD$`M9L|$0Ll$Hl$8M|$AG\tRIIH9u=HmH9t-HuLntH|$0HL$`LL Ld$`I$HD$`M9uL|$0H\$(Hl$8IHHD$`H9tnMDHBHHXuCH r<ŀu7H%r0H$r)@u! uH0rH-AHT$`HHD$`H9uMI$HD$`HD$HL;d$(@Ll$Lt$(L|$0Hl$8Il$HEXH ĀML9uf.M?L9IwHXmtLHI9EHLE5 IAqH4vH| HB1fDHHt L;jPHH9uIHHHH9bHWBF1L9hP@Dž@Ld$`I$HD$`M9L|$0Hl$8MI$HD$`L;d$(}HD$L|$0Hl$8H(@H%Ld$`I$HD$`L;d$(3Il$HEXH$sLHŰI9HIHHH9!HHhHD$LL9u=M6L9IvHktHtIHL$H;MPIH4HL$H;HP%HL$0H9L$lHtL|$0L9}PHt$H|$0HL$`LL-^ L$1ɺbLL|$0Hl$83L1ɺLL$L^ 17H5i^ A@L1ɺ[L-;^ fDLL$LN <H5^ A1fDD9DD9H|$0HL$`LLlL-] L1ɺLL|$0Hl$8 L1ɺLټ1ɺwL-`] LL$L] GH5>] Aƿ\LHI9ILhHD$LL9u fM6L9IvL(itIMtIUPH9T$ HHL$H;HPHD$0H9MtIUPH9T$0Ht$H|$0HL$`L(sL-Q\ L1ɺvLL|$0Hl$8ľGLH@L1HILH9HIP1I9@HH9I9tHHH9H0H9uj1D9rI1L-[ MNHL M LL|$0Hl$8HL$LLE1LM9txAJLt_IH ILD>u=HNLaMIIH9ufH H9L;auHL9uMM9uM9,Ht$HL$`LL-Z L1ɺL(L1ɺMMQ HD$LL9urM?L9_IwLftIL9u fDH L9L;auMMLK 1H5kL71ɺL-Y 1ɺOLL60L|$0Hl$8MI$HD$`HD$HL;d$(Lt$Ll$(L|$0Hl$8-f.@Ld$`I$HD$`M9ID$HPX tHHH9HH@HHH9HMHhL9u@M?L9xIwHetH|$0HL$`LLWKL-X L1ɺLL|$0Hl$8L1ɺHHH9HMHhL9ufDM?L9IwHPdtH|$0HL$`LLL-W L41ɺLL|$0Hl$8CKfDL-W L1ɺ=LL|$0Hl$8 Lض1ɺLHHLK L-EW 1LιHBL|$0L9xP$Hl$8LHIL-W 3IH3H[LH SI1L\XZ"HxH9`I1HL|$0Hl$8IHHD$`H;L$( L|$HE1L|$E1HD$@IHD$8Hl$XH-.H4H}HH9&H|$8FH|$@I7HD$8L9xPHD$@L9xP8 E1fH|$HHL$`LLkY Ld$`I$HD$`L;d$(I\$1H HHH9HCXHDHtH0HLqHHHH9HDH4~H|$8D$0H|$@L$0 ȈD$WMMIL9uMmL9IuLatE1HgHL$8M9~PL9yP8HL$@L9yP8HL|$HHl$XF1LH;1AUSILF L-7T 1LAYAZL1ɺ^fHt[IMtOML9u$fDMmL9IuL`t|$0tH|$WtAIE1fIHLH@HD$8HHD$@^M9~PL9{P8tHL|$HHl$X80LH-0LvF ASISHLqHhHHH9HDIH}E1HH9LHHLpHCXIH9If.MmL9IuH^tHAM1H5L9C ܴY^jHD$LC H5L1襴5ML9t:H\$0LLl$8DHH9HsL(^tH\$0IH\$AL-Q LQ LI%;#tHxHt$HA1ɺBLLճkD$WD$03I7H)HL$HI9u'H L9L;auLt$L@1ɺH5gUH-L|$0L9xPHHl$8LHHL-P 1LB pLL|$HHl$XMLt$`IEHD$`L;l$(t:Hl$0LLt$MMl$AEYLd$`I$HD$`L;d$(uHl$0Ht$L3TuAPHt$H|$YjH\$I1ɺL-O LC HL13HK`L$$1HH<$L$$1IL;-H|$TH|$/H\$HKH胧At(LхLqKLQHD$H``H蟅fH\$H:KQHAHL|$PHN L N ALDPLB =11_AXfIIŰI9u1L9t@I9uL;pP@HI9HSpHCXHt_HJPHtgL9xPuL9tLJH1L-M Hl$0LKA L[L'1ɺHtL9xPyL9n@HLLL?OL-hM L̬1ɺLHl$01ɺOLLïMH\$0L9OLH\$0MH\$@I M$$L9It$H:YtH\$0M&ID$@HtKHHtCH9t>LJL M THL|$0Hl$8L|$0Hl$8LkL L׫1ɺH5 |WL-;L L1ɺLL|$HHl$X议Ll$0lE1\H|$@L|$HHl$X(H|$8H(ATSIL> 1ɺBLL<'HL|$HHl$Xu(LHj(AVSIL= *L̪1ɺ+1ɺLLA̭o1ɺLLA覭ILm1ɺC1ɺLLKAmHD$LL pH5Hǀ161L-J L4> ALLͩ1ɺL1ɺL-H=+HtݾH+Hff.f15IDAWAVAUATIUSHH4$dH%(H$1D$HH$H<$Il$8JHD$HL#Lt$E1@E.DEX HfDEnIE6IDA uA#!A'A"IE1LA8tHBHEuDA tNtILrI@TA@L; 1GH5G A蔩H|$蚹D$H$dH+%("HD[]A\A]A^A_fIFI9HcÍSHL?YHDŽDHcHDŽ H<$H54G QH<$H5)G 9 H<$H5G !GL<$H5G L H$H-G H$H H$/LuLJHHPLELGI|$LhLHLLH1ҹH=ID$HHu1ҾqLY$}H9gHD8-ux-uPKHH$-YH9tQHHV=u1܋H-HDHD AH1Lm9 L t`ARL[4D$IH LD 17H5D A薦A1ҾLrLH貺iA5H1LK8 !D DQHH9t$ AfI^H$pl$hE1HHD$8H\$P$AAIH(D9~nJ EHu u?I|$H5 DT$ HL$0hDT$ D uA HL$0D$ID$@Htf,u맋l$hT$N4$Af tD l$(A4$Ht$@ML$@E1D$MMHH0@HD0@D$pD$hH|$`HD$ $L͐DHKHf|(t|AZIS H=< HcH>f.AD$Ht$ HHLfH(H99uI IRDpzvh{Nq}g]OSI?5o+!IXfDAfa HcHt$`MLRHIL,I I(M9A9$uID$Hƒu|8fAD$8LMnIE1L AAI(A9A9XuI`HƒuwLIlfAz(H5ś tI2I|$L\$0LT$(NLT$(L\$0TI(M9,fAD$8Gf}(H5b tHuIpL\$0HL$(HL$(L\$0Wf}(A|tHUH91fAz(AD$$tIRH9D$8LIυvt$pD$hdHcƉFD$pNvzgDME11Lt$(Dl$0EMAD$MA$!$A?DDAI(A9t#DL uAD$I(A9u݋$Lt$(Dd$\MDl$0D$(kID$@Hc fh)H@)H$P1ftHH$X1ftHfH$`tHH= H$h!HaH$PLd$ IHHH;Ht/pHHH9\$8uHLLd$ $|$\!9|$xt$(9D$tDEʼnt$xD$tHcH5JL$HiH Q1fIL$(L-@6 AT$0t_HtGHcHHcXH,RIHf|((t%@ 1M1L薖ID$@1fT((IL$(9|$t$At$\Ht$PIt$`HtfhfH@LwIID$@HAfh3LL+(A$ID$ @@ID$@1Ht fhID$(LAo$PAo$`Ao$pAo$HA$Ao$Ao$A$Ao$fxA$A$fA$HA$ A$ H'H HI#$H I$Å` A$A$lA$A$TA$A$UA$uh D=- Eu  I$Ht1ҹH=|GHuI$0A$A$A$I$8A$@zIl$@I$Hf8)tH)LA$ID$hA$ff f1E1LT) H5e KL11| L.H=Ht H=Ht H=}Ht[=8HQHNHKtA$uaLH=LtLbA$tUHpHHuI$8HǀH/H`AP ML$11Lt1 L肑I|$ID$HID$PID$HHGHPHHHuH=Ht&HHHrH_H=HFHi H%T$$M܅t9$%Dl$hED$pl$|fo$fo$$D$h)$$D$\)$$$$fAIHcD$8L@IIfAD$HHcH4HiHH5EH$H0HA$I$(M$(L9L=:HEHPHZH$H{HH$P̟H$$h%=^LK1H-:Lz$ H-LKL$ 1H1 H@LHO>L# L к1؎HmL9HDŽ$P1HDŽ$XHDŽ$`I$8HǀLP LD1ɺ 1L[D$\l$t$D$(D$xA:3ID$ AL-A$(ID$ @@L 1ɺd LLA軍"fDHpwO$Ll$HL$m$Hc\$|H5HitPHcHH ubHiH=r7bQHcHH8u,Ht$PH>t1 H9FHt$PLLMuLiHB8D$`H8H+$H5HT$ J>J>N>DhDfEH8HxHt$ DPBIL$@HHt$fEt;A1MDSLHt:H<Hf|9(HI9uޅAU1E1LLUH!H4vHf|1(tAHL92Hu׃L " H5Z A蝋HD$HPHtHWHI$@H@I$8HǀHLL 1ɺ 1L!nHBHHFHI$@HBL A$ID$hA$t+L 1ɺy 1L赊Il$@HDD%ED7EuDML$1L) 1 L^ٙ1ɺ LAL) 19I$ L L) LHLE111L) 1ɺ LID$@H  f H%.1I|$fA@1w$9t$h$9t$\LJ1ɺu 1LA^+HCHtHFHI$@H{HC萐I$@HHHL1ɺ 1H$HrH9$$H-3o8CH-3LK11L H葈_ID$LD# 1 H5W AYA$ID$(L" LL1tL51W Lӄ1ɺ LL5 W L1ɺ LŇ1H5O& HC蕙LKH5uIHY A9HEHH5 APLVLP1YH 1L_ L5XLN% AH5.% A qL1ɺG1H5rL1ɺ` /HLLd$ uH9BH$H9f%f8IT$ JA$@t a f A$@ A$fx@LEA$ 1A$ sŃ*!E1IT$@HzA$Hf fA$AEDfhDEA$fA$D|$@$E 1ҾL`4$E1PL %H-A$D-%L-55%D=%P1VLAWڄH 1ҾHxLHvHgB`1ҾLbH+HH=oHH?oHii1ҹHHHD$ rH@H,H 11D$ D$ XH莛41Ҿ*L_+LH-rA$ 1A$hIHHHL-X$ t-H5LL->$ tLLMM$LLИ A$@H1M PL 1L%AX1LAY)2jH ID$ @@=ID$(HHM@2H9uHcH MHHLHt$HT$PLы5AŅ~ tA$ID$ @@1ҾL]L{L 1ɺ 1L A$I$L=|H5-=-S@HHHL1ҾL7]ID$(fxm,A$IT$@HfxtHA$p1ɺ LL~A= A$f Lp H5 LHt&L4 1ɺ 1LހA$H5 L֒Ht&L" 1ɺ 1L褀A$H5^ L蜒Ht&L 1ɺ 1LjA$=gH= N譔H -HHDH%'1H= 茗=U%==%H%Ht|H5WH$AHH$fo$D$H~+)g+Ex =o+L 1ɺd1H5zT\H* xX1LU H5B!8S1L H5~1L 1ɺHH5~H5*=*`m1L 1ɺr L~ID$(1L 1ɺaH5^~ID$([\f.A$EL 1ɺ 1L~ALh 1L 1E1}"A1ɺ LL 1A}AL 1L 1E1}A$11L诰AŅu9IT$ JA$@ttbID$@HA$1JLz1ɺ 1L}A$@IT$ tBuML$L1L0 E1|l8|$L' L1|$6%D LQy1ɺ 1LAb|/LL$ L QH5/|gH= 莐HD$fHRLLUD-%E@f 2fH$1ҾLI늋T$$qHt$(H\$ EPv Ht$01HH4$HIc詉H4$HL$1H L0E11ɿ}1HHIcpH|$HE1H |011R}SD9eAD$hhE1H|$(H;$ t $$HL$iY LqLiH$dH+%(HD$H[]A\A]A^A_EL 11۹bE1E1H5H 4ApAEL$HIŸGED$>LD$ 1H1H$(H8ÅtDLl$(M1L2 1pE11H5  1E1 豃11L1E11B~͂fDAUIATIS謙HtG1LH5D HHHHtXI\$L[I$ID$A\A]fLj1ɺ1H5 1̚f.L\j1ɺH5 H{1txAWE1AVAUATUSH8dH%(HD$(1L$MoE1L$HGHD$ M&fD$/ƒHT$ D$L:M=L̀HHL|I~HPHHT$tHHHT$LH藅HH5Ql L)L{DLAC%teML) H5O 1mE1DHT$HBHD$L:M-E1MAAs]%uAtuAyD$/!ƒHT$ D$HI~H0HVH(H@H@MIT$HPID$IMMD]DD$/;ƒHT$ D$HLDD$HJDD$HHH@ H@H@H@MtID$HEIl$I~ DD$rHfI@HE HX@fHT$HBHD$DAD$/ƒHT$ D$HLHL聃IHDE1HD$(dH+%(H8D[]A\A]A^A_HT$HBHD$DHE DD$fIoHT$HBHD$[DE1ɹL ^L 1H5 .~fHH|$ Ht$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$ 0HD$$$$UH HT$dH+%(uH}@USHHHHt ;pHt6H1HtI@V~IHtAHL[]ÐHE1L[]N79}+AABHtD@f 9}BHtE1AWAVIH5B AUATUSHXH|$HT$L$dH%(H$H1HD$8BH!HLd$0H\$8L- DH LH]sHt_L|$@H|$81LHT$,LtuLL{|uH|$L$,!H5~ @H }H|$8vH|$tAL$t4H1AVLL$ L H5X1ZH$HdH+%(xHX[]A\A]A^A_zHd8xLL$Hg H cIHH5A9HDHAPLQP1H HD$H|uH|$8u?JzHӒ8wLL$H^g H 3cIH_H5A9HDHAPLQP1H yHl8%wLL$Hf IHH KA9VH5HDAPLQP11H qHvL"H=tnHt0uPѣ-6HLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH+%(uHznf.HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$1HD$ HD$$ D$0MHD$dH+%(uHmAUATUSHH $HH $HL$P!IAL$X!t@)$`!)$p!)$!)$!)$!)$!)$!)$!dH%(H$(!1H\$ IIH$"!HHD$!H$0!$ D$0HD$g~ILn1DL1H$(!dH+%(uH![]A\A]lATUSHH $HdH%(H$1HHH+J11H1hAąx.H$dH+%(HD[]A\KkH-ԃ8h<$IٿIHUX H`HDHH APH5VLQP1HkfAWkAWAVAUATUSHH $HdH%(H$1=rIIIL5V1ɺq1LRL$HML 1AUtLU1SǂAD$H H$dH+%(u?H[]A\A]A^A_DIL<[L5lUxjATUHSHH)Hs\IHt"HHHnAL[]A\1L H5L[]A\ATSHHHGHpHG HwHPHW H9w)H0`IHt`HC HL[A\G(HH+7LNL E1PH51iXZLH[A\@LP1ɺ1H56@AVAUATUHSH [IHf@A$t6HCID$HsHtHID$Htr[L]A\A]A^fDLsLcHLhLE[HtpLLHblID$L 14H5c돐1ɺBE1LOH5=fID$1E1L ;H5(f.ATUHSHH5* H;Ҋu6ALl 1 H5SD[]A\fDHHPHH0L"LH H@0@8HCHtt1LH52 HXLHA>fDHLHCHtH@Ht HSLLMd$Mt EA"L]H!L\HA1 fDL%E1LH LuLE1ɺoL1uDMHEdH+%(aHeD[A\A]A^A_]fD1H5mHw~HL?EI|$1HڍHzH;1LH5y HnE1ɺLDH5tDM/f1LH53 H+A>tnLHMvMtRA>tL1LH5 HuE1ɺL!DH5qtDM1LH5 H<E1ɺLCH5ɦ!tDMULH%MLC1ɺ1H5sE11LH54 HE1ɺLACH59sDM HfJ HeA1AփH<1D9rHʨ9fL%Lb ELrLB1ɺ E1ɺLqBH5irDM1E1ɺvL>BH56rDME1ɺLBH5 brDME1ɺLAH5ޤ6rDMjE1ɺ|LAH5 rDM>E1ɺzLAH5qDME1ɺ~LbAH5ZqDMELBA11H51qDME1ɺLAH5XqDMzYf.AWAVAUATUHSHL LgLM9LAL3A#tof.{THBDp I9twbTHD< uE(HH] L9tSHHDQ uH]L9t@IH] L3A#uI9t&HCHt tHE HI9u@LeE H[]A\A]A^A_A?t E;LWr[w1H  HcH>[H  HcH>E I9tN1DP u2HL9t)Ht!#{@!փ@=@@uI܅t EILe H[]A\A]A^A_EHL9tH DHu.u}uIE I9trELcELcHEL9utHL9g<'uI9W<HIIHSEL95Ct <"t<\t/HJL9BHʄuI9<HIHJI9BHʄtE LcELcELcE Lc@AT UHSH0HIHf@}EH4 HcH>fDA$HHHtH A}I\$U(HEHH+ELz RLH1H5)E1ymXZL[]A\HU HuA$H}0ID$HA}?U(HEHH+EL RLH{TH}11HWID$tj"Hu@HH=XUID$[EHPUHu*L# 1ɺH52lf.uU(HEHH+EL2 RLHA$SH}1HWX ZAD$}XU(HEHH+EL RLHNfDA$HID$H}U(HEHH+ELm RLHU(HEHH+EL{ RLH@L 1H53kfDLx H51E1kHofDHWfDH{?fDHc'fD1HNfL Sf.L91ɺ1H5E1;jfD1ɺE1L9H5 j1ɺE1L9H5iaUHSHHHH8TDHt/H;HhtQHSHHPHSHHCH[]L H5]iH1[]ff.@UHSH}PteHtW 1FHHKH}KH}KH}XKH}`KH}hKHKHKH]KKfE1HPHfFF HOPQAAADpփp pp P,Qp(P$QPQ HI(PHHPHH  ʉPDfDADfDAVIAUIHATUHSHJHwZ(PIHL'OID$HHOID$HtNM,$I\$[L]A\A]A^fE1I1L uH55g[L]A\A]A^L H5fgIl$HtHI1HHFHII|$ILE1IYLX H5fA(z1L H5޾{ffDATHdH%(H$1HxFAL%1H$H %H%H5bF~>=o%w~0b%AH$dH+%(u}HĐDA\L 1H5ef ML%e8MJLRIH5ʽ1AE1pMff.AVAUATUSHH $H dH%(H$1=ށD$ D$ n%:H\$L%^f1L LH0 H.5~(%% %=#wJHT$ H5j H= HT$H5mH=8 sDl$l$ HDEL31ɺ* ~H1HрAą@AH$dH+%(fH D[]A\A]A^KE1fD@L[QOLA覻DA;O112E9AUL%1IUL. 17L>cX ZHNAվ!HAƉHH DH H%H H@DN11蟁f.D$ Ld21ɺL% 1Lb1LL bDLL E1SbdfDL11ɺ{DL11ɺ5L%s1L bL11ɺ1LaEL 1H5afDI8H-aTF|$ILIH6 H#H c HDH>APLMQP1H DL11&HH-$aL%u8E|$LIIH5 HH HDHAPLϔQP1Li01ɺL1H `DHL,01ɺA1Lr`&HUSHHG8u 1H[]H-7`D;IٿIH4 H~HDHH APH5QLQP1ոH ff.H1L} H5_1Hff.D L~_Et1A"1D L H5N2A@L1 1H5-2AfDAWAVL52AUIATUSHHHdH%(HD$81=NHD$tAL51 ;uPLA L1E1^HD$8dH+%(wHHD[]A\A]A^A_fDHŅFHT$1c=HD$HLIٹAPL| AE1^Y^=^mEH-]8BI1PHy LPL*.1XZfL=y%AA1H XMH L-111LNBLD$ ljD$LLD$>DT$LD$LH 1DT$D BHILPL? UATAAE1\DT$$H Dr<6EDH\8A1ɺLPHx L yx%PL,1AYAZ@CL%\8=A;ILIH1 H{H HDHAPL8QP1AAEE1H L+1ɺ1LE1[Vf.L #f.;CH-[8}@M1PHLPL+1_AXBH|[85@=>w%MIH/ HzH5HDHE1APL'VLP1DT$$H /DC@HFLH / DFHHc HDEHH` HEȋFwFHLJ QRWLNH5-1ZH HDuHLH QRF8PF4P1WLNH5P-KZH0HfQL RF0PF,PF(PF$PF P1WLNH5-ZH@HQL RvWLN@&AWL=vAVAUATL%fu%USHXH-yvdH%(HD$H1H]L9wH=9 dEUHu8D]4H}@DM0DE,M(DU$Du Lm[wqiLrE@A,HUHHEHHBH;HL9HDuLHEjH= EfuAt HXHD$H1MASL H5+D\$$ARDT$0AVLT$(AHHD\$4H 8tEDT$ A}<L 1;H5)+XL9 1H5#J1H$dH+%(HĐ[]A\A]A^IAt'EHf1HCH_fH5 H.Ht\H1UH-L ^ Li HxI^1_1ɺCHLXI1:}hM_IEALLH5 H|0AVANUH׻L J-L%LE1L6 LHLU0ZYHCHML4 LRH1xIHL B0IXL H5KFH1(ff.@AWAVAUATUSHH $HH $HD/dH%(H$!1IEuUIhL| H5GH$!dH+%(H!D[]A\A]A^A_L$HLIL*AŅtpLX*Hv/A?/t)IWL11:/@HH9u{M~L[ H51E1GDH$MH^HHD$H1HH 0H|$Ht$ )H$HD$u H;D$H$HL$)IH$@HD$M4L2H/x.LxuAtހx.uA.uAtf.1MHپH2 LtHt$L)uHD$H9$hwLd$LL/L/tN1-HE8s*L G1PHLPH51XZLd$fD1LHAMs1Lj H5B8EL/qH-MLK H1E1D.DMs1L H5DH$MHFHD$H1HHݺ t+H|$L'H$HD$@ML +H3DH-+8(=EHH IHbHDHH gAPL XELwQP1H ML ++HCH-8U(1HPHL DPL1Y^K@AUATUHSHHHD%2dH%(H$1&HHǃ%HǃAtKEu^H~*HHH$dH+%(HĘ[]A\A]@H5u H'HH%}HtHtIEAHLH5R`AUANUHL &L%*LE1LF LBL)ZYHHMLA LSA1@H1UH-L L HA^1_1ɺDHL%|A1D1IILZ H5RHA1hl)IYLu H5A18AWAVIAUATUSHPH8dH%(H$(1IVHAIH!E&AtIcH5 HD$EI~H$1(HHMnMv/L2$HHPLH L1ɺY;H5p@HLE1hf.AA1AuAH$jAąD 8aHMc&H$EaDŽ$D$xfDAdžD=Fk%MnAwDL18MDI}"Mm H\1MuA,DH<HHH@I~pI~`I~XI~h HD$fMt4IH4$H L N 1z>Mc&Am,DH<HHH@IFpI~XHD$HHI~`I~hHT$1 HT$HH@HD$H9I~`HHT$ HT$HD$8HpH\ Ht$0H9AGHBEtHۃsH޿{&IHIH A_ LAG8PAP@AWAGAF4xMD-YMcN0Eu Ef8EE1IcF4IAOHH H%H L IG(IF=X%H HHA>I01%IHBI1%A>uAOAVxt,=YX% OH4$L 11p<AF(tAOAtAOAtAwAOAt0=W%wH4$L 11;AOAEEt=W%AO@EEt=xW%,AOAF,AoI8AG AwDHMnMIL|$ HD$H$HD$Lt$(M@MfL,H2IH|$LDŽ$L}(H$IFH$*$Ƅ$MnEeEx DL1H\uLHt$DPL9@Ic҉HLH9,t @LA\u A\EeHID LxEeEu@HHfo$HHHUH)艄$H$fo$HE ]HeMv MH@H4$$1LI 9H4$1L 9D$EA>EEwD$xD$xe@ Mc&I~hHH|$ I~` HT$1HD$0HT$HH@HD$8H9GL|$ Lt$(M1H4$L$ 8H4$Li118AW 1LL|H4$31La n8fL|$ H4$1Lt$(L 48^H4$)1L 83L|$ Lt$(HIvXHt HT$H#Iv`HtIFpHT$0H}HE#IvhHt HT$8Hn#IcAGAV| jAOt AGHHet =S%vAAO @aD$|IcH7In`HD$AG D$HHH5 H~ HDIFpH5w H p AAEfAnF4EN(EVxHD$ AE^|H4 HEAHD$hAH% HDHD$`AH HDHL HD$XH HDAv0HD$PH HDHD$HH HDEfA~HD$@H HDEHD$8H HDEH HD$0Hլ HDEHά HEHL$(L(EtfL? f8=fA~I~XH L%8 HD$pL L  HAIO0MHL$H H HDHH$PD$(PH2 Ut$@$$$$$$$$R4$$ARAPL ATVASWAQL 1AU$QH$H$Ӌ=LQL1$PHAcD\$|EA>LrZAD#Et'H$H5LƨAAGe7<H(AW 1L_%LQfDD$|} 8A91AAPt xD\$|AgEDN=N%AG H4$1L 2L[A>LAW 1LLDfI~XHO 1f8=HD$pIIfA~IL $ HH= IAG A1_AN.΃ fH| HcH>f.AG\DH-]%HtzH|JL%18HL  PH LeEPHPPH5) P1AHEHEH H4$L11Q[1fDH- `@H4$.1L 1KfLLDT$@DT$@K f-\%H0u Av0 fAnF4H=/f~BL^: L (3 L& HIcPH ARHWQ1AQL [1VAPL AUt$PHt$PHP1A$XH4$=1LQ 0;ffDHI~IIMg(MIG0 HD$IHuH|]IEPPHH0HG1P8H4HI9uLd$Hp 1L+LAF4AT1L P1Ht$EN0/AXIFAYH4$81L .KAL.L  tL  H! LEH$ 1L HAL? H1'U.AO EL 1E1H5s.H$(dH+%(xH8D[]A\A]A^A_f(H4$L 11-AOI@IVIH1HD$0HD$8fAOH$H cE^01HDŽ$EHL-p.L% LHGHHH&H2 x.LhuA}tހx.uA}.uA}tLLt/LlH HPLLD 1ɺH޿LP,mAv0fAnF4H=f~tfH= f8=f~L5 L . L HIcPH ARHWQAQL g1VAPLq AUt$PHt$PHPZiG% MG%"@F%D9-H1ɺoPLѴ Ht$1D+Lc F%EN0AZA[AAN0fAnF4L+f~…H=ytfH=f8=f~H5m- L5 LdH* H L$HTMIEHASWRVQAPLE USPHۂHHD$P1AMc&HPfH=f8=f~AuH$Ht 8 AvHA~LIG(tJHHjH jE1E1W щHVPjH$NH0I~PHtW 1H M~PAEE HH MnMt-/LO HT HPLH'g IHtHK AF0HE0AF4E4 - L}LHP H&HHu1IHEP@A;F(cMVMMMDMoL$L L$HHPuDHrMoID8 tIIIWMjH9Z IBIOH9 HLLT$H$H$LT$ IzIwL$kL$AL(E4DM0 AULY 1ɺPH޿1AY^L L$1ɺH޿1MJ'MO1ɺL H޿1'L$MR M Mt MM M H/AdžAF4qAN0u`fAnF4fL1f8=LMMf~LPL11H5Q&IHtHuAF0HE0AF4E4AFIvEL߷AF4HL3 P1Ht$EN0 ^_6H-HHPHHLIL^11TH5y Hs  HHLH]H]PACHH;1E10HPLLvLCED`Hþ/L{ LHuLLJHE1蝶L1ɺH޿LU1LLLHAF,H$LM $0 RL1ɺH5w(-HEHHE ˵AIIIdžLIdžLÅzE1Hl1E1La H5veL1ɺq1H5v1VL>GL1ɺx1H5v'HߴLG LHaIG(Q1jIHjI jAA ҉HlPAFDDPHt$8EN@EF<]BH0L|$ Lt$(H8BL 1LPHePH5u1AYAZIG(Q1VIHjI jAA ҉HPAFDDPH$EN@EFfDD?%DEt %E,A$DžHT$XdH+%(Hh[]A\A]A^A_f.1H=uiLt$R1 AŅLDPHD\$RfEtEAM D f|$RtD|$HEL P D|$ L=D$L1|$11(Y^D$D\$?1D1 D\$D$D$D\$jPE1L AR LDT$ D\$AZDA[D$DT$t'L1ɺ 1LDT$D$DT$LE$?38 HL=SL LI 1DtL1ɺ! 1LIA$1L1Lq #E,1DL L=1LpLI D1f|$R@DT$8H8` LW PD$PDL$HL1_E $t AX1L HLAQJXZ L1ɺo H5% L=L 1 LHY @Hl$@UAUASAQE $AVt$8t$Ht$Xt$ht$x$APL WVLQR} P1SARH$ӸHĠH H {H oHcH WHKH ?HŇ 3H 'HÇ Hw HHI H^ H H6 H? H/ DT$8H8@ L PD$PDL$HL CHw VDT$8H*D$8HLL PDL$H1 XZt$8<$mD\$8H ?8L LPD\$@ 1ASDL$[A^#AUATIUSHHHdH%(HD$81HHMLAH%E0LH % ЉE4C1L-HtR@HDHH@H9uH3LL讬H9t'HL`1ɺ1H5O!HL[]A\A]@ATH=hUHHHHIHHxHHǀ1HH)HID$`Md$=ID$hID$`ID$pID$xID$pI,$:ID$H:ID$HHL]A\fD1L~g lH5-HHL]A\1E1lL6g H5XHL]A\DLf {H5%I<$E1IHL]A\fDL$ H5rI|${:I<$E1f.UHHHSHHHH9u "fHH9tH;XuH[]fDH訂tH{XH蘂H[]fHWHHOHHH9ujf.HH9t`H;puH9tHBIHH9uI@HBHHFXHNXH9u "fH9tHPHHH9uHVHPH1ffDAWAVAUATIUSH8H^PH|$Ht$L$$DD$ HWH1IHxGI9LBEHH@HLHxPuHD$HhpH}t0H}HI9LBH H}uHHHl$E1L5IHD$If.E=Ht$H^pH{uUDH H{A;uL{HMLDL|M9A9t"L1ɺB1LALKML 1LC1AL1ɺDLDHHH PL߄ 1AQZYt$$Ltc;t[H[L\$(HHI1IHLH PAD$D)t$(L} P1L\$HALH D$ u}HHT$HHHVHELh PL1RMQ1uHUAMH0AEH,@IHHl$H}PHH8[]A\A]A^A_fMHʁt/w\H t!H@tHgH HEH5HHg H HDH5$@H9 tHlH HELL$(LԈ 11<L5LL$(HTL=͂ HD$HhpH}ff.@AWMAVAUIATIUHSHH(H?DL$dH%(HD$1QHxHxHHIHǀH1H)HL_H;HPHHT$HHT$LHLIF&H;LhLHLLHoEH{IIFD$AFoMAN(oU UfAFpIFHIFPHIFHIFXIF`IFXIIIEHl$M~xHH AV8H H%LH кHD$=}A<$HD$dH+%(H(L[]A\A]A^A_@IF"1E1Lʆ H5fDIFfDL 13H5]H;LE1]VLH{LLP<,L 9H5kH{H DH;LE1rfAWAVIAUATIULSLH(LnH$L$ dH%(HD$1HD$M}Mu^fDM}IMtKLH9uHHLuHD$dH+%(+H(L[]A\A]A^A_fDA$H$HLPHDl$ ILL$D;1LIDH0A҉Ņ~D;L|$yDA$KDmL K L!HIF`HH7 LDʃtGH PL 1H5BAD;XZuE1DMT$:HH5VB| PL 1AD;Y^>H6H?HHpHHxfAWMAVAUIATAUSHLL$HtQD`0I@8h4t|LAąu}L1ɺ1H5mLy&Ll1ɺ1H5@E1HD[]A\A]A^A_f@|x@LLyAąH\$Ht9IFPHh0H@LL`LHLHHHH|$PA:IFPHHLLhL蓼HLHHHHD$PH@Ld1ɺ1H58HD$L| HH51E1lHD$PL7H뾐AW1I1AVL5AUIATAUSHDD$Lh| DL$ IRVLZYWHD`0T$LH@8HʼnX4@|Aąt`D$ H苟1AċtD$fRE1E11PH1LjjPjH0HwHD[]A\A]A^A_DML L1E1 DžNAWIAVIAUATIUHSHlHfH@HI9ttL)LHuLI2HteL9LLHHFDHI>HKt}IFL3HCIFHI^H[]A\A]A^A_DH ϳHC1L2 u H5=H1[]A\A]A^A_u>DUSHHdH%(H$1HxmD$A%=@u'H$dH+%(HĨD[]Iٹ!1Lʀ H5y PE1H-<8;IٿIHHHDHH  APH5hy LQP1E1H ? fH֋Q0ATIUHSHH>+1LHHHu.uHHHADHuI$1H9E[HD]A\fDAUIATUHSHHHL`I9t5HZHH9tSLLHHL[]A\A]L@HB`HJ`H9uyfHH9thH;huHZH9uIUHIMHH9tHfL;`tHH9uH9t1HH9utH[]A\A]DHEXHuX1H9tHH9uuzff.SHOHH۰DK4DC0H# HHDHH 1qx H[H f1L1ɺH5p HC[AWAVAUATUHSHHLHdH%(H$1胾HD`D'H}DHމ2HHt L`MuZMI-H,I1M|$M)MtPT$ MLLYtuD$ LH-HIPH5l ^1Lg} Y^H$dH+%(HĨL[]A\A]A^A_fLl$1ҹHLyHHI)LBD$_LD`D&H}DL0L=HHHt7L`Mt.LAVMPL| kL= L-RLLHHI9u}N,#LɼLD`D&H}DLI0HHtIL`Mt@LPHMLz| Py1H5 AXZILv| 1E1~H5 AmƄ$VfDHAVAUATIUHSHMAEt^1HvVL51LɻLLHIt2LLHA1EuHJ4+LL)[]A\A]A^ff.AWfAVAUATUSH$PDD$@L$HD$ dH%(H$1)$)$)$HH:IHDLg|It$H1ۋ$@A$I$D$ Mt$xfAD$pH$dH+%(HL[]A\A]A^A_HHT$AIHhHT$HE1ML$LLCHHHHHxXHEHHp@xD$@DI쉅At$I\$HD$XHD$`H\$hHVAL$$HD$`M|$AT$4At$0HL$xH|$XPAAWL${A]ZAD$4I1ɺAL-L z PAD$0LP1&A[]艾HHEAD$0E8HE0AD$4E4ޔLHD$@/m:DT$@ENH\$`H\$H|H=蚸D HD$(ED$ Hl$0L$L$Ld$LLt$8D$D1Ll$ A@HL$DHlHL$I@HL1I LAI~A HEH LH H H$1@H‰ Љ1H9uL 1кN+HH&HxHD$AD;(5Hl$0Ld$Lt$8Ll$ H9kH|$XH&kD$@f.L1ɺ1LE1/f.LQw H51E1WHضI?LhLyHLHH蒿I$DL-0Iٹ=L%w L2fL1ɺ1H5^fL-Lv 13L(L1ɺ1H5]fL)n IDŽ$fDIٹLLv E1H|$XHFQiHuBH;I<$HIHIٹ:LY FfHHH蜟,D$%=`IFLTc H51E15+41E1Lb H5H$dH+%(sHĨD[]A\A]A^A_@:H?LLL]AŅLjHHt*I<$LLAŅAuDL1ɺQH51E1SFfDIAL LĊ1ɺ>1H5L1ɺT1H5p޺fHT$(I<$E1E1LHHH  L91ɺMIH詢fAWIAVAUATAUSHD_H_dH%(H$1Et-Hu/1ɺE1LH5 BHHu]IٹLV H5aAɹH$dH+%(aHĨD[]A\A]A^A_DLPIH@ H$dH+%(HĨLL[]A\A]A^A_L95D$HT$@jL% x L-U L9A{ACIcL>L\$Lt$PHT @L1L\$AS(Aw4LL\$A0 L\$=A{HawʞL\$8#H-1ɺN1L؆HLdž1ɺ1HE1 <DIKMC Lt$PL@L1L\$<L\$7fL\$AKLt$PHS @L1 L\$fL\$AKLt$PHS fAKECLt$P1HeS @LL\$踆L\$fDL\$Lt$PHS fA{tYML9=ALJA>H-L 1.HصHLL\$L\$A8Lt$IK I9uLHL$H:HL$L^ IH51QAVE1XZfD1L9LL%AH)HSAVIx1L\ H5E1A_AX7H-L-HQ IDL%tQ LE1{HLc\ AUISH5+1ATH H-L-6Q HHQ L%uML% H-bL- Q HL-P H Q L%P _ḦLAkLHL[ UH-I=H1Y^1L\$HL[ EEKųL\$H1GEKL\ L\\ 11IH}ML1ɺ1H5V|ff.AWAVAUIATIUS1IHH|$dH%(H$1HGHD$,HD$HD$`HD$DMtcM?L9|$tiMtdMwMt^IFAvH$H<$11LDH5MuDHD$LxHL9|$uE1HH-MtbM6L9t$thMtcM~MtZAuAGIH11LHMuHD$LpHL9t$uH$dH+%(D$,HĨ[]A\A]A^A_H=OH<$LLIHB`H`H9uDHH9L9puHAv4A~01jHL$(E1E1ZYD\$`ENDT$dE@AvDL$,E(IT$|LL$0t$xH<$DzfoD$0foL$@foT$PAFAN(AV8@I~HLG1ɺ1H5@HLLR IIWHIOHHpH9HH;pHH9uH91HH9uLLLL1ɺH5l߯D$,fInXIFXH9QL|$ H5DHuBLG1ɺ1H5HmH9tHL}AGIuH=LL>tM9tEEuL|$ VfDL|$ D$|H5LL P$P1LL$Y^D$,EFD$,EtA~ uoLHŮpLX IH5,1AL+~1ɺ1H5mD$,xLLLD$,rL}1ɺH5!4GAWAVAUIATUS1HH|$HT$L$$dH%(H$1HGHD$ HD$@Ht[HH9\$taHt\HkHtSuLetxMO11L'}H5mHuHD$HXHH9\$uH$dH+%(ED$ Hĸ[]A\A]A^A_H=IHT$LAHL$@Hu4}0jE1E1ZYD$@ D$PD|$$EtH5L腑HHEt$\|$XDEVML V W%H51VY^D$ H}HL{1ɺ 1H5L@LMYM~XIFXL90HL$pHl$8Lt$HH\$0LILd$(6HuHLW{1ɺ1H5+HH9LcE\$I|$EuH=LLHtHAt$4E1E1A|$0jLAYAZDD$pEt$tH\$0MHMLd$0PAF4LT H5qPAF0P1ܪH jHl$8Ld$(H\$0HtHT$LHgHEDEpLT$\t$XDH8`T$DtD$HtJHHtHHЅFHEHUHHMHHpH9ZHH;pFHH9uH951HH9uD$$HT$LHHLZy1ɺ^H5+D$ A=9H=G BHMPL%G 1VH5WMLx11-H5H 'D$ Zf.D$\MLR IPD$`PLx1ɺUH5ZͨL\x1ɺH5-D$ CLd$(H\$0L%x1ɺH5i|$$D$\MLQ :PD$`Putt$\|$XHE t$\|$Xt$\|$XHE xff.@AUATUSHdH%(H$1?u/H$dH+%("HĨ[]A\A]DHI蝊uD$%=@tL-B M11L,E .LALɎHHH/H{/ύHH}tھHmyT8 HuLiv1ɺ=LH艉1LCv1ɺfL1@LxHGfˍ8tbHMt}HzIIHH oHDHPAPLQPL1H AL sL~u1ɺMHȥz}HMzIIHRH ooHDH@APL|QPr褍LuO L12UATUSHpHH@HxHtSx.HPu ztx.tHE1ߎu=D[]A\z.uzuH,HuHA袎t)H-8kIٺz1PH%LtPH5? 1XDZ[]A\H-kE18!1IٺqPH=%H5? PLt1Y^5AWAVAUATUSHHhH<$Ht$ HL$DD$HH/HL3HD$L97E1M6EAL9uH$H8`~HD$HrEAODH<@HD$(HHHDIL9D|$8E11Dd$0EIHf.DI}AH@L|I?$MmIGHM9uDd$0D|$8HDHD$0HD$HЋT$HHHD$8AD$HHD$PLtH$LH8p}IHHL$8HT$(IE1D|$LMLd$HDHl$@HD$XHXHHHHD$0H@LlDAoI7HIWL3AoGCAoM9u`HD$AD|$LCHl$@L0D$H]HD$HT$XHPHD$ Ht$ALpHp H܄Ht$LDLI觍VfL3Hw HD$HD$L9H$H8>|HD$HPHL$HT$ HvAHHBHAHJ HhD[]A\A]A^A_@L+L9UI}+Hp!HH$H8{HHIuHSHAL4ҌHD$HL$ II^IFI^HiH(LpHA gH$Ht$PH8\{HT$HBHDHt$(H HHD$Ht$0HUHHHD$8HHAHAD9HL1 fDo HHHH9u*fDL Ib 11LYJ E1H5f.Ht$(H tHgfL a L2J 1GH5oH$Ht$E1H8@L a LI 1H5*o1O`L ea LJ H5<놃'1L 4a LI H5Wff.HwHtHW H9tfHw HG@( tL1ɺ 1H5k%AVAUIATUHSHH?.yhLI HHcUIHH;xIH}HMLZnxLLL[]A\A]A^H;L蕊{LI 1H5Н[1]A\A]A^DLLH5Qr[]A\A]A^H;L5uLH fAWAVAAUIATUSHH- T$ H}PHE1E1fH'I9LBAGH<@IHHHPuIm`H}Pt;H1E1@HI9LBCH<@HHHHPuM9MB\$ DLHLALFq11eH5RADLH5/HL[]A\A]A^A_ѰE1QAVAAUAATU0SHH?vIHhfHʴ@@ EHDmAl$HH‹rB Et$, AD$AD$At$(;HCpHxurLJ}1H-`LyG HH11L0k}H;LE1[L]A\A]A^H Hxt;uA ID$ HS@HC@El$(AuCHHCHI$ID$HCHL LLcH[]A\A]A^fDHS`HteI$IT$L`LLc@[]A\A]A^fD1LF H5^[L]A\A]A^H{:AAWAVIAUATIUSHxT$ dH%(HD$h1fL<,u)fAFI<,tLAFIt<,uLH)H$H$HL$8HLLD$H|$ H9HHH9uMH|$ %@D$HH9|$#A(Ll$(L$LLt$8H\$0L|$@ALfA9HD$ AAL`Lf1HDHHH;Xu+0HD$(HLL$H0dL$EDDAE9vDHD$ HHD$ H9D$qD$HH\$0Lt$8L|$@f(f/~PE \fTw NE f/f/\ .E fTf/xH\$0L$LLt$8L|$@Ht$H9uHH9HP:u\ D fTD 1f/HD$ H@8@DuID$8MWHIH\$L$Lt$ L|$(#j|$Hvff.AWL0 AVAUATUSH8T$(H $Ht$Ht-D$(HH<$D$/uCt?L0 1H5Z1H8[]A\A]A^A_fE)uH}@[IHf@@ @0H}InE)OIFAF0IFH]@HD$IF HE@HD$ H9CHVH5$ L @HT$IN, MeLhuM~8I_H5# Lh'LLExHuLHAUPzI~HD$IIF IGIF L8HM~ H;\$ &H}(ZIHfH@ @S,&Le`H|$HXHC Ld$PHthKL IIO, AMHADDm8H}IL,ZHL1H^IF(~DHEbCH|$H@HLdM1L. H5H $1HtAV0H}L$k$HHtfHpHt]HT$H^uLIV8AF0Ht5HBLExLHHu@H@HH=PPIF8H@@)tE(@t7D$(t/H}PHEPIHEXIFHEXL0LuXE(H<$HtAF0|$/L. f.L- 1H5}fDCH|$Ll- H5`H@HLL1}yIF(L- 1H5c}FH8H[]A\A]A^A_HG(u LGPLOPM9tHG@H@H9t.fDP(uс t P(HH9uM9tI@IHH9t>fDHPHt':t"HpV(tV(f.HH9uMH1TL- H5Z|1HAWAVIAUAATIUHSHHtZ_H H]HtCDX uM<$Mt<Et DA#D$tL^LHHH(]t,IM<$Mu1MtI.H[]A\A]A^A_fDMtHIAD$H[]A\A]A^A_fAW11L AVAUATUH- SHHHF{11L H({11L, H {11L/, Hz11LI, Hz11L, Hz11L, Hz11L, Htz11L!- HVz1Le- 1H8z1LN1HzH>LX 1ɺ1HE1y1Ln 1ɺHyHDH$IE MnI}Ht!E1\I}IM|HuM9MBEF I EuLd$L<$L-9 H;ȃ MwMΜII>M9wtH;H5mtM&L[H;LHuH1L: xL; 1ɺ1HH?[xL%V 11L Hx1L 1ɺHfxH7) L | fDHCHH1HPM1)xL Y^MuLL1ɺ1HHpYwL% 11L+ HwH L  DHCHHMP11HwL XZMuHHLL1[]A\1A]A^A_%cwH;LS(HLAwHPHH0L2LH @8AH@0H\t3Hi t!H"@tH#U HHDHL4 1PHAw1I AVDL$(AH;LH >cA?.L K1ɺ1HuvH! tHT HMcHDhL) H%v됹H1L7 v/ff.fAWIAVL5NWAUIATUHSHHdH%(HD$11HHLH$CIHH3HL4uXMt*IIGI$IG ID$IG L Mg MHD$dH+%(HL[]A\A]A^A_Mt3IIGIW I$H,$IT$IG L Mg 8I(H8|OIHuD$xDd$|IH@HEIF`HD$ 1LH$D\$(H=NUiD\$(D$L$MD$%D$0i HD$ DPD$ AABt AH$HD$(IAHHD$@IEt"H|$H@IEItDB uEFMHDŽ$ HDŽ$`MAE<"L<'L$ H$`DDT$8A LD\$HhDT$8HIWHHl$8Dd$HLEHD$P fDD9"oIW(I H~AtAtL$ L$`D1L+$ LH迋HtIH$ ELd$PIHD$ H$H$`HD$0H$A|$%A EljD$D T$L$ DL<$H$1LI7IHH$ LH=QH$ H0H$H=Qu[Ht*H{HC!I$HC ID$HC L Lc IH$dH+%(i!HĨL[]A\A]A^A_HH{HC7!HS I$IT$HC L H$Lc HD$QfDIHDŽ$HDŽ$kA]AE1LHl$H-LC11&H oML" 'H1nA]LT$L 0 H1MѹnH1L/ nH$H|$E1H8H$L$H=OLH(H L<$H$1LLIIHtHI/ LH=OH{ H$H$H0@ILT$L HDŽ$H-t1HmLT$f.I(H8,HHH fH@@HH@@HHC HCfDHHD$ @cA]AE1LHl$H-LA113HlML! 4fDL$`L$ DL+$ EIHl$8AAsAH|$(& AEH|$HDAEIHDQ u<@<"t<'IH$H$A LIH|L$L$LM)LD$HNH|$@IwHD$8dFIHHT$8Ht$HHI9IFkWHDŽ$H$HD$HDŽ$HDŽ$HHDŽ$HDŽ$HDŽ$IUDPL$` LLPH$`I€9-HL)H#H#HA#LпdAHHHHHLп'IHHII@H HI`HXJcDH9Eɸ$DDAA$HD$D$HHuHQHtDP uHDPuLHϺ DL$HHL$8OHL$8DL$HH$`I>:H H)H$H$HLdD$0HHHHHL'IHHIIsI<MH<'A%D$HD$D$$HHuHVHtDP uHHDP+- D$8H~L H|$HNH$`H|$HH>:@HH)HHHȿdHHHH<oHeHiDT$8HHkD$0L$ L$LLqHO( HcH>fAX A0L$MH$E1E1HD$0H$HD$ ABuH$H$LDT$0ʉDT$0HI8%H|$(L$ 1HDT$0H$`L;H|$(DT$0HHL$`A@D T$ADT$L$M#IH-LT$L61ɺpfDILQ( H5ef LL' 1H58}fD$ ALHl$ML1 ^H-1H%fLT$;AE/H|$H@AEIHDQ u<[<(lH$H$1LA 舳IHHD$ Hl$L ^ LHH-&1HfeLT$1HDŽ$L4MLT$H12eLT$H<"t<'TfH$I}A H$ѲIHIH$E1E1L$L$HD$0H$HD$(HD$ I$t#H|$H@ID$ItDB uH$DL$|L-}L Dd$xEuMn`In@IF@H9uHmH9D;M,uMA9uHIHIDHD$D$#E(ILD$8H8>IH@fH@IH8i>HH fIEMXALD$8!IHL$@LD$8H8>LD$8HL$@HfHAD$ImAEAIouHmH$` t/IDLL$`H0ՅH$`HT$0H+T$ HrD$-HHT$;DHT$HH$`CHt$ HHT$NHT$H$`IImH8蚒HEH$`YEIEH8 I(H8<IH.H$fMd$AD$ID$ Ml$H0M$$AD$}<{;I}DCfDL 1H5a+H$HD$(Ao1H$AHDHD$(PIL" H5"ga)H]>Hl$L01ɺ\ H-1H$aLT$H1o LT$Lg `LT$HDŽ$HD$ Hl$* L H-sLHH1`LT$HDŽ$fIxDDLLD$LD$HH+DMH@HADA FLT$LL$ L  H-¾1H`L/1ɺw1H_DHD$ Hl$L P LH>H|$ Ht$8HT$0BHT$0Ht$8H9HGIH8HT$0":HHT$0Ht$ H3KH$`ID$%=~ @u@IUHEAt EHBILH8KFIEH$H(AtHUH@H@== H IEHUHA!HUH@H@t$|$ImA}D$%=D$Im1AE&d$~H-Ƽ1HL ]L-11{H]7LHl$EML >pLL$ Lv xH|$(HHD$(09IHL$8H87HL$8fHHAL1ɺ L,H-ۻ1H]LL$H1L \IHH8IDL\H@HE4HduLHH-aLB 1 HAAE<"G<'?11A H$L$ H$0IH$L$H$E1E1HD$0H$HD$ H|$(gH|$@ HDŽ$HDŽ$ 6HHL$`LH@LH=-=@HD$8L$TLT$8WAE<"1<'L$ L$LLT$0A LL7LT$0HI H$ H|$@LLT$0H$4{LT$0A Hl$M1ɺ H-L*HZHD$ LT$HXH|$@LLT$L$dGLT$LT$IٹLs  LL$LLU H-11HqZwDAL_ZLHRHIV`HL W H^ LDHL R H-1HAA]L A_LL$H1 YLHl$CCL IELL>)1ɺ ]IF`LHH|$(H|$(fLHl$ML XIIUH* HEHAHMHBHH|$(7 HD$(E1DHIEHI>q[LL pH-]1HXIMH< HEHAsHUHAHcƄ$ %AI21$A@!HD$(HH-ӶILH-LT$1L'1ɺ HWH|$@HDHD$ LT$HXLT$Iك_ L LL$LL L H LDHL R WLL$LHDŽ$`L =DMeD$HAE# L$ L$Hl$8LH\$PMLH|$HAD$IHDQ u<"t<'ILA HL舤IHy HtH|$HID$ItDB u LLH=7 ty|$HIH\$PHl$89MH7ILHMt;huH-LT$1L HUHD$ LT$HXUHH H$ H$HH|$@u L$`A$LT$8IH\$ LT$ L  HIH- 1HJULT$b1}Hl$H-ݳ1L| Ll$ HUL\$HD$ LT$L$HX(Hl$ La H-zH1THD$ LT$HXHl$L>$1ɺ TIEHl$H-1L $ HEBEu1|$HDABH$ H|$@LLT$8H$'tLT$8 MILT$H-1ɺ L#H1SHD$ LT$HXH|$( H|$(IMHGDHEt HAHWHIE1DkLL H$H$I}uIH L$L$LM)LD$8 6H|$@IwHD$0-IH#HT$0Ht$8HI9IF>L:1 LItHD$ HR2L M4Hl$L WHA LEP@ HD$ Hl$ L' H-LH8HT$LL$ X4H|$ 1H9HT$}"EIMff//f/ !Y E1D,HHIdL$`LL fCHl$L L Hl$L L Hl$L LH Hl$L1ɺ L}H-1HKLT$L% LT$HcHdHHH $0LT$8I H-L LT$H6KHD$ LT$HXEH\$ LT$8IL| HLT$IMIj1WA?" Hl$M PH\$(1H-fL_ HHSJXZLH|$@27LT$HA?ATLL t$L$p6H-1HEJAYAZGHl$H-1L HSHy LLT$PLL$HH|$8/H|$8LL$HH$`ILT$PHH)H)LȀ9-HD$8HL)IHu[I@H ALT$8IwLT$8I Ld LT$H-HiHl$L1ɺ LH-ާ1HILT$LK LT$HyL LT$XLD$PH|$H.E1H|$HH$`HLD$PLT$XHAHLH)H)HD$8Hc$0$,$4HуHD;t$,$($(uf.HVHtDP uE1E1H~ LHL$H-H$`HL$HHHJH运HHH=BILLL1ɺ{Hl$L1ɺ} L*MLL$LLk LпdHHIIAA$$:$$$ :Ճ$ eH~ LDL$`HL$XL\$PLD$HH|$8,H|$8L\$PH$`ILD$HHL$XDL$`HH)H)€>:JHD$8:HH)IH/D$01|$HL$`AB M*ABM9UME1M?AM9uDH7DD$PH=H<LT$HHt$8T'Ht$8LT$HHDD$PHD$0 ƒL,MmM9uH JbLT$8DD$0H|$ !-LT$8DD$01H|$ MzM:I}H IMHL:HJIMHIUA9wLT$ 1(LT$ yHl$L1ɺ LRLdD$0HH1IIID$01E1LPH-L HDHƒfHH H*XLULD t$IL$pLASL t$_L$pL^ LDL$lLHL$`LT$XLD$PL\$H)L\$HLD$PHH$`LT$XHHL$`DL$lrHL)H)HD$8SHl$Mփ L h uHl$Mփ L. BHHu2HHAIHtP-u߄tHH-tHff.G<wH HcH>DHD11L} H5KCUH@DfFf.Rf.Sf.Af.Uf.AWAVAUATUSHXH|$D$$HD$HxH|$HD$ HD$LXMcD$MKAM/E1IIH1LyM1MoAME1ImH1LeMtmE1I|$HtJDD$LT$Ht$DHL$8DT$@LL$0L\$(DD$LT$Ht$DHL$8DT$@LL$0L\$(Md$AMuA@HmHvMmAMOAMDM%HIHMIAMAM[DT$MD$H|$D$ HH|$HkD$ H|$D$$HH|$H%D$$HX[]A\A]A^A_AWAVAUATUSHX?H|$ D$HD$ H@HD$H8D$HD$LPMA:PD$MBM{A8&E1IHHE9E1HYH;1LcMA<$E1Mt$MA>E1InHt{}t1H}HtQD\$LDL$HHL$@T$iAEMd$MtA<$2ADH[Ht ;AHIHt 9AEM@MtA8AD\$MRMtA:eD$|$|$HD$H@HD$Ht8D$|$|$HD$ H@HD$ Ht8D$D$HX[]A\A]A^A_AAA,A;D$KD$gD$@AWIAVAUATIUSH(A:~MJM=A9FMAMA8IHH9LqMA>InH}iL}MA?1MoMtjA}I]HtM;H{Ht2LLT$HL$LD$L $LT$HL$LD$L $@H[HuMmMuMMvHmHRMvM.HIH M@MMIMMRMH([]A\A]A^A_@A$MmPA$C M rA$MPA$AE MVA$HmPA$AG H;A$MvPA$E M[(A$HIPA$AF H$A$M@PA$A MA$MIPA$A@ MA$MRPA$AA M}A$PA$AB H([]A\A]A^A_fDL rE1MMH9t:HD:uHIAH9tuAIAt!A uICD 1ff.fL u HoMH9tED:uHIAH9t;uH L o8uHHH9t4uE1Dfu1H@AADE1u̸fHLrH9tH:uHIAH9t3uH u -8uHHH9tu1Duuff.L eE1MMH9tBfH:uHIAH9t#uAI At)A MH9uDuKRAD1DATUHSH9tCIH%1H0fD0HHHHPI9tH HDNu[1]A\1[HU]A\ff.fHHHB@8AVAUATAUSLr(1Li(IHPHx IDj(Hp `t*HHH9t_@t?H9[]A\A]A^ t7@tGD[]A\A]A^fH9[]A\A]A^@HI9i1[]A\A]A^fD1DATUHSLgHMtID$I+$H9}?HIHt9H@LI$Il$HCID$LcL[]A\f.HGIL| 1!H5 6ff.HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ $D$0HD$HD$dH+%(uH-ff.fAWAVAUATIUSH(H?LD$H9LL$H|$IHI6H|$HIHfDHH9t HDB tH9toLHAADŽt?H9tIU @HH9t HDB uI$H(D[]A\A]A^A_fDHT$H|$H5/ 1`fDHT$H|$1E1H5 =ff.ATUHSD&HHvAtIHuPHuHtHHcCHSHKH,AuHcC HS(HK H,[]A\@HtH}t HH  XH5 H= ff.AWAVAUATUSHXH|$Hl$ HHHL$H1LD$dH%(HD$H1*HD$Lp LL-LL`I}PL1B@LLLuK<'Hbt/CH<@HHLHPLHL3uHD$AHD$HD$HdH+%(HXD[]A\A]A^A_ÐAL11 H5֑3fHD$Lx`IPH@h1HD$1>DLLLuK|%Hyt.CH@HHI|Pt?HL$HL,LKuHD$AHD$f.E1AWAVAUATAUHSHH(dH%(HD$1fDI߀,u SH,tI߄CHt<,uIM)M+LA@-HL$LD$LHaL%R1ҾHL 11L濄u1H1AWEL LK1X1ZHT$dH+%(H([]A\A]A^A_@E1L%ƏoIwMVA@M3L%L 1L0*@IwMVA붋T$t$LQIt^HE@HM@H9uUfDHH9tG;P,u;puEuP( uFM8D qu8HP()LE`EtBHvHA EHv1ɺnHH5MLL 1/랹HLD$t$脓t$LD$HYL%{Lg1ɺgL/DSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ HH$D$0HD$gx'HcH9ںCHT$dH+%(uH[øAWAVAUIATIUSHH8H|$dH%(HD$(1HHD$IƽL|$8f.L&CIHcHIHD$Ao$HMMID$HLAIGb9s|$-HD$L0CHT$(dH+%(u=H8[]A\A]A^A_L@HL$LHHt{tHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$(HT$dH+%(uHff.HGuoHt]HH\u"t\u߈QHqHyu;HHH~t$\uN"t\uHԐ@LGHE1E1Ʉu,TfD<:udMɸ:LLDɈHLGt*<\uG<:t<\t<@t\LfDHHtLHtLD<@uMtLIʸ@AUIATAUHSHH(dH%(HD$1HD$HtH;HMHHDHunEtu5fɸAUuV2w"H  HcH>}t1HT$dH+%(.H([]A\A]fHt$HH9l$t1 HD$WL$HxLfH*\fT fHl$ f8EwHU'HHfHH H*XfAufHtHH+L f(fT0 f/HDHƤ~@@B뱐fʚ;fHd @HqHaVfDFfD@6fDH!HfH*Y  f/s H,\H,H?D}}ufDUwUfSHdH%(HD$1FF F0Ht^HH5 H< Ht'K8HT$dH+%(H[]H5i H HtUSLHxDL$ Hl$ T$ HdH%(H$h1D$HLDD$ HIEHH8Iŋ41HJ(Ń 9HuB?UCSJMI AHHAAREDDL9v-1H1҃HHÃwL9woAMsfI*AL ARuL Q fHH*Y^f(f: f: \ fT f/LFDHRHD0H 1Bt 1S$HRHHL HfH*^QPL) LH XZH$hdH+%(HxL[]A\A]A^A_HH1HxD8Hu1HD8JHuH8Iŋ4fM/fI*AL AfDHd AfDHڃfHH H*Xf.Li 1H5 L=$E11DT$ L Et$BD5H@HLL L1L H|AMtHtp[A.H RHHL0H 1Bt 1SI fI*ċt$ L LɅDAHt$H|$1ɺDl$D$HD$Ht D8ZHLG EP18H5q L=y_AXDIfI*XCIfI*XADIfI*X1AAAqAVAUIATUHSD"DDsILHHHtPL1.D A]HHESIuHH[HEHE]A\A]A^fD1LR1ɺHEH5 [1]A\A]A^VHHtD HEufAWHcAVAUATIUSHHHL@L@HD$H4$Hv#ATHuL谅AIl$(M$PIcHDu H(H<$OHp@AD A HADžuDLKAyI$H0H@Ht;ANI~HHHt9wHHHuI|$8HH/HxHHHHǀH1H)HI$PI$HHp'I$PI|$0HHI$XI$`M$PHI$` HX HDH|$E1AH$AH\AI~JHD[]A\A]A^A_fDH@HtHAI$`M$PI$XrL1ɺ1H5 }Lq1ɺH5 XAUIATUH@@SH^HLdMtBAD$t t A9E}AEHL[]A\A]@1Lt2AD$HH|$H|$tBLdMufDL1ɺ1H5% E1fL1ɺH5 Yff.AWAVAUIATIUHSH(dH%(HD$nHvID$HIt$LHID$H!HD$dH+%(H(L[]A\A]A^A_f.uIt$LHKID$Hu1ɺ<E1LH5\ @wfDHvID$HIt$LHID$HH0L|$Lt$I|$ALL$tLA<$!ID$8HPIT$HPHPIT$HPID$AEIt$I|$E1LL8$A<$%Lt$HHL|$I^zH9fL`IH@@@ @0IWHXoAoZA_ob Ag oj0Ao0HR@IW@IVo2A6ozA~oR AV oZ0A^0HR@IV@fDL|$HHH\$MwHfL`IH@@@ @0IWLpo AoRAWoZ A_ ob0Ag0HR@IW@HSo*+orsoz { oJ0K0HR@HS@aD1ɺ1E1LH5 mL1ɺE1H5 E1;fD1ɺ4E1LH5  1ɺBE1LH5[ ID$8HPIT$HPHPIT$HPID$jfDL41ɺ1H5 E1s:fATUSH_HtIHHx Hu HHt&L`HT$$1H5[ LUAŃL%11ɺn1LL L H1UL L XZH$E1HHD$(dH+%(H8D[]A\A]A^A_þ L$HD$H]HLIHH@@fHI)@@ @0LLIID$L9LHFHT$HHHT$HD$HHL` LIG({HD$HHcT$$H+D$H9 D$$HcLHT$wHT$LHD$HrHHT$LT$LHL9IGH|$IOIWIG0D$$H5R HAG 1mIALJA LHHuLy1ɺL%}1L L |LD1ɺiL%|1L L L1ɺrIG0L1ɺL%|1L: L HLLM 1U YL^LVL1ɺIG(L1ɺvLϾ HT$LL$|LL$HT$HILLLL$H)HD$~Ht$LHD$LT$LL$HtHT$LHHL9IGI|$IWIG8L%y1L|L1ɺAL1ɺyH$L8HcD$$HL$$KPI_0HH)Hc1ɀ|auT$$HH9uA;O sII_I;_Io8H5:( H9tH5( H&HI_Io8H5' HtH5' HAH Ht4 HHu7IG8L1ɺ 1IW@LL L%yxff.AWAVAUATIUHSHH(dH%(HD$1 HLhHHILH5 Hǀ1HH)HHHt:AM<$HT$dH+%(H([]A\A]A^A_fDH5 HHt H5vL,HL@H1HL LIGx9HpLpLTHLhLHD$HGLHL AGpL$AŅu7fDHxAt$ HuILJIIWx4$H|$A9Gp)IGxL4HLOHtrL1HL IIIH}IHLHHbIAA9BhILJ(AUIATI@USHHHt2LHHLAątUH+AH[D]A\A]fD1E1Lb H5sHD[]A\A]fHL%1L1ɺH5scHD[]A\A]DAUIATIUSHHHtZf-HHH@HtImH[]A\A]fH5) HHtDMfD1L H5rH1[]A\A]fD1HMHHH5 qHL 1IٹL; H5rD1@ff.fAWAVAUATUHSH8HHH$dH%(HD$81HfLl$,IHH@0HT$4LH5 @@ 1 LL1ɺ:L-q1LI1L LgLHH$E1HHD$8dH+%(HHD[]A\A]A^A_D$4D|$,vbLC >L-9q1LZDL 15H5qE1eH4@HH@ID$HT$4IcH B E1HL$L4;uZfHcD$,AID9|$4vEID$DHt$MLHRH1HJHtL1ɺKy1IT$MLH5U LLtL1ɺOB@HcD$,LH5 M<HD$0HD$HL1t/LM1ɺSfDL4 DHcD$,1INjD$4t-IL$T$A<H4@L4T$A9T$4wӋD$0Mt-Pu 7Lxr- LT$T$HuL1ɺZXL H5 6HT$LH5 AIG ELD1LAtLS1ɺbHcD$,Iǃ|$0 LDL$?IHILLL)HD$LHt$HHD$DL$HHHT$HD$LDL$HH9HGD|$0DL$ID$ HAvH5DL$*DL$t}D$4AD$H$L ~Lh1ɺmLHDL$DL$HID$ uL hL qID$ hAHE|$(Ik ID$0HE1H A|$(DL$HD$u?HcD$,AIAD$(D9vjDHt$MLH@ID$0DL$D\$HHHHP1&D\$DL$tLc1ɺLt z1ۉIT$0DL$A<H @H,%A9\$(DL$EwATUSGH(H{)IuoHMC+&fH;HHfH@@@@ L`I@0H*DL 1>H5 E1L[]A\H/HH IHH@@fH@@ @0bID$HHsHxA$ID$ID$HHH_C+?*|9HiHH%H;HPHL`fIH@@Hh@ @0L[]A\DL1ɺeE11H5ѻ SL[]A\H;HHtfH@@@L`I@ @07fH;HHrfH@@@L`I@ @0LHRfLL1ɺ43DL41ɺ|DATUSHIHt{|tL[]A\fDHHHHtxH;HHt6L`fIH@@Hh@ @0L[]A\fDL1ɺ1H5Y E1hfD1E1L H5# 5ff.HGHG0G8HtHHHHH@H9s=HLG(HF IPH9LBL޽Ht1HHHHHÐH)HcH9|1HÐAUATIUHSHHLoHu HHHs0I}HcIEHH)H9}YLC(HLHH9wqLH>E1HtIC8HKHƒH#H)HHS0HIuH=HCH{0H8HL'Hk0AHD[]A\A]HHͼff.AWAVAUATUHSHHDg(AHFH H,`@H@HH|cIHFHsH;1AąuBL H5ER1LeHD[]A\A]A^A_HLDHHPuH;1LAAą~LH;H5? AąDc(AAHED@Dx(EpMcAteLDD$ 0DD$ HIA3Au_At AoLAq@HW`A`LDD$ DD$ HILMD1H LLDD$ DD$ H;IcLLN 1H5PPHuH;1AąDc(E1 L fLDD$ DD$ HILMD1H{ LLDD$ DD$ H;IcLGDc(fDH;H5; uLP H5O\L) 1H5~O9fDLa 1H5NOLE1hLY 1H5O[fH;H5[ H HDH544ADžHE8LHU HRHRLlAEHD$H)IE1lIUAuHHulADžH;LADžsH;IL9t$H5IRIADžH;LtADžyL 1DH5HDH;L/ADžLe 1$H5HL; 1lH5HkH;H5ADžR1L H5DH$HE@(^>L 1.H5 HQHML 1LH5GL1ɺI1H5GL3 1>H5GcAWAVAUATUHSHHLn8 u:ALذ 1hH5-GrHD[]A\A]A^A_úH5j HLu@L%AL 1qH5FAHE0E1E81LHL%t1H5 HL%tH58 HL%pHEHU0L%L(LHHE0E8M@HC(L=&FDH Et@HCHLH OLu v@ Q1DH1AHC(L%0_AXHSHx(Dr tJHx8tCHHX1LPEN1L yAHCL%H DqDp Y^LH1ɺ}AUE Lڈ L1AHCLHA@ XZ,AVAUIATIUSHH@H4fH@HX@ @0Ht C(E HIL$IT$LeLm8H9tH @HH9t HxuHE(HHHMHUHiA $Il$KvyMt8LI|$LpL?HLLHXH]HE8HC(AڃC(D[]A\A]A^fH9]1HXHHH9uAL-C1 LL L11aL(fDLl1ɺm1H5iCHUHEHE1I|$HBH/[D]A\A]A^HtC(Au߃࿉C(AMuHE(DH EtL 1ɺ1LH5B%E11ILҭ H5B[D]A\A]A^H]DC Eu)L5B1ɺ]1LULC Mt'HEHHx M0AHE(LHx( x L5Bt;HEH1ɺ5H5KLo @ VLDH1AL-Y^HEH61H5TL4 @ VLDH1AHE@ XZQAPL5AHE81LZ !LLK1ɺj1LL55AL!1ɺ.LiL5AL 11LAAff.AWAVAUATUSHH(HHHnEvHPHH0L LH 1ɺH@0@81AHmI9HsHtH;HC@HCL{XL{PI9tPPHI9uK(HfHs0H;1M$$HE1H@0@8fDLcPM9'HCXHt Hx8HD$I$H$I|$8L|$II?~ IHZHPJIl$Ml$H]L91L5E"@IHHL9EHHUB)ut4I?HtH@Iw01IHLHtH@;v;AG(@kHUHEHBHWF0tHWPH9WPHUH9HH9KL%;L 1LL1ɺ1LE1€S("H;<GLs@Hk@L9 LE1DHcHHD9LOH9uILIHuX @AN1Ht LLA转U IcVH;LF I;.IL9AF)A~,HuHC`AVK(HRHHHPH0HDЃIfH;1LuL٧ H5`:L肾HH@0@8LL|$C(@ HHkLk1L>tI?1H5¯)bL1LS H59I?1H5L Il$Ml$IH]I9DHt;H@I?w*1H5N I?L9d$fDI?H5ٴ d IME1L-HHPHH0H*HH H@0@8MtH IVDJ AH:11UL!| H58AXZAG(@L$$I$L9d$AI|$8H$GAL$0t9fDHL$A%AHI9L|$AH$@L}LeM9uUfDIGIO;A~AEt(I_CH<@H$HHx`H;C~CM?M9t6EtIG@) t HM(@L^fDHxHtAąHWAąt`HHL9t%HHx(u@ HHL9ufEvMAH}HD[]A\A]L<1ɺ1H59/~@E L%/u"LBB1ɺ]1LLE LD 1ɺ1L*m \L1ɺ1H5.:fAWAVAUATUHhSH8H|$T$dH%(HD$(1VIH HxHHHǀ`H1H)hH(CI1ILt@I?IDH\M9uH|$HsܩHD$H D$L|$1Ld$L5. IHŐMLE1LH1HIA9vA|IHH9uLd$H\$(H^IHfH(@@HH-fHH@ @IEHD$LLt$$M} IELLV HtOHl$HD\$$LHD$$AHHuLZ H5Q 1H|$L_L 1mH5 f.H|$LE1 HD$(dH+%( H8L[]A\A]A^A_f.HHD$IID$8ID$0I}Ht腊MmMuD}A\$A 1҉\$II}Ht[MmM A}u܉ڋ\$AT$ ID$$At#I{HtLM[MtE;Au݋D$$AC H|$HID$HAt$ H|$HID$(HHLE1NET$ELH1KI|$0D8E|$ HC0EAAIHL芦HLH1I|$0D8E|$ HC8EAAIHfLCHL1H轪D8HAD$AHK@A9xE|$ IT$DI|$0EHAAILHۥH HC0Lƚ1ɺmH-1 1HL11HRfHC8Lt1ɺoHC@LT1ɺqvH[D8E|$ HC0EAAILEHtD8E|$ HC8EAAILHHlD8@AE;t$AHl$AD$ Ml$0LX菤HYfH@E1At$ I|$0LhI$H3I$PHu2>DL1HèHKL@II9A\$ I|$0McAAAILHtdHuKD@Lݘ1ɺH-H 1HL1ɺ1HifƱHHtIڋ\$IEL4 }Ht"L)1ɺm1H5  kL1IDŽ$HH|$ݢIH"HD$WL1ɺ}1H5 :Hl$E1LV AD$@IT$DH‹HkL{ IcL>fDHu0HC0HxHHGHu8HC8HxHH&C$L {AL$ I|$(Hs81A;L$ D#tLK0HHP@f.ED HufDHM0DM$H{0EkIw0 HuEG$IW8HK8EHu8fD< <AE;|$rI|$8蝝IHHxHHLHǀH1H)HM,$HE0I$HHpHU0I|$0LVI$`I$XHAt$ I|$0,I$@HH-r L1ɺ2H:MnAN HID@ @H[Hm;Etf1H[]HuH{tHuH{H[]HSBuHMf.9uHuLE1ɺ1H5 bf1ff.fAWAVIAUIHATUHSH(dH%(HD$1Ht$((L|Mt)LIH-fH@ @֧IHL9a\HH@HI9CHEB uHl$I9,HfHI9t HB tH9HHL$H)MLHL$I$HI9t"HfHI9t HDB uHl$IL$MLL HHH\$u51M"HT$dH+%(H([]A\A]A^A_IL$ MLHLH܃跇tIL$MLHL, HG蒇tIL$MLHL HmXHMLHIL$L HA,IL$ MHLLܕ HL9|$MD1H5` L1I<$D$裟L蛟D$HȨHL$I$HCH5 L1ŅHl$H5Y L1誅hH53 L1蔅Rzf.AVAUATUSHH $HdH%(H$1HH1Iʠ)ʼnHT$1r|uuB8IŃtHH|M1ɺPH LPH5f 1E1_AXHt$HD$@HD$L$L{HHdmvdo001H9$ML0 1E1H5Շ 舚H$dH+%(HİD[]A\A]A^fD3H8uM1ɺPH E1PLH5\ 1AYAZfHt8-M1ɺPHLPfDD$$$At4Le H5 1E1tCHA1RH5 E1L= Y^L$L$I HD$IH9v[HPL 1H5< E1^XZXL$L$L+$fD1LΉĢHL AO(qHt$L蔗AGH\$%1EEBD%BD')Ht$ 1L@I߹1Lr~ H5EBD%fBD'Lky1ɺyH5e]Ց11L H58gff.fAWAVAUATAԉUSHHG #WGL,I]HtYHIADIHE Ht9D9cuD9suHsLHT$ԑHT$t%IHEE HuHL[]A\A]A^A_ÃEAWAVIAUATIUHSHHHLA'IHHtLpH[]A\A]A^A_@Hz HT$HtHHT$HHxH$H $YLqDyHIMA$H[]A\A]A^A_1f.DAUATL%u UHSH?wIIcL>LgI\$IfDHI9tHHu1H[]A\A]ÐHOHEHH[1]1A\A]DH_11HH UtH{ffH[H_E13Lct#DHHLwAD9+wH[]A\A]@H_ tLcE1DHHL/AD9+wfH_tLE1DHHLAD9+wx@AWAVAUATUSHH $HfHt$HIH$HL$ HT$LD$(dH%(H$1I)$HH=$T+HD$HdDH|$.HEx.tL`H S1L$MHq LvH5 L,HH?HD$H\$`LH@H踇HWIIFH3H3CH uIVIFH3SH3CH uLILpLHLLHIL= HLd$0趐fI1ɺZL1L )D$0)D$@D$PwHH@LHofAofAoVLA) $A)T$aH t+ML 1Lb1wfLHD${L 1ɺ1H5Ӓ vHS8蜈1ɿMPHDtH5 PLt1vY^H|$Hf.H|$E1H`|8,Ls1PH[$L sQPH5 1 v_AX:fDHD$ {H8H|$AuHD$(HH$dH+%(HĸD[]A\A]A^A_HL P11ATLЅ H5f buAYAZE18:L P1LrPHF#PH5 1uA[[MMLN11H5 t0C~8džM1PHorLPLBr1tXZATH1IUHH~HSH)HHdžHLc1A?fDH|H0HD~@ADA HI9uL[]A\fDATAUHSHHHDHH8HtHH+[]A\f.HH?tYHHt2H9t(HFHWH8HHPHWHHFHGHvH6HH | H5sH=} )H | H5sH=s f.PXH $H5sH=sH׀PXH K"3H5zsH=sH觀AWAVAUATUHSHH(H9t! IH~{ IHcH>t\LD$菈HoLD$HCELXH([]A\A]A^A_@LFH([]A\A]A^A_A$LnHHATIT$HIt ttAE@IM)D9;LF_fD9LFFfHvH(L[]HA\A]A^A_fLnAUAMA8 $LL)9Fʅ;λDHÉH9tA|HCA8<tֿLD$HL$H)މT$T$L$HLD$I)ItHxLD$PL$衄L$ILAoeLD$HA&AMLAEMu1LD$舀D$fDLnAEHIT$ItdAMA4$HAt AULnAEwHIT$ItAMA4$HAt AU|LnAE0t{HIT$ItSAUA $AT AU4LF$LF 111LD$L~D$LsCfDLD$茄LD$HIfo 1@@@$@4@D@T@d@t1ALADAoTHAHHuA$IT$LHIADD$GL}D$Ls:DLD$脃LD$HIAELHIT$IvXAFAoeA$AfAomAn(Aou(Av8Ao}8AFA~H,D$zL}D$LsLD$IHHCLD$IuLLHIEnLk;ELD$Iw舂IHpLD$DpHxLLL@JLkEHLD$L$T$&IH#T$L$LD$HIuI}LD$T$L$o+LD$AMAnA$IT$LHIvAFALs3L{D$!L|{D$Lj{D$AouLLD$pI{LD$nLD$3{D$LD${D$11111HIH=s HH9t$8w"HcH>fDH@HL9uIL@ALHHAttIIDHpIM)DNM9|E1 HI9D\E8tDHpDEtE1@HA9kD8TuHIHDJfLHA1AE1fHH9#E8TuHIIDf.HpAT/HIHDMHDAUIATIHUSHMHtWAmIuHxHùD(HZxHIuH{H@AxL yI\$A$H[]A\A]H :r 9H5y H=jr vfATUHSH~Ht]IċE11A$L/w!Ho)AT4HBD&HHuH`xLc[]A\H q IH5y H=q ufATIUSH~HtpHA$IL$1HULE0HHL9t+to@2HHH/L9uLwHk[]A\H p _H5[x H=.q /uff.@ATDbUSA9tq)HHLH֍qHHHH|=Lz1rHHUHEHDHH)r1H4 9r[]A\futEt1fDEDff.fAWAVAUATUHSHH9tw)IHuo HcH>O1H[]A\A]A^A_DA$LnIT$HIttA$HATA]SAU0HLD$D$LnLIu0rEMEIUELD$HUuD$BfDLnHL)AUH9#1DHH9kA\A8tf.LvAA$1H9AA8T6uHMnIT$LUDHA|AD9hBA@LvASA$1 HH9=AA8T6uHMnIT$LDHBt2*AD9AHLD$D$@LvA$E|EA/AIIT$HHHDHB2A$IAD0IV /w A8s HH9uADH߈D$APAwBHLD$LfHGI4$HtH AoD$LE.sH[]A\A]A^A_f.HGHvHtH DLLEEEEuELD$rD$cI~DD$2ADLAD$6LD$vrED$I~DD$ADLAD$cUHHSHH'HH9t;8t H[]H@H);Xst1@4 @8tuHH9uHH[]fDAU1ATUH-lcSH,#>~)mHyH HdwIH H5HǀXHH!I#$A$H ID$HH=[YID$PID$HI$I$I$I$HI$PI$HI$(I$I\$xI$0I$(HI$I\$xHHHt&~pHHHA$M$pH5i LxvH=1W|tHHt1HvL~]H=i JtHt<81u7xu1puz|TNA$A$pH=v fI$HH=M^eID$HH==i eI$GHL賿LL BI$@L#}A$ptHL`L&I$@LI$@HLLo-%LSI$p"HZI$H1L羞9L輤FL| I$A$I$I$I$I$I$x1ҾLJHH 1ҾLH6J1LHH H"JLO/HI|$x+ I$HHPI$HHP(I$ID$pI$ID$h!LL]KLI$G|1vHLlH=A$GHt&lHHHL L:\Ao$PAo$`I$GAo$pAo$I$GAo$Ao$I$GAo$A$A$A$A$A$A$A$A$ LH-Lm Hk[H1LBm K[>fD1TlIjHI9 iI$GH11Xnuo8 E117n/#L-DwH5I LYI}I$Gzho8flHL 4\PH5d L~PUH5״1=ZH /Ll H5ZfDA$)SH H#H=#HL[]A\A]LV1ɺH55Y1lu%n8 H1l/'L-uH5 L蕡I}I$GH gm8jHL ZPHb LPU@LpH1H=#~#Ho#H0HHfHH9uH o{ m߃&;uH:8#;H!#H•"H#HL[]A\A]H-1Lki HX11LTHWA$f.LLT1ɺ 1H5& E1WHL[]A\A]LUa 1ɺbH5 wWL>T1ɺH5SWFLi H5,WLS1ɺH5WLLS1ɺ .Lli DH5% VLE1fLS1ɺH5*VL^S1ɺH5sVfL:S1ɺH5OVBLS1ɺH5+VLR1ɺH5VLR1ɺH5vUH5eLR1ɺhHt$UHt$LR1ɺ1ULbR1ɺH5 wUjL>R1ɺ1H5QUDLR1ɺH5-U LQ1ɺH5 ULQ1ɺ1H5{TLQ1ɺH5RTLQ1ɺH5.TLbQ1ɺH5 wTjH5i1L`e H5׮DTwH=HtLLe H5SLP1ɺ H5jSLP1ɺ1H5ISff.AVAUATUSHH $H0dH%(H$(HG@IIHtwftmp2HH$ _I$pH H1PLO1ɺzH$HKc*A$H5w H=.g^LO1ɺHHDH aHH|HC8/uxuH]^H{H$blH$HHH@HH  褴AƅD1Ɂ<$LVM-LNtgH5 1E1 RH$(dH+%(&H0D[]A\A]A^fHp2H!bAHE1aH#vVHXI|$HiYHt1H$HxHHHHLHLHH)H)HIEAHL N1ɺ1H5 3Q"fDH\LM1ɺDLM1ɺLM1ɺ1H5S P*ff.AWAVIAUATI USH8dH%(H$(1(fHHI1H5 NcDAWfAVAUATUSHt$0HT$HL$LD$PdH%(H$1HG@)$HDŽ$HD$pHNt$@!t$$ t$88 D$Zt$<h t$DD$\Ht$D$4HHHT$H9=HXT$8D$LI T$$ T$; E` HD$t$@tHHL迲TL$Hk D$D D$$D$hD$lHL11L|$lLt$hLF_ H5f JLLH4-HH1H9tHH9u^ D|$lLLt$pAEo RHtHHt H9L vAW=Lu_ AV11ɺH5e I_AXD$LD$8M D$1ɺ1H5ɟAA HtHHt H9 L wn=HLOM H5_] 11\ADT$DE DL$LEL$Ld$(M9LHM I~gI1ɺIH5\ 1@M6M9u f.MMA?HEHHLVHH' H9 LHAW1ɺ\LW AVH5j\ 1d@ZYA HH. H9% HXO^=HA1SL!T H5\ 1@AZA[:f.H-H9$HXUOT=HA1SLS H5[ 1?[A\f.Hyl@L il@AHHHH9LH=LPJ H5[ 11?PHAHH9LH=LI dH5Z 11>D$DD$<D$8D$$D$@D$ZD$\M=1A11LT H5KZ L>dHHHH9HXM=܌HA1S1LI H5Y =XZ&HLD$lLALt$pWHtHHt H9gL {j=LH5rY H11AVLWS Z=Y^XHHHH9HXLAV=SA1H5Y LtP 71 ^H5"O 113ZH`B=HA1AVLG H5N 12D|$|A[A\L _qvHAWAVAUATUHSHHH9D$ IAI@AEHH9ti:_tL{HE1E11LIWXjLjjH%oH tAGY u1DLL۩uHD$ H9uD$ H[]A\A]A^A_@D$ fDAWIHfAVMAUA͹>ATUSHHH HxH$L $H$pHD$H$HD$H$HD$H$HD$8dH%(H$h1HT$ )$`HH$`IHD$(Ld E1AHLABELONEH9$`H;$hH$tϦ#;$p$t xHLVM2 001H9$xMt EtA1ۅE$H$1D<-tHcD4@HuL="* LWH 1ɺ1L0D$4H$HD$ HXH L$1L%) fDIHD}I>"DEtHALH 1S@L1/YA6ALH 1ɺB1La/^AvLH A1LD1C 1ɺ1L(Zu1LELEC 1(Y^DL=" 1ɺ1L l5 L@ Lu(L=\" 1ɺ1LE1L 5 L? 5(HL=$" LL$ 11LN4 L(Hl$`H|$(H @4 HI1LIL/4 1'1L1L$hL4 '1L1D$pL 4 'L4 11D$tLZ'H$xHH 3 螲1ɺLIL3 1'fLL$ LL> 1ɺ H5 &D$4L$E16 H#? L? H1E1#H- L/1 1D Hi#E L> 8LL$LHLdAą4LD$MfDAWfIAVAUATMUSHH8H|$Ht$xLHL$H dH%(H$(1Ƅ$HD$XHD$`HD$hHD$pHD$xD$PD$THL$)$)$v=HD$x11LH HD$ HD$PPHD$xPHD$xPHD$xPH|$0LL$xLD$tML$tH =Dt$PEulHD$XH D$hAGh<L- 11ɺL> L!HD$H@@Hfh/D$PAGlCHD$hHt MOL94HD$pMO Ht L9}IGLL$pD$PHD$hH$ Ht$LHHD$(-AtH H$@fƄ$H$AƄ$Ls1Ƅ$@Hk)$)$)$)$)$ )$0t.@<-t!Hc4Hu߃ 6f)$)$D$0D$ 1}IHJT5HH|TDmuEtHMuH@H|$L1HwhHHLHDT$ ELI9L|$8L5L9fI$LHt L9tHpM}IH4MmI9IMuLEwpEfDL$1Lvfo$fo$)$ )$0AGtD$0D$ @MtI$Ht L9L KL- 1ɺ1L L|fL-t LR: 1ɺL^fHIIG0I_(AowH LVM2 x[H3$,H3$$H  1LBH|$ Ht$ LT$8HH%H-H)HD$0HHt$(9+LT$8HH HT$(Ht$0HLLT$8( H5A%r0N*>H3E H LVM2 x[H3UH  1Ƀ}LT$8LG8 Y HD$0H;E HCE1HHD$(H j Dt$LIH\$8LLd$@IHAEIH9$ DLH AoAoAo Ao0Ao@)$ AoPAo`)$0AopAo)$@Ao)$PAo)$`Ao)$pAo)$Ao)$Ao)$Ao)$)$)$)$)$)$)$,HH\$8LH1Ld$Ht$01L-y Lt$@pLL6 M]HD$8HLt$xH$S*D$`XZ@LHuAoOH$H(HPHH$LLTiHHuIEHth LG&AŅL1L$ L$L$ MI9Mu@L1HM.AFa#LL"H$HH$@H$H3$H3$H H$XH$PH3$H3$H LI]IA'H$L7H9HGIFL0 %LM6H9uEHL$I9!ЄHLABELONEH\$8fo$DŽ$4 H$ HLVM2 001fo$H H$8HD$H$hLt$hH$(HD$0L\$p)$@H$`D$PHDŽ$pHDŽ$xHDŽ$)$PHD$XHHl$`HDŽ$H$AxL$L$HϦHL\$ HLT$L- HDŽHHDŽPH@H0H$4H@H@Ɏ1ɺ L$0A1t$0L3 AW<^_1L\$ I1ɺ L 4 LASAVULT$(AR HD$(H H@@Hf(-%Ln, 1ɺ 1LADH H9LMmI9H$AL7H9IL$~@L@fDLHa{H54&L_2 V H- L0 E11 HH1L0 2 fh/HL$(Ht$LA#}LN+ Hl$`LT$XXAoOHtH5> Hu"C$H9Cc@H5 HYqH56HBZH5 H+MH5g? H6H5 HH5 HH5| HH5 HH5 HH5HH5HsAEI.1H-L HX1L"1ɺH;1E@AL & 1 H5:QG==.AWAVAUAATUSHH(dH%(HD$1L#C$HHH: HDA$<+<-IC E4$LY% RAFըIIIDBuA.t D:uzL|$LLI\HT$:.~E>I9EH*@fA*Yf/0 A, E f/CH,C HCHCAD1 }.xH5D$Ht)ALLH5D$qHT$D$E>I9(f.EHHD PH5 1QL$ E1kY^C@IEf.L# WH51E1yHD$dH+%(H(D[]A\A]A^A_D8A>HT${H ?@D$D$1H=> H49t6HsL 1|H5Ntr At YsXfD\H,HCH{?L  1H5L  f/s"L,L%u'Y WfDf(\L,I?I)HILM" PH51XZIH AWAVIAUIATUSHHDbEHHxHhHu.HS`Ht D#E AHD[]A\A]A^A_ÐL{`Mt7 {MtHk`LHGHt HxHH@HH)xMtIF@H}fx+oL " :fHeb1jAfA'H5d 7_AXHHxHhHDcL{`EMtoMLLcHHxH  tuG] uoZwL~RIH51fDD#EsLe! 1FH5P;G\ 1vLWIH51^fHLH(L R1H5[#XZ@H{L 1H5#1E1L1ɺ1H5gf.LX AąrLi1ɺ'1H5|$H{ SHAI1H5r*E1L +Y^@HC`HCPHMAL Mff.ATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$HD$E1L%3 D$0Hl$4$H|$E1E1Ґ/AHHcHS@HtH @HHfz(tƒz uEtH|$Et4$HHH;#LfATH5LL1XAZTHAHHcjHD$dH+%(uHD[]A\AVAUATUHSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Ld$ H$$HD$E1H2 D$0Ld$$H|$E1E1D/AL0HM@HtLcKvHf|(tEtH|$Et$1H5uHKH9#LƤSH5<LL1AXZI@HAH0bHD$dH+%(uHD[]A\A]A^ AWAVLAUIATUSHHHHT$QDLD$dH%(HD$81HG@LLǁHh/f*$ *E1HL%}|LL HH9 H@H 3@jAA1hLhH5 hhjfjejbhhhhhhj\jUhhjRjKj8j4hj&j%hhhhj jh1H  CH@jA LhA1hH5 hhhhhhhjMhhhhhhhj\jUhhjRjKj8j4hj&j%hhh0H1LAúhIE@S$H fD\$1ALjAhH5 hh.H D\$ C$ H@HA L1jAhH5 hhhhhjMhhjZjOhhhhhhhj\jUhhjRjKj8j4hj&j%hhhn/H1L H@BjA LhA1hH5 hhhhjjjkjihhjNjDjMhhjZhhhhhhj\jUhhjRjKj8j4hj&j%hhh.H01L(&HH@j1 DE% H)r Ą H; HDHPEuHHY u D[EDEE|H@ H@XHk1HLЅSHH@ tL6tJ@tL;t) L6H51E1@jALhA1hH5h hhhhhhjfjejbjMhhhhhhhj\jUhhjRjKj8j4hj&j%hhhhj jhh,H01LH51E1HD$8dH+%(HHD[]A\A]A^A_@f8LMC$LH5E1ADžHLD4HǁE1L%HǁL1H5 *L1ɺ H@,AOL1H5 )Lq1ɺH@jANLjjDA1jkH5 ji)H 1ɺ,LGhjALhA1H5 2)ZLY1ɅDL.,Me@CMfA$.vL+C fA$h)wI$@)HCPLcHHSPLLZ IE@1HtGft HHu1ft HHufOHfDHS`LHS`LMEHHPH  H{`ULH H{HLC`LKPHH@Hd Mt=LLHL$(LD$ LL$LL$LD$ HL$(bLK`HCPLcHL(^HAL1jADhH5L& hhhhjNH@1ɺLjALhA1hH5% hVH 1ɺALdIE@H f.oH.H|$fX'HW' fLq L%V1LfL1ɺ1LE19Mk1L H5E1fL|1ɺhH5ĻE1fXfDjA LhA1hH5 hhhj*hhj!jhhjcj'hhhhjfjejbjMhhhhhhhj\jUhhjRjKj8j4hj&j%hhh#&H`1LfAú?IE@Hf'f f.C]fh,nHH@gg~fDL1ɺ5DD$L+ H5 1D\$fDIE@Htf'fX'D\$LZ IU@HfD\$LH(L H5r18D\$|fD1LH5* D\$8#D\$HHPjD\$L1ɺH51D\$L%׸Lu1ɺCLyffh,t&E1f(!L%Zf.LE1fx%L%4f&fX-L%ffL%ff.Tf(!L%1ҾLIf.HA L1jAhH5 hhjcj'hhhhjfjejbhhhhhhj\jUhhjRjKj8j4hj&j%hhhz"H1LjCHH@fAL1ZH5 L[1ɺ1ҾLD$#D\$D\$L [fD1Ҿ=LtCMe@C My1L1H5  L1ɺ0 L1ɺ@L%1LDD\$H1'jALAcH5+ AYAZD\$c HH@DHA L1jAhH5 hhhhj!jhhhhhjMhhhhhhhj\jUhhjRjKj8j4hj&j%hhh H 1LUAúIE@Hf'fyD\$L KfDD\$L *DL%/L1ɺ=L3XUH)JJHD$1LH0(H/HHD$0IH L+ EfX'fDD\$1ALjAfebhH5 j*j'hhhhEH@D\$ IE@HC@Dc$EL%L 1ZLH5LHHW H@@H{HLC`1HtLKPMMMLKPMLLLL$LL$L%$L LD$HLVjLH(rHHfMH'H|$HGHKtHSpLD\$LL_D\$CHt>HCIU@H0f)"(h {D;IU@HC1fKtHHf,+C| H@ HHs Et {p0 uHD$H8oIE@Hf8##PCxw PD\$LnDL%|D\$DL HD$HH@H΅AL <'H|$T'HGxD$lL' HD$1LH0`B/HHD$0HD$LL$HLKXHSXLL(HS`LcXHvHLHT$HT$ HCXHD$H{HsLC`MHIE@Htf.PL HD$HSXLLHHCXBB H{H} HHD$LC`HQcHHsxLD\$HLL5_HD\$HAtfX'D\$1ALjA!hH5 hhhhSH0D\$ID\$L1ɺ%D\$L1ɺt ML L%1LHD$1LH0!@/HHD$0HD$zHHT$0LL}Lc`LD$0MtLLLD$LD$ H{HLC` HHD$HQD\$VL D\$L1ɺLKGHHH{HgL }xHH SpD9D1APL q(AL%}1L@XZ)LHL%ML1ɺ]L1 LL$LHZLC`LHrL%L1ɺLHHEAxALEH6HHCHHQD\$L1ɺPdL D;cpEVL q(HA(APAQL  IL% 1LXZCxLD\$5L 1ɺIH51D\$1ҾLD\$D\$t[ǃIE@Htuf[tVD\$L 6Lc`CǃIE@Htf I]HMeHI9tKD\$LAfft'LMH}LLGHL9uDHD$H|$Ah HxL%L-1ɺLF1CC|LD\$fD\$C|D H@IU@HOLD\$AD\$CL t L 1L 1ɺH5ƦD\$HD\$IL%L=1ɺbLVAL1ɺ~1ɺ\LL#E1iLD\$>3L 1ɺIH5$1D\$HǃIE@Hf.Sp BcpHHt {tWIU@Hif)tt 0c C|1ҾiLD\$D\$ǃMe@MfA$t1ҾjLGD\$fA$8I$HD\$eD\$L%ͤLk1ɺhLLP1ɺ1LgRMWL' RfgN="Lz D\$H5E11 HD\$HAbL%L1ɺzLL%L1ɺLL%ϣLm1ɺLqL%LA1ɺLZEDH1ҾOLD\$EED\$CIL d1L%+L> LL11LHH&LH( 1L 1ɺ3H5D\$zCpD\$HL>HH >H{H]L% L>HH BH{HH'LI(L@ D\$LgML H5ڡE1D\$L| D\$EWL. q(HLH(ATAPLp aL, HCHL%AL L Hǃst9s|AI}D\$A,APjM EfAs|A,I}$IEM ,HAZL A[=H5zLJ(AT[P112CtC|A\XD\$AL] 1D\$H5D\$E19LC`L%L1ɺLLH(1L 1ɺH5D\$mCpD\$HLH(L (L%`1L#LH(L AL%0L1ɺLL 13LH(1L 1ɺ;H5ĞD\$CpD\$Hf 2艃f ꉓ9E=LGVD\$H5:11ɃD\$LI(L L%L LL# 7]Lo /If)L%i(\f&tR|&Ƙ1LE17I+1ǃ1fǃf.LH(L' IL L? yfAUf1H5 ATIUH`dH%(HD$X1H)$HD$Ho L$@HBH HD$P1XtLl$@HLUuDH|$BfA$A$ AD$HD$XdH+%(ueH`L]A\A]fDH|$ t$t$t$$$$YH|$8H0foT$ fo\$0A$A\$AWLAVAUIHATIUHSH8HL$DD$LL$dH%(HD$(1L9HDFY0A|$hD$D$ HEPEt$`HENDH9DH9HI}Ej)A,M HAAZ=[A[IL'X1ɺH5d1iHRHHUXƀ L$ 9L$DEHHT$TH HT$@DD$HL$HLLbHtHLET$H+T$EA$AL$pjH@LPED$tt$0PH AÅHtHMX@AD$\fD1H].ASfDHD$ D$fDEL1ɺNH51E1HD$(dH+%(0H8D[]A\A]A^A_DH9HQHAHBQL IH5k1jE1D|$D|$ D+|$A$[E\$E5Mt$@H]PHT$$D\$LHW\D\$*T$$HAVL YH5L LD1Y^D\$D\$Lv1ɺ@H51D\$HAL 1ɺEIH5M1LA^T$D$E$ED$tAL$p DT$EHHLD$PAQEt$0H IE@HUXHt f"u AD$\@\$9\$ZQDD$HL$HLL 1D$LI1ɺf.HI90HI9uLD$T$DHL*<1A|$hf=HH@L IbLD$E1DHH /AÅBHUXf.L1 tH5}1|E1@H?L? IL 1AH5"$L1ɺgD$L1ɺafL Kf.HD\$ D\$taHL$DLHD\$ Lf1ɺH5t{D\$D\$L81ɺH>L IH5*1*D\$qLI1H5D$L1ɺHHD\$I9'HHL`LD\$tzHD\$4D\$t!LD\$yzLH8D\$tCLD\$(D\$t-H}PD\$聗D\$tH}P]D\$LD\$H-n=L HI1H1L D\$D$LF 1H5D\$Lf1ɺAVAUATIUHSHFPH@HpHG@HtbfvXL){1"H5x$L1ɺ-1H5:E1[D]A\A]A^@HMxHUtLt}xufHEXj$HE1HEX <1L 6IH511Hi[]A\ADA]A^fH1HCxLH6AŅHMXHL5Xv;DMt1ɺNPExL LP1X1ZHhAŅtCH,;1ɺVLILp 1HLAWAVAUATAUSH8HL$dH%(HD$(H>#HIH@tIHeAA`uuR{nuL{@f0HW@HuH{HD$D%EHD$ E1L56=HD$HD$$L=q HD$ifD$$s1ҾLD9 HIL= 1UVL1A貧_AXD EtYHIL 1SDL1tAZA[t$t$E1E11j1HLjSj蜭H0@HD$AfHD$(dH+%(ZH8D[]A\A]A^A_f.uu {n>e{x{@{x{1E1LH5;荦X=.%AtK=-(Ht$ =%IL L1x*f.D$ ;uu{nu {ILF 1L1@HnD{AH7<X\u{n{A"fHD$ADHD$uu {nu{ts{h{IL% 1ɺL1A٤@HD$ ut0s{h{IL 1ɺ뢀{nuʀ{#fDsui{huc{u]HIL 1PL1Af.$LE1H$H|$LL$pHT$@uWZH=YÃt&Ht$11LÏH=($9M؉$Mt8A<$#t1H|$HtE,tH}@E,[H|$LvNHt$L51ɺQ,Ht$L1ɺ</Ht$L1ɺw H=GDŽ$DŽ$HD$0H9$0L$\HL$HHT$0LHt$ B=Ht$Ld1ɺ耑D$X1L5HD$`HjHt$L"1ɺ>D$XO1Ht$L1ɺ D$X?|$XHt$L1ɺwːHL66Ht$Lu1ɺ葐D$XHt$LK11BL|$`IKHt$L> 1|1D$X;LIH0L$PL fHD$@H9$Ht$L11 辏D$X}LmL+lL諟IL`LKIHtLLHeIIHt$@LHaHT$9L^H5jaD$X%Ht$LՋ1ɺsHt$L1ɺώD$XHt$L1ɺ襎Ht$nL耎D$XLi &Hx@P,Ht$L1ɺ,iIL;HV`HD$H1D$XH.`HD$Ht$LM11軍D$XHt$L莍D$XLM1ɺH_HD$H1XD$XbHt$L1ɺs.LJ H5V_D$XHt$L1ɺ݌UHH8ATL LDH^LC HHD$(1蔌XZD$XAU>1ATL%!L UH-fSHHDdH%(H$1HA HHD$HD$HD$HHH$AD1LAD$4Hl$PD$pHDŽ$DŽ$ Dȉ$P1AQA裋H$H;Ll$H$H5H$L脝H$HtGLHHtWH`H$dH+%(uiH[]A\A]f.1ɺLL݇1붐HILLR ՊX1Z*f.AUATUSHHD%dH%(HD$81D$EbD%E"LHHLݙH׉H|$jAULc1L qRHH oATH5C R1U Hl$XH0|$HL$HT$ HD$ tYAxOLl$ Ht H}3LۙHD$8dH+%(HHD[]A\A]fP)1L  E1L H5bXZuLP 1H5Z4dL H5'6$1E1LLSH5҈(ATIHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81HH$D$ HD$(HD$@HT$ HD$,0H5 HD$8$$$GfoD$ foL$0H A$AL$HD$8dH+%(u HLA\f.AVfAUATIUHSH˹H@dH%(H$81H$xH,$)D$@HD$PH\$LD$LL$ I)D$0LEH|$`HHD$`HD$HH$pHD$HHT$(Ht/HHt#L5vHLltPMI}IMH1%2H$8dH+%(H@[]A\A]A^fDHH$HtHC`LHHJuHyHH$HC`H^fDHt6HHD$(H HC`Ht H@ HD$@HC@Ht2HD$HHD$0HD$(fDH1ɺL61 o oS$$HIE11L$LGIwNI:LAI9tt<_uIAAI9uHHtD@H1LB H541HE1AVAUIATUSHH>uW/EL5j@u(I]H[]A\A]A^D@ tkH@t1DHLm5tʄu>1L B H5=[1]A\A]A^tHH8uHIM[]A\A]A^ff.Hu'u[H…HGHHG HHHHDH5HHDHHHWHG H9uHG@( tLk1ɺ 1H5Kvff.ATSHH-HHƋ@vA v>t1E1Lӽ H5)HD[A\fDvH;11AątAHD[A\L1ɺy1H5XƯ@1E1LW1ɺ^H5-HD[A\AWAVAUATUSHH $HH $Ht$Ll$0IHHT$1ҾL$dH%(H$"HGPLH(1HHLphML$HLLHD$0ID$PHVD$(L15MHT$(LHoAąD%E蘖IHHD$ːDL$Hp"AH$H HD$H1~D$(IH5?HL$L$PLHcHt0PH5HcHL0PD$(HcHHt0HK Lt01L5SjLL$ L$L\$*~Y^1LL$L1L0 vH|$LIQL)Hñ 8.$HIHHDHAPL1SPLL$8L1H L8te8ȑ1LPHp}LL}PLL$(1XZ*fLl|1ɺ1H5H$"dH+%("H"D[]A\A]A^A_ID$PAt$HML E1H51_AX뒐諓H| 8$HIHHDHAPLSPLL$8DL 1ɺ1H5A~ @HT$,LHgAąxL4{1ɺ1LK~V術1L{ H5~f.AUATUHHH dH%(HD$1ILl$L,$)t~H}PݰAątFLHAątAHD$dH+%(H D]A\A]LLz1ɺ>1H5|_}DAL!z11:H5|4}fLy1ɺC1H5|}aeDAWIAVAUATE1USHHHL0H9HPHhEl$IVHL2LEXD1HHILEX cAątILM9tqIE뫐HH-{L HIj1N|Ly11|H1|HD[]A\A]A^A_AAWHAVAUATUSH(LI9MAHHAA͉D$ IGH@@]jC@`uH,~AąEIGH HHPH IHLDHDIAV L5zATIL L51'{H}PY^,AąAHH5 zHAąLovAąL }AąEDDl$ HI_1EIAą1HzzAą?1HAąALfFHE1L! IH5y1zH(D[]A\A]A^A_@HHLL'IH5Wy1yHs(H"HLs(IHHD$IGHp(!IwHL$HHF H/HH#HT$LHL$HT$H1MH= MXMSL 1LWxXZ:Hv(HIWHHB HtxHHtpLIHUSL Lt1ɺH1LwfDLt1ɺP1LwfDLJ(Lvt1ɺY1LwrAWIAVAUATUSHHH|$8L$4LD$LL$dH%(HT$x1HH9KLHC)L$0@yAąH|$8HGPHHC@Ht$pH|$8Ht$hHl$pH=}H HH=jt`HH=* tMHH=1֋t:HuI HD$ Hƿ1L@ 3vJfDHl$hDkLH7DH9 EAUHHL1@18A@HH9uD$0T$  D$E1Dd$(EO$vJM'HHD$HHlM9u6M$$M9It$H6tHD$hB<0Al$AD;kLsD\$EufH|$8|$0HϦ H HNPHt1ɿRDL$@HL HD$01tIAYAZI9H1f.HI9u9T$0HcD$0H4@HD$8HH@PHxl|HD$HHMHD$8H5H@PH8膆HD$PHKKLt$0D D$HD$pD$Lt$HD$@rI$I$H9HL$PH;H(HHD0HHH9UH;J@l$ L$0KLD$1HAՉT$OdmJ4Ht$(Ld0;L$WI/I9uDHmI9[HuLtHL$@t$HT$hH]DT$4EHC@YH{hHt$ 1L I1rKLȅtbL|$(HE11Lt$XL4@N,J*DEHFE=A9rÉL|$(Lt$XD)CLHcD$H|$HHL$hH@HHHDHJHL$pHHHL$H9FH|$D$HOH:HJHOHI>HWIVL0l$0HPIVHIF"f.EFHx.IHJ|(ATLģ 1AWHt$0I1AE)qHDND(LD$^H5Ӥ_H{0LD$I@HHHH{DH5bND(LD$/LD$I@HHHDH IBoH4JD*HD2HBo  JL(HL0KLBM;?tHD$8H@PHD$XHI9LHL$(HHH|H1ɺ UHt$0IL 1vpA\XfDHt$ A1L CpL4  Ht$ 1E1pfHHL$(M'HlM9ufM$$M9 It$HtrDHt$ Ll11oaH1HI9uH5QqH-HE1fDH H9uVL% 1RDL$@ Ht$0E19o_AXHD$xdH+%(YHĈD[]A\A]A^A_HnLk1ɺ HD$ Hƿ1nHt$ Lk11 n덋T$0A{LҮ " iH|$8ALHKDmIHxHL0 UHt$0I 1Hn[] Ht$ 1ɺ E1Lj!nD$0UH51LC HdmHD$ H1mHHL$M'HlM9uVM$$M9FIt$HVtl$  Dd$( L vHt$ LcGmHt$ L>"mHt$ 1ɺ E1LilHM/HhM9uMmM9IuHtL LE1H|$8HHL SH\$0I 1HhlXL Z H1Fl HM/HhM9ufMmM9IuHt;H G$H5nlH=lyH|$8%H-$@AWAVAUIATIUHSH8D$,H@Ht$H4HDD$(H@Ht$H@PHxt@HSI<$HRHPIT$L HPIT$HHID$H9t8I}JhHuLGE1IH5NP`HL[]A\A]Lv 1@H5`H e$H5`H=`mff.fHHIH9LBA@Y IML9H1t>uHIHIL;Q@t'HL9tPH1uHIHIL;Q@uLHAHHH9ȆHH@H@L9P@t͐HH9RE1LDH% ff.ATUHHLgPI$Ht Lu(I<$HAąt5AHD]A\@I<$HH]A\(1LZ[1ɺH5mo^HD]A\@AWAVAUATUHSHH(LoL~MM MW LLMg0LT$Mu0LL$Ld$LLHHLL$M;M LT$AuM;u0t1HHt@H5N^LT$JlLT$u!AH(D[]A\A]A^A_fM;W uHD$I;G0DEfDAWAVAUATUHSHH(S{ADA9"DED$HCHUH@H9BHHHL$HD$H9HLHD$HD$H@LxHHD$I9IfDM6M9IFLHpHruME1LC /H5t\\_AXH(D[]A\A]A^A_A9L, H51[AYAZDHD$HHD$H;D$LLM9F5M}&IG@HHx8HI@HzHIEHH@@HHHyH9pLIHL> R;fDHL P H5 1ZH f1E1LL{ H5ĸZTLE1L9|$HCHUH@H9BfHLL "1H5bKZXZ@LHLHD$M9pE1f.IWM?AM9uLL9|$t'E1I'M?AL9|$uED9l$DL MmM9LHL9uMmI9 -MutIF@HtHx8HYtI~@HFtIEHHP@HtCHHt;H9t6LHHL DQwL AeL DAWAVAUATIUSHHHLoHHhLLpL?`HLHHXqM$I$I$HD$L9BL=8fDLHHqHEpIFH@@HHHH9LJHU1 SLLWIFH@H XZM6L;t$InHupHt HltHgLL`L:_HAIFHEpH@@Ht HHtH9ugL (L O1H5+WH1[]A\A]A^A_L @H[]A\A]A^A_@LJfIٹEIDŽ$LCff.AWAVIAUATUSHhHn`H|$HT$@dH%(HD$X1Hntu8^hFptCn HD$HH\$@\ H@PHD$(8H|$AąE^pEtHD$HH@PH\$HD$(HD$(MfHHHD$8HD$H1H9l$HD\$LmMhM9I\$(L=LHjtH5ێHj[Me(AEu&LLjtH5Lj6EVTEH|$L-vtS=LATI-LИ 11TAXAYHD$LL$E11D$THH;|$t]fDGLt?HH @HBH fH:u HRArHH9uH?I9uEtt$TH|$1HL$THyD$TD$4AFlDd$E1AdžAFhAD9H\$HH;\$%Lt$H1E1HCDcLDsPD{$LXELHEHAT$HRH|HH98uHPHH°H9HQHRH%@tDaLI81@EEE9 DEHH;\$0Lt$H1EVhINXEfTA~PE D9T$AnTEVhD9T$A>AH|$DT$AH1ɺgID$<L͚ H5XsPD$(PDT$ 1ARjRH HD$XdH+%(XHhD[]A\A]A^A_HELhAA~PL+ HL-r1LQLN1ɺ@1LE1QpfDA1E1ApK8H߉t$0DT$$DL$ L$7t$0DT$$1DL$ L$A@>L[ACY*L߉L$0t$$DT$ DL$DL$L$0t$$DT$ E@AE9vEDHHRHHeH°H9UHQHRH% fDHqEAFlDd$EDEd$4uAFhEA)A9zH|$LЖ IhH_PH1ҋHIHtx~ltHHHH)HDL ,Hxj[=ĞA]L-pIA_LW 1ɺq1LOH;DHAFh1ɺvE1H-xpLjLHOL[L11*HrOL-@pL2L1ɺLKOMnHJAFTH|$AFP1A E^TAtOI~XDA~lA^htD)HD$HxXEEtSHUHB"uGMLR)օ!   9މ1҉1؋D$9D$Ht$DHHVXEVhHt H$(H'+H|$)HH Ht$HVhHFPH H|$8Jy)H|$(AVh틏HHHсHH9 t$9rAvhHH|$8H;tKHCL-JnL LHHX=Adž11;MEVhD+\$1AAD$Iٹ)L L-m1LLH|$ӼAąLI1ɺ61H5mLHD$AHH9D$H@@AFHD$HHXHL$AHH;|$qHG@dHAPAvhHD$(AvhMHD$@YA^P=ۘAٺEL-j11LC| LIHEA^P@ L-jL1L?| ILt$HD)EVhDLt$HD)t1D3EVhjH|$L-=jjLSILَ 18I[]6H %Hfn4fo `Y Ht$(fr f8?frf~9"D1A9L|$8HAEM A,@t$$AIHjAADLTEAM A,I@t$,Ht$8I$HDSL,$=L-iILL` 11HA]A_69A EL1]8I^XAFTI~XL܌ AV=\VHL 1ɋD$ PAL9D1ɺ01H50hLGHfHLPI°H|$_NL> It7-L|$AvhIPH|$(1ɃAIGPHD$(kEEI~XA~THD$8HL-MgDL ,@t$$HxHjQY{=I^LL 11FI^X!DEpTHxX[EVhD9H\$(HL-fHHDL ,HxjPQL,$=FIL< 11cEAnhAYAZ9l$P~A+\$VHD$8HLDL ,\$HxjPA^A_ILc~%=HLP 1ɋD$ PA1H5eDAXZuAHD$@A 11EzHD$LL9D$kI@@t A9 I~X@HEѹGD$ L PL-d1LCY^HEѹOD$ L PA111E1H\$81ҾL-dH0DL H4HHcHx\$$IvX,jO=LILu X1Z11CAFTQL-cL?1ɺLCAdžAHD11HIHL-cAFhIHDL ,Hxj\N=]L I11LD$$nB_AFhAAXHPXZL-%c1ɺ1L?L.B.HP Ht+HHt#LIL tUWLH(vif.AWAVIAUATIUHSHH^XdH%(H$1ILH HHL1۾H=ГL9HDHD$@GHD$8HcHALLI9HDǁL$tC|$HHTHLDPDL$X1H5ē@XZH|$8*H1H$dH+%(HĘ[]A\A]A^A_H1H sLHL1L2=1ɺH55G@1xHD$PH|$8HIGYHhLIH51?@LH5?1Uf.AWAVAUATUSHH $H@H|$@HHt$`dH%(H$HGPH$H|$(HD$ L 1HHƯHD$hHHD$H91@HH9uH\$@HH9SHD$H9fHPHLHH#BL$l D$lD$X1D$8D$<HD$D$4D$\Ld$Ht$H[HHLxIIH9fH H@H@H HD$H$LHH$HxH$b L$I9L|$HLt$|MLl$xH\$PDd$<\$X5=AċD$x=tW=M?I9tOIGLLD$xD$|Hx@^tыD$|=uD$xD$4=uM?D$8I9uDd$MOHH$HfHE1L$H>IL)$L$I)$)$)$)$)$)$L$`H$)$$IHHƄ$DIHDŽ$H$HIDŽ$(DŽ$4DŽ$pH$HDŽ$DŽ$Mt-1LHn L9HD$ DDL$PH5^I IH$H HHH@HHH vH@H41HH H-\HI$HD$DL ,L$PHxjFM1ɺzH$H1Ln ;H$H5u\H$H$_AXHD$ H8LH$HaH|$ LTfIHHHH9t1HH9u\HD$(H|$LD$\L,cj1E1jE11LY^rL,H|$H華H9\$jHH@H-1ɺ1L6H9H1Ll 9DD$\Et`H\$(L$L- f.HI9t7H;HtJ%uMHHh9I9uH|$ tH|$ (1 HL  91'@1L51ɺH581H$dH+%(H[]A\A]A^A_@HH9H%HL1 H5l1|811ɺHL-5U8L!51ɺY1H88ILف 1H5 8f.H1Lr 7H-L 1nH7]T$hLd$H-uCHt$@L)LH-c6u1ɺ}HL34[7D$!H5>E_$ f.A1HCA@HHHE1E1$1L$jjjnH0AąL 1ɺ1H5D#hf1҉l$AfD1ɺALU H5UDv# ljD$1҉AnHLL$LT$D\$9/LL$LT$D\$AVfHHH9t!DS A9r S$A9HH9uHLHH1AVE1L?H5C"XZc@AWAVAUATUSHH $HH $H8HL$H|$HdH%(H$( 13H D$ AE1Hl$ L-&/A Hu/fAAFH IHtIcL1LH)HyIH-11LT H!w9HT$B6|$u.|$H56m 2IHD$L MH$( dH+%(H8 L[]A\A]A^A_D58<3HL #PH T LTPH5@AQ1E1!H f582HL S PH"j LPHlPH]582HL t"PHS LPAQ5L5|S Lt2A 5IA11-1D6,@D,E|$,A<$2L S L)ARPH9i PHkPH1H A<$.i4L-k8H1HQL LPH==P1AU|$8H :,;[1HRL ʠLxPHh P1AU:H +TA<$1L6AQL R PHELKAvL$AUPA$蒱ID$HuH-+<1ɺ 1LH4L11HL1ɺ1HE1L11HH8D[]A\A]A^A_D$HH*IEHHt$IEHL(HD$LpHD$HHD$H9D$ HD$HP5HEPHxHGH@H@HHtHAąnA0f.HE1HjjjjjQjjD$pPL$H|$hHPIHH-:Li 1H}@ ED$,D$pH-C:L51ɺ HN2HH9Lh H591E1/HQHAąLi 1H59Lfh L+h Ls1ɺ1H5j9H r$H5H="&fAUL-3I1ATL( LUASHHdH%(H$1@HcH111ctb,8t});ILIHHcH HDHE1APLxQP1H H$dH+%(ueHĨD[]A\A];u+ILL1E15HHu'xƋD$%=@tj,f.AU1ҹATUHSHHwHLoPdH%(H$1IL,HH5L(H1LLުt LH5L賋H2L&I}HXH"Hs|+HEHH$dH+%(HĘ[]A\A]f.D$HCL]1ɺIH5Oh1DH$HxLHHILHLHH) H)։H\LT1ɺ1H5gg3f$ATfT LMH1ɺL* H5g$ۉATTV*fDAVAUATUSHdH%(HD$1H$HHHIIL% )f.H<$$H[HtaH 1HLLxrHsH<$LHuH"KuL1ɺH5t^AH<$5$1HT$dH+%(u^H[]A\A]A^fD1L1ɺH5sA1L1ɺH5s@)AWL=AVL5UAUATIUHSH1HHT$  LD$(L# LL$0dH%(H$1VLL/HYL^IDHLD$LHt$"H|$@j1SH# H kSLD$(H, L MAPLc1QHt$0H VH5V# SLT$PHARQH ATSAUQH AV#H$1Hp|$@HT$A@t ' Ju9HH 4HH޿ L1DL=bAŅtNDL Ebu0k_AAE8SL'11H5L?atqEDL)AL 1H5"Lfm9_DS8 HL @}PH L[PH`FH59P1lHL 1H5K@ 11L H5^KE8 HL |PHv|L[PHEH5P1H fAWAVAUATIUSHHhH$H$Ht$L$HD$(H$LD$L$LL$ L$HD$H$dH%(HD$X1AEH$AA?nu Aab_rrdLT$H=7L7LDM}Ht$HoL\$(H|$0jL MLDHHDHHDHASHDH1 PHSPHRPHt$XPHHt$XVLPHLT$`ARPHUPH] AWPHcH G PH$1 H$LLꋼ$HĐH_JAHM1L PAEH5P1t$(t$(AWH0Hl$@Ht H{HHT$XdH+%(Hh[]A\A]A^A_DAtGHt$HHHH|$0jHDHL `HDHHDHSPHWRPH/Ht$0VLPHeUPH  AWPHcH  PHT$x1H$LH`|$0LHM^H1MAWL H5xHl$PXZHt H{Hk1@HHH|$0jHDHLHDHyRL _PHUPH6 AWPHcH  PHT$X1H$|$pH@LLHy],AHM1L PAEPAWH5Ɗ1H DAMLk 1ɺPAEPt$AW fAWIAVIAUATUSHXLfH|$Ht$HHT$@H $D$ H $H|$1LHHH@sI3GH LVM2 x[H3UH tTHHKHMHHAH98LJHLa L1Q1ɿ"A $ AXAYDMALMHCI9A$DE1!AA$HD[]A\A]A^A_fHHKHtHHt H9HQL 1ɺPL1AZA $A[HHtH Ht H9/HHP11L RL9A$XYʀ5HHtHHt H9HsL1PLS 1LMHC^A $@_I9Rf.LJHHKHt HHtH9uGL HL= 1LQkA$[E1]rf.LJf.HB/HQHBkL @foATIUHHrSHz(HBHjBtHB(fHH8uϦcHHA$dLHHtE 3h9KXt []A\h[H h]gA\@Ht HHtH9u6L 1L H5 [1]A\@LHf.AUIATUHSHH#IHt_H@ H@H@H@Ht HCID$LcI} LHt/f@ID$ HhHL[]A\A]ID$ E1f.AWfAVIHAUATUHSHHH$Ld$0dH%(H$81)D$)D$ ft$iRLALyvfD?/HHuCL=- D$ 9\$ HLLESMH1ZYHﺶ1L=I9t`HK1HLL|HI9t<1LLL\uH-FL=1ɺHV1HnLL5H $H|$H1H5 AąH<$A HD$(dH+%(H8D[]A\A]A^A_fDH-L1ɺHH<$Lq11HLT1ɺ1HE1hgH<$gL#11H565H-L1ɺHQH-1ɺ1LH(1H-LK H!fAVAUATIUSHdH%(H$12H(HHI fD/H{/7HHt_}tLH{xD$%=@tHAƅuL1ɺ1H5!DA<$uILqAƅtaAHH$dH+%(ucHĠD[]A\A]A^fDHLxD$A%=@tL51ɺ1H5HML 1H5E1X@AUIATIUHHSHHHt]LHHtH tCLL9s7fDHAT t0 t+L9@ƃ@H@tH1[]A\A]H[]A\A]AWAVAUATUSL$HH $L9uH8fdH%(H$(B1HH$H)$LMHAվL$H{HHEPLHL1HpS{Ht$0L~L$!@ 1LLL#ADž8 Hcrypto_LH9$! AH|$XH|$EkLHߺ@ +HLHHE-H5% H=L5bIHLHIHIH0uI?/uI8/uH$PxHD$H9$PuHAw1IL1Lh c8 IwH{Y^cHSLrIH51E1H$(BdH+%(.H8BD[]A\A]A^A_fAH$LHHD$21@ LHL%R=S'LH1ɺPLL$1L aXZ1H|$1QqH$ljD$D\$YD1rD\$H$BD\$@D`H|$L#!@ LH9 fE1H$Ht$HH)$PHD$IH( IHHH 1%1)$` jA1j jP<5HD$8H HHD$H@HHxLpHMH5 rD$$D$,1D$(LL$ HT$HT$L$ H92A<  |$,tT$(Prt$(f.HPLT IH5̯1Q>@E1$!UKSMLLE8 Ѓ ˆ8 fkH8$LIHqH|!HDHAPL6SPLL$(1sD\$0H D"L8>1ɺLPH LPLL$1#AZA[ f.HXOL IH5\1@LL$L1L fDD$$D$$iH|$s$PyH$P11 @fDHE1NHL PLL$L1AXAYfH|$L11<H5L1L LL$L1L D\$'+8t1LPH LPLL$1YXZbL1ɺ1LE12D$,L1ɺ6H5 L1ɺZ1H5Ƅ$P<$@ATUHSHHdH%(HD$1HH$'tfH$Ht HHtH9utL ]HHO1ɿPL%R1L/ RLU;HT$ H HH uHu41HT$dH+%(upH[]A\fLHf.Ht HHtH9u6L R1L U1L濄XZLHff.fAWAVAUATUSHdH%(H$1?/tS=$ H$dH+%(TL 1ɺH5LH1[]A\A]A^A_IH5 IIH1HDLHhHtc$<#tIM}MHH;kH HCIE1H#LT$PHAHL @HEHH9H@HIٹE1PLM 1H5r[]1H= L莵L1L5 nI<$Ht00LhL 1ɺ.1H57LAU91McL H55JL L-r1ILҴAD;1LB IH5ZL-*藴L1L> JoLcDAHLILAHLDH N1McL H5 JL DL-hL3 L˳XL->L9 L衳L 1ɺO1H5{JJL 1ɺI1H5Lc=J EAV0CT8BT8ECT8fBT8[1Lu H54ٲ|L= 1LcNH5Y诲JCV1L H5耲LL- 1ɺ1L4LTA\$Lc1tLI H5%IcH1L H5lIcHX1LU H51IJA\$L-' L LLc臱b1L H59`LhL 1INH5}11L H5e DUfH-SH)HH)u))2HH (AH=y1"t1ҹ(HH=Ht H[]@(ff.@AVIAUIATUSHGHOH@0HWXHHHQXH H$HQXHtHH袉Aą'HL茉AąAMtOL9tHLfAą3HCHK0H{IMXI@HgXA[D]A\A]A^H0HHQX*AF^JHCHhX>;DHFPHcE1L H52#LqH1XDZ[]A\A]A^Ð1L1ɺH5"Ϯ[D]A\A]A^L1ɺ}1H5"蟮#f.LkhA)@LD1ɺ1H5y"WfSfH1HH@dH%(HD$81H)D$H|$1)$)D$ ~Ht5H@ Ht,8tC1IL1ɺH5 1HT$8dH+%(uH@[fDH@1Ҁ8HD@SIII IHHAAHA 1RH0^AXZEx [f.I1L, 1ɺH5%1[ATUHSHdH%(H$1IL..D$%=@tV=`t/H$dH+%(\HĠ[]A\Ht$(HfLHxqD$%=HH9$u yH`iIL\ H515@8ԽI1PH@WLSPH51跫X1ZfDC8茽I1ɺPHıL PH5g1oL1DIL| ;fAUf1ҾATUS1H8dH%(HD$(1I)$L$Hk L-1t$GALt$Lz 1UŪHT$ H H9wPHD$H9tFHD$A1ɺVHD$Lz LPP1聪HT$ L1ZYx_HD$(dH+%(H8[]A\A]۾HA1ɋL CH5P1L裾Aك8t+Ld 1ɺ^1LީrfL 1ɺ\1L賩G fATSHHIHt=HH@Ht)HH@HuI$I\$HtC HL[A\1߃1L_ H5 !ff.@AWAVAUATUSHH $HH $HhHt$HH5h H=HT$dH%(H$X!1D$LHD$hD$PD$\D$`WHIH-11L HWH$HD$pL=_"HD$xIhints_veHDŽ$HDŽ$D$$HD$LL臷HH|$1A?#HtҾ L輻HtM97Hglobal_fI9PA?filtKHscan_lvsI9Hdevices_I95Hdevs_hasI9A?scanN=r":AHT$pLD$(H$HL$pLD$xL$HD$(Ht0HϺLD$8H5 HL$0dHL$0LD$8/Mt&LǺLD$0H5e 4LD$0<H|$(Hth1HL$`HT$\H5< uKT$\D$`HHH HH!H H H HH!H H$Mt6LHHv(A}-t!1IuH$ #HHHD$(Ht$HǹHAUD$hL} \HPD$lPH$@!P1L$蕥HD$8H LT$(H8HL$D$$HAI IBLLQU@=v!iltef=k!r:HT$h HסLl$hMtH5D!L~fL 1ɺ1HLHD$LET$$AdHD$U1IHD$AϦL$@LHmIHQt&HHH9u HH9tL;xuLHtIHL9Hp1ҹLHuƄ$LDL9D$AT@IGHIVH@8H9M6L9t$Ld$HD$L9E1fDM$$AL9uLA 1ɺ1HAPH$X!dH+%(OHh!D[]A\A]A^A_@=>!rsioUf=3!n:F1HL$XHT$TH5\ H=!bDL$TAH1ɿjL HjD$pP1蠢HD$0LH ٸ1ɺbHDLS 1\f=k!er=`!:HT$hHҞLl$hMtH58!LyaL2 1ɺfD= !:S1HT$dH5>D$dH=!9u;D$dL 1ɺ1H耡HD$f=!h:1HL$PHT$LH5FH=q!®2LB 1ɺ1fH5  @IEHth L DL$LEt E9HD$L L 1ɺ 1LE1?L1LE1 QIL L1w ːILHP LƠsL}1ɺ 1L蔐Jf.HHb!HHtH]H^HOH8H9H* HHt9~ HHt#} HHgH@1HfAWL @1AV AUIATUSHt$ H5蓏H=HtR HL%M1DIT$ L4MuAnfDHUhHEPƂL}XILHR L,H$Mt/LM6HjHUH9tHMHJHHmHmA;\$rH=C H3H=<Htz H'H-L%H]L9t|HEH}HHCH|HpHdHXHHMHL9uL9t$L 16 H5 H=HH-HH HH9tHGHCHHHH9uH=κHH-HHHH9t%f.HGHCH萝HHH9uH~HHpD$ uH[]A\A]A^A_tiI]xImxH9tL%@HS81IMHL1uLى1ɺE H5\HH9uH[]A\A]A^A_L1ɺA H5&踌sAVIAUATUSHI~LI1HI1E1IdžH)HfD<_tAALDUH9s AD-t։ڍKAt͐[L]A\A]A^[]A\A]A^SH.HH{HI1HHHǃH)HAtJ11'fD΃31t,BHAt<_uۃt#vэBHAuƃL[Rfȃ_[HIt tAL^ 1H5C~ 6HDL 1H5袊AWfAVAUATUSHdH%(H$1N)D$P)D$@D$P)D$`u3AH$dH+%(HĸD[]A\A]A^A_ÐD%HEMHHL-߆KLILX 1 ؉H u E[H=DE1HT$@HHR H5 H蛭HEPHH8kIHfHT$pHHǹ)D$p)$)$)~ADžI>fE\AH= AƃAAt6HL$HE1E1j1HHjjH t D$HL LI 1dAAD @HHtHH9t @3\D=ENHL$HE1E1j1HHjjH  DT$E>fLLM9HD$HD$D IwEuPLd1ɺ 1L{#fDL<1ɺ L1E1PHE1E11jHjjHL$(H tDD$EM?M9_E[@A=ѳAL1ɺ 1LEɆw@HAL 1ɺ IH5y1莆bDE[@ZE1fDHHHL$LxH9,E1DIpIGxALxH9D$uEHHLL] AVI1 ZA[L$[1ɺ L1:DL1ɺ1LE1H@ ADžH=LLI 1ʄDL1ɺ KDHL$HE1E1jHHjjsH t$t L$E谙AWAVIAUATIUHSH8dH%(HD$(1uH0H#BXwAT$D-AL$HEfL={ HLDtHEXHr H%HHL IAW5 H SL=ePL1{AD$H LxH1HtHL胴AD$LHAD$$AŅH= LHLAHD$(dH+%(JH8D[]A\A]A^A_@AT$L1ɺ@ 1L蘂fDF1fL% H| HLDAHDAT. 1SIL 1H51XZ8f.H$H! HH HEDHHE1E1jHLjjҾH !D$EDT$EQAT$HLL9uf.HL9H{1u1ɺd LL ~58L}1ɺ_ 1LfDEL$EtE\ uVDD$E=TAt$/1H1HAŅG@E\ tH= fff.@AWAVAUATUSHD DdH%(H$1D$<Eu4AH$dH+%( HĨD[]A\A]A^A_fDIHVEtSHH LHD/H1ɺ6SIH5|Lܔ 1Y^kIHL$pHE1jE1LIjjuH AŅT$pD$tt"t.H5 LA聣@fD1LDmIFXEtaH0HuRAt EEu;LCL/ OIH5{1~EIFX@AGY@LHD$HHHL$|d{@AWAVLw(AUATUSH8L(dH%(HD$(1M9IIHIH˺`fDHHL$HH $H $2Hc;L1HjrH)Lc9M?1҉M9EIwvLD$T$ LL$L$T$ Hc;HfLH fMOHח HEH)1LbyLa1ɺ H51AHf.Hc;L1H7H)L6b.Lja1ɺ fDAHD$(dH+%(uzH8D[]A\A]A^A_É$1ɺ LaH5mD $La1ɺ >$1ɺ L`H51D $vSyAWAVAUIATMUHSLHxDyT$4$DdH%(HD$h1D$8A VH G HcH>DAE D$<L54D$ D$A1AExHT$A1A}hEE@1Ep1@Ip1E@ƍp1E@ƍp1E@ƍp1A@ƍpDt!IAAHT$EL5eEM8AH ynAtDHH HHH$1ELH _1ɉD$A<$LZEHf LL=ԡ ATL AWAu3D$,P1DL$0ALH0fLS1ɺH5VL|S1ɺn L1ƒE1f.HE HE$L9S1ɺ[ L1D $fDL|$MI@L|L5ԳLR1ɺw L13@L|$ZIL4 AXЃHEHEHEHEу у@y A8AYHEуHEIHtAMMAH5kPDхH 'LHD1RH$Hi RAX1AYALQ AXV  ; X@AY 4IHL5)H;H$McMP1K<I1ɺz H$IcAH I<H)1ILI1ɺG AA1H~ LL$ H$IL$ A Iu`D$ 1osD$( KH$IcIHNI<DD$ H)1?DD$ nADD$L=1ɺ ADžH$I<1DT$H)Hit u>DT$ADT$L:1ɺ HLq 1:ADžL91ɺ H$IcDT$Hp I<H)1y:DT$ADT$<:L91ɺ 1LiRH$I<1DT$H)Hp :DT$ADT$ HMKH56H6KH5k HKH5k HK1IMHHk L3T$ t$L@I1ҹHl$LLd$LQKHL0LA0DHl$L LgIL%b8FM1PHLO2PH541AXZ"fDCIHa8F$MIHI6HTHDHE1亀H {APH54QLsP1H ;H|$1ҹLEJHHD$E1ƀ+HL-,a8EM1ɺPHLd1PH531AA]A_A}dt+Am}qv}g}vHLXn AQ1MUH531`AZA[>GHr`8+E1MPH^H5L3PL01Y^AƄ$ff.AWAVIAUATUH1SHHdH%(HD$81!FH`HjE1Hj1E1Hj Ij肐H1ɺXILQ/HD<$E@L$ I]E1HuEtI$IDŽ$ID$AD$A L$$HAT$4At$0ML$E$A$I|$PAD$pPI$HP~sH 2Dt$4EA$E$ElHD$Ht$\D$\H4AEu"LC1ɺ1H5q@HD$D$4E1HǀMt;MmL9l$t@Mt;MeMt2E$EADŽ$MuHD$LhHL9l$uT$4L1ɺ1H5tp?uDHt$$fYID$HD$ H0LJ1ɺd1H5p?L1ɺ1H5o^?fED$I|$Et1Hu3L1ɺ1H5o?DH=Ht$$eI$Mt$AT$4At$0I|$MDUs#AD$4ML$LPAD$0PH5o1>Y^D$4-/LD$@%HlM1LH52(>L 1ɺ1H5n>Lfz-Ht$ L=LL-=qaLNG IH5-n1AD$4'LL$ LLP 1H5m^=ufEl$D$4EUE\$ EGHt$$L襂D$4$L 1ɺH5vm<|LHH3A}LO 1H5<rAD$HME$A$AT$4At$0I|$PA$PI$HPnH AD$4ML$LF )PAD$0PD$41|$@,L$@I~XLz#IFXHHt$8AF|LAdžT$,H%LaM1L[E H5~t;GHkLT$`DL$@ALLH5LT$HLT$H1|$@AR'HtL LsN LDH5 1LT$HAU:XZLl$@H5LHD$HHT$HHJH1H- AUL VHLr:^L _1ɺH1d:7M"1LM H5A 7: M/LM H5 :4"@UHSH/HH Ht^1ҹHH"HtH[]ƅI1 L{M H5 9H1[]1IH :HH yf.AVAUAATIU1SHu"tH;@u[]A\A]A^I$L3Et.~HfL3EtHHBDp tID9u[]A\A]A^ff.AUIATIHUSHHHH}HmLHlH IH;H<H HDHHSL LLHPH1AU]"H HL[]A\A]HLH HIHt HDS1IAUE1LK H5G 7XZff.AWE1AVLcAUMATO$UIH- SIHLHA$dH%(H$1ILSAD$At$ LHubD1HUIHtMH@1LLHxH$dH+%(+HĘL[]A\A]A^A_fKHHE @HmH@HxFIH|H@1HLIE HH@Hx|LLVM1LjJ H5γ@E1I1LrJ H5LE1y"Lu11H5eff.AUIATAUSHHdH%(HD$81HtYHHH[HtAHf11LH)D$)$HD$)D$ v5HtHP tNH<1MATLI 1ɿH5g4XDZHT$8dH+%(uJHH[]A\A]HD$8dH+%(u,HzHHD[]A\A]?f.1Hzff.@H  HLh@ LDHR@HDH:@HDL B> @LDL@LD@tH $> H5SHDHARRHP1PH(ff.AWAVAUIATAUSH32IHHx(IHHfH@ @AtAt AD$waI~ HHf@Mt3L2I~LxL HLLHHEHkD#I^HL[]A\A]A^A_f.L 1uH5yI~E1 fDLG 1{H5AdfHEL< 1H54fATUHSHHdH%(H$1OIH#HH8uC~8EH$dH+%( HĠL[]A\ÐH-l1ɿ1IL< HyL1uIٹHL< Laf.+;IٿIHHOHDHH J APH5ծL"eQP1H LE1fLA; 1H5fAWAVIAUATMUSHHH$H|$HT$L $HD$dH%(H$HGtstnPvfH@HL LFE 1E1H5H$dH+%(HĸD[]A\A]A^A_@C`t H<$H$J,0HuIHu,1E1L3E H5_uHt$LLHE1H<$zC`H|$O$7DLLt$ϦAL$L%A9$HHt H9jL .H1ɺFLt$LD 1ZYE1LIvIHE11MGMK,/M)fD{@LHHcЅ8tۃ tAHHIH9 LJA9H MHE1PHRL.bPH5ҫ1QH LIM9DLC`}AoAoOAoW Ao_0Aog@E')D$ AooPAow`)L$0Aop)T$@)\$P)d$`)l$p)$)$E1HT$!H01@A{t tD"HEt IDN tHH|$ D HHyH9pLHHL%11t$L濄LB 7^_H|$DK,7LϦLt$A֋$HA9$zfD$E$I/H|$L3AŅD$lL ,H H5JA9HEL +H9LJL +H HJA9HEH$K 7LH7 kH|$1L3AŅt,AH `xLHL m+LD1ɺT1H54WL1ɺQ1H51f1AWAVAUATUHSH6H9IHF HcH>LuA$E|EA/@H[]A\A]A^A_@A$LmHHAttHIT$It\ A$HATuA]SAU0wHLD$#D$@LmLIuE]ESIUELD$HU D$3fDLmHL)EMA9AFK1DHH93A\A8tfLuAA$1H9AA8T6uHMnIT$L5DHELExAD9?A[LuAIA$1 HH93AA8T6uHMnIT$LtiDHFD2EAD9pAHLD$1D$DLA9LHGKuGH1[]A\A]A^A_fDHULD$3LD$AEnfEUESELD$ D$;fDAIIT$HHeDHB2A$IAD0IV /w A8s HH9uADH߈D$APAHL艑D$I~DD$ʒADL跒AD$[LD$ ED$2I~DD$xADLeAD$ATUSH1HPdH%(HD$H1HHx0Ld$HL0HtLH-1 Hu HD$HdH+%(uIHP[]A\@HT$ )HHcH<HcHiMb1H&)H0 yOff.@AWAVIAUATIUSH(Ht$HItHźIFI9rDHH9t<( tHIL$E1E11HL$1Yf.x?T$  T$ IHMAD@@t "t_ DHD$AB AGIH9s,At#AL;d$sEu uAGE1IH9rH([]A\A]A^A_fDAWIHAVIAUATIUDSHHLD$0H8IHHL$fIWL IELpHHH@H@0@ HIUAE H9u HH9tHPL;"uAE LuH;HCH|$PI]IEL(LktHt$PL.H[]A\A]A^A_LM$H5L11L9 H51=ff.fATUS?/Ht0I}L9 [H5s]1A\%d#@HIEHپL|/L LzMDHHLE1~x []A\DIٹLt9 {AWAVAUATUSHhLT$L$LL$dH%(HD$X1HHD$I9SIELt$ IHLt$(DLt$ @ucAąuWLoL/jIH51HD$XdH+%(u HhD[]A\A]A^A_f1ɉHLAAąVIEAuLHH ub@IPD$0'AąLT1ɺ1H5gJf1AtLHm(nIUHHB HHHLIUsL7 S\DHEH'r 5&H|$0H+ H HDH+ 1:Lv1ɺIP&Aą1LAąIEH@@ -D$HE 'D$A;ELLqmIH9T$HJAAtDJLH PDd$LU1LL7 E)HL$E1DLM$e^L_AD$AELHMHH'u  AE$1ADžAuLAAEPIGPHHHˆH9ufDH@H9@tIE@L1L GAąHM|$\H'r f.LHm(kIUHHB HHHLIUL5 S@AH@IED$1L1LA1貈Aą?L$HEtHtLlAą,1LAąd1LbAąHEA@1ɺHLtApLL1ɺp1H5_Bf.L(1/AH5PE&IE1LH51E1DLHm(4jIUHHB HHHLIU{L3 SH51E1AXAYrf.LAą L91ɺ1H5L/AE8LJ(kLJ(H5LD$L=iHIEHP HHHLIHSLO,f.Ll1ɺ1H5bf.LHm(hIUHHB HhHH\LIULr2 S{@L 1 LL2 L蜨L _AL1ɺ1LοIGPHHHˆH9tfDHHBH@H9uL&1/AH5wBMIE1L"fHT$L1LAą#L1ɺ1H5vDLJ(LJ(SL1ɺ1H5+fHEL\1ɺ1LֿsVfDLfIUHHB HtfHHt^LIH1SL)H5XZL1ɺ1H5sLJ(LH(L1ɺ1H5>L1ɺ1H5wf.AWAVAUATUSHhLH$T$DD$HD$dH%(HD$X1HHD$I9#ID$L|$@AL|$HH$L|$@A9H$HVHHHEH@HtA@E9L$Lht.A|$LAEDD$DHHޗH}P}1H{SID$H@H'TH$@t C@D$EuA$$EuEt$8A$D$ AD$$D$$ID$H@@u JHEPHHHˆH9uKH@H9;@tI$ID$AD$LHRAL$$AL$PADŽ$ADŽ$A9HcHH9T$,HrFtJLHE~PHzA)L. Hƹ HD$81HL$E1HE1D$_AXeH$H@H's1LH= H}PL1L?$Ht$(1KD $5DLQ- 1#H5E1fHD$XdH+%(7 HhD[]A\A]A^A_f.E1ɩAAE9L$Lc$L1ɺSH5"1D $fDHLk(aIT$HHB HtsHHtkLIeH$H[(H@ HHHD $LD $S3PL, H51 A\E1A]LJ(AUEL1+ SH5[1[]E1HLk( aIT$HHB HtKHHtCLIAU;L* SD$LI1ɺOf.LJ(f.L1L9d$LDH$@@`HCL$A$@t9A|$Lt1L9H5HHCfD eHH9D$ $L$ HXDp8|$$xPx$H|H_IT$IHB HHHLIH1 AUL-L+ L.X1Z11LH|C@t-A|$Lt%1Hd1HyADHLk(_IT$HHB H?HH3LIAU@L SfAD$L(fDL-1 LL* I1LWED$LETM$M$ 1IEH`XIAH`X=I|5I11HgXH`XA$tHOXHD9ufDH$H@(iHh$LQ1ɺkfLJ(H] ZLIHfoLֿPHL P1AZA[1HL$H>LyHI)H@H@fDH(] bLALI1L HT$11HmLZ$LW1Lֺd1nD $UDL1/AH5`76L1ID$uH51 4$L1ɺV;f.LJ(|HEPHLHI9ufMRL9twABtHHCHE;l$LILJ1ɺ1H5]Ht$(1:E1"fL1/AH506L1ɺ11LH`H$H@*@T$1LHdt$Lm1ɺfD$LQ1ɺL1hD $OH[(HZHL~ SIMHLT$xZ L% IHHHD$(1AD$LHL$8LHT$0pLT$oLT$HH9D$H4$|$ Dp8Hp$|$$xPx$HpAl$L1HHt$VcaLl$0H5 I}HYH5r HLT$8IzHL$4HL$HHS(LT$IjX"ImX!AD$LH$=YH L$ HT$I1RHt$8AD$LLpt$Y^YMEX4$1LLIMEXLT$LtGAD$LLL$DhYL$1DLMBXLIMBXL$ LXHt$(LIj1Ht$(11Lf.$L1ɺSL1ɺ]1LֿE1$Ln1ɺ3$LX1ɺ$LB1ɺHt$(L*1ɺFnH\$(11LHL11H޿*Ht$(L1ɺ$L1ɺN ff.UIASHhDBH=BdH%(HD$X1H{LH5BH BJBLLHBL nBH\$HL\$@LHDDT$LHD$HHDHAhD$HDHɉ-HDHH|$ HDЋPLL'Ht$(LD$HL$0HT$8D$HMtH1ɺLHD$XdH+%(uHh[]ff.AWfAE1AVL={AUIATIUSHHH(HL$L$ HDD$ LdH%(H$ 1)L$8HD$HHfD$fDOIѺAPL! VLS1ҾH ?1H$LŹlHUnLD$  IL 1L21l$0H|$P1H1H5 t$Ht$Ht$HQH$Dt$pHD$(H$HD$ H EHILz 1AV6LAZA[E1҉ÅH<$t!H$LT$HxH|$LT$LD$0\$@Dt$DHD$@foT$0ID$A$H$dH+%(YH(L[]A\A]A^A_Ƅ$ ML1L9 (E1QE1҉ÅcH$E1D$ HD$LT$H8HL b PH" PLPH$L9P1Ӌ\$@LT$0H fD#HD0DaA}MLIH*H0$H =vHDH#APLZ9QP1E11H pf.HL\$pf1L ! L1L\$(L)$)\$pH$)$<L\$(L K! HH@ H8t-L-p71ɺ1L^FLrH@8OWxKMxCH$L5 1Lf1LL\$ H)$)D$pH$)$L\$ HItELP MtE^HD$PH@@H fH.H5T HIHH-6!1HHf.AT tt HH=u HHtL 5!1ɺb1L&H5jeH5 LfHHtg1HHT tt HH=u HHtL H5!1ɺi1LR H5H|$0t D$LhHt$0Hl$LHHt$XHD,$HH ADEDEDH;D$ fL$DuQHD$0HtH&H|$0uZH$dH+%(PH[]A\A]A^A_Lh 1ɺ1H5HD$0PL1ɺ1H51ɿ1LH5H|$0PL)H‰Ȼ HL$fDHH9<uLMLH$H$H3$H3$H u)H$H$H3$H3$H D$DĠML 11WH5ML 11YH5yH11AWL H5kkXZHD$(L 1ɺ6H5JM 1?jHT$XLHLL$`%LL$`HL$0H= +H$H9$1Q4H$dH+%(uHIك1[L>]A\H5A]A^A_ff.AVAUATUSIՉH5 IHcAH>I]IE1f.HS3LHAH9uL[D]A\A]A^fHGHt H L[D]A\A]A^fHGIuHtH IUAuL=LD`[D]A\A]A^DIUAuLA[D]A\A]A^@EeEUE11ۉLHIDHP0AA;]r&@EeEE11ۉLHIDHP0AA;]r@EeEE11ۉLHIHP0GAA;]rE1AWIAVIAUATIUSH_HHGIAnHtHX;(rv^HXHHuAM,I(Ht`fH@ @(HM9u3L` H[]A\A]A^A_HXH@QHttىmDIHXAnfHH11[L][A\H56A]A^A_% H~AWEAVIAUIATUHDSHH0DHA0A9wfHSEHDSAHD9tH;uD9w2@HUEHDUHD9t)}u1H[]A\A]A^A_uADEu,֐EtHEHSEHDSHDEHHAtu'EuEH{HuHE{HEu`0u uuIImfff.@ATUSLgHHO I9A$Il$<^&<#~*P܀:w"H51 HcH>fD<|H{C1HkHHRA $Hs []A\H9L 1H5T C[]A\DHkC[]A\Ho1GHHHHCH[]A\HHHA|$^11LS L9z1ҿfAD!IiL9[M]\-AIAHHKuD HoGHHHHC`[]A\Ho1GHHHHCH[]A\ULMrtn}AAHFLMM9|M8|ЉʉLCI,A EAD#]AEÃE8}DA A I-A A  I9HCHkID$G1HGHHH]AL$rtFtt!nt,Hs 2HCH"HCHHCH @Il$HC`O[L ]H51A\%~ ff.AUIATIUHSHH?Htwf@Hþ1fCH}L HHtJ1LH]H߾PxTLeIm I]H[]A\A]L 1H5fJ H1[]A\A]fDM1Lr H5+Jp H1[]A\A]AUI ATLcUHSHH?HtwHH@@ H}L# HHtL1DH:H߾ BxVLeIm I]H[]A\A]fL 1H5VI H1[]A\A]fDE1L H5I` H1[]A\A]AUI ATAUHSHH?HtwHH@H}Lw HHtP1DH~YH߾ 6xZDHEIm I]H[]A\A]L) 1H5FH H1[]A\A]fDE1L H5 HP H1[]A\A]AUI ATLcUHSHH?HtwHH@@ H}L HHtL1DH8H߾ "xVLeIm I]H[]A\A]fLy 1H56G{ H1[]A\A]fDE1Lb H5F@ H1[]A\A]AUIHATUHSHHLL`LHt-LHHHCHC H[]A\A]1L JVH5fF H1[]A\A]ff.HAVAAUMATIUSHwHHubf9.tL@Hs(H HtKuƒtDtMLDfPt[]A\A]A^@Hvf.[1]A\A]A^1fATIUHSH?H rHtEfL`HS(H{(HhtWHHS0HPHS0HHC0C []A\1L H5c [1]A\EHHtHff.ATUSHH $HdH%(H$1H$HHuIL1ɺMH5θ H$dH+%( HĠ[]A\fDHHxȅuMH-H.t 8ufIL H1ZJ |DH-3tIL 1HQ1 DL% IH$IH}HH mkHDHVAPLQP1AH AWAVAUATUSHH $HH $H8dH%(H$(!1H$ HIHHADuPLܳ1ɺi1H5( H$(!dH+%(H8![]A\A]A^A_DL$ LLݩtILLKuOD$%==`Mw1L: H5 ]L=pEpLH]H1IAVLL+ XZ@EuSLL=ys8M1LD H5ܵ DCtLH4y8HILt 1AVH51w AY1AZH9F@8HLIAUL: 1( Y^H$L0uP$%HsHLh I1AVL1 _AXT'H 8i$ MIH-H8HDHH pAPH5jL[QP1H 2{ff.ATAUSHH=!dH%(HD$1H$!JHH=HIHDHHL%1It$LL  XZH<$}H-y 82;HH HDHIPHLPL01RH|$ H HD$dH+%(ZH[]A\L%1Lf L H<$H<$.@!I!fD11HHHHp L%h8"LLI1AH-4 L%,8HLIPL? 1Y^L1ɺ1L @CH- HV8~HgUff.fAWAVAUATUSHH $HDL$HAHH$AAEHdH%(H$1EuQLݭ1ɺH5&! H$dH+%(Hĸ[]A\A]A^A_AIHt$HI I IM D$(%=`L;t$8tHL=HtL=8D`H+1$t$LHD$ `ky8?|$ 11DDH_ILL1B fDI1Lr H5¯ $L="IL3 1L-1l HY $HIIHH bHDH)APLQPL1H L% LIPL51SAԋ|$X1Z1uH 8]$H,IIH1H dHDH>APL[QPDAWAVAUATUHSHH8D$pLl$xT$L$D$$$DD$D$($DL$ D$,$D$$D$ֽLI˽LHD$ rp t L= L%z M7M9DfDH|$HRIHXLxPD$HAD$ D$AD$$D$AD$(D$ AD$,D$$AD$0D$(AD$4D$,AD$8D$AD$LDD$AD$HHLLpLM|$LMLLHPH M|$@H= H LH=I$H ID$L L%t H8[]A\A]A^A_y~fIwH\IMM9IAuѐwL= L% M7M9IwLat'DIMM9qIwLI:uLH=}AGILH ,IGHBH袻먋r d j L=q L%j M7M9uDIMM9IIwHuLH=WG}AGILH ,IGHBHH    DLH=|AWH L,IIGHBH輺?L$1DED$L$D$=7H8L1[!]A\H5A]A^A_%| ff.HHHtIHH֋HPL2^QR  DH1iH@SHdH%(HD$1t_,fuHD$dH+%(H[CtHt$M u&LB1ɺ H5 @t$ŇuH AٹSLxH5KF XZZjf.AUATIUx5L- IA1ɿ1LL u]LA\A]龸fDCH- 8腺HLPHPHOL PL 1LH ]A\A][ff.AWIIAVIAUATUSH8dH%(HD$(1HtHMtILE1ML- HÃf.&4IcDL>f.ItAF\MtoHI 'u_؃HT$(dH+%(H8[]A\A]A^A_A1ft7Ht-DHH 'tLA܍MHÃ:DMif.Ht$ LHT$LD$L$ VL$ LD$HT$DIHHfDqDLHT$LD$L$ L$ LD$HT$'LHT$LD$L$ L$ LD$HT$LHT$LD$L$ L$ LD$HT$LHT$LD$L$ 7HT$LD$L$ LHT$LD$L$ L$ LD$HT$gMIL9L1@HH9uHT$LD$L$ L9ICH5Hx(豺L$ LD$HT$fDMIL9qL1@HH9uTHT$LD$L$ L9ICH5 'Hx({AF\IH IH9HxXHAF\IIH9HpL;vXHH9uIFXH!IFXH"IFXHIFXHIFXH/IFXH.IFXH'IFXH&pIFXH `IFPH@`H L@IFXH68IFXH  IFXH3IFXH2IFXHIFXHE1E@IFXHAF[MI?H,fIFXHpAFZcAF[SIFXHCAʷf.AWIAVAUIATIUSH(HtHMtIE1ME1AL5N fDMLHIL9IDIc4L>H@H5LL$HT$Hx(D\$L$L$D\$AHT$LL$E1D*HLAHH t_NfDH@H5#LL$HT$Hx(L$D\$虶L$HT$ALL$A7HuAH(D[]A\A]A^A_DH@H@H$T@IEXH@IEXH0IEXH? IEXH%IEXH$HH@H#xH@H@MH@H@H@H@H@H@H@H@H|@H@H@ nMuAE\D@IEXH10H@H@H%@IEXH-AE^It0AE\u)AuHAH@@uvMDLHI HpFxLI|AE\qA]DD\$MuI^AE\SAb?A(ff.1AT(‰1Ҩ0AƒE‰ƒ@E‰ u E\t IcAAA~IHtUL萩uEuAE1fDMcLB<IL譨1LHfDEu3H$dH+%(u@H[]A\A]A^A_fDE1bMcHH51B<B˯ff.ATAH5uUHS贯uHHAtHcH  HHHTHHtD[H5]1A\ͧDH5HYu%AuH HHHT(뭐H5H!u5H:AtAt AeZHjfDH5Hٮu5HA=HA)H5H葮HAHKA]ff.UHH|tWu H]uH]fy,L(1]H5-w]ff.AWAVAUATUSHHdH%(HD$81HIL51fHHIL1L)D$)$)D$ HD$dfHH@ H8ML511LL HHl1LPL 1L| AZA[1E1LH5s,MHD$8dH+%(aHHD[]A\A]A^A_L5k@H@8OuxKuDpEuH11HL)D$)$HD$)D$ >HtH@ Ht DEHL511hL 8H5Z _AXL 1H5+[ fDAE1LH5N+(LxAtHL5f11LL)D$)$HD$)D$ SH:H@ H-84ML511LL HL\L1ARL 1Lz L.Y^MD}MtuHHf11HL)D$)$HD$)D$ Ht@H@ Ht78IL11H5 fHAV1ESL 1ɿH5)A謔XZXDL5k@Lp)HXHtH5+HxHtA $H5 H_HtA $H5HFHtA $H5H-HtA $H5HHtA $H5HH A $ 3AWAVAUIATIUHSHHHdH%(H$1@ AHlD5E\D5a ELL|$@@LLAƅHL%=(11SL}LAWm UMIMMHT$(H VH|$ jL SHjLc1SHT$ H/H H5R1SHAVSHAWSHUSAUxH$1H`|$ HT$HDL$t AEy#LBL1E1 "Hl$0Ht H{oHH$dH+%(u{HĘD[]A\A]A^A_AyƹR 1E1L@H5&蟑DLd1ɺk 1H5&wrͦff.fUSHHHHdH%(HD$81Ht HuHD$8dH+%(HH[]bt؋ tH[(mHH|$jSLc1L RH 1H5U軡H\$HH 1ɋ|$HT$ H?Hl$ Ht H{HD$8dH+%(uHHH[]~ɥfATUSH@ dH%(HD$81t @ u HD$8dH+%(H@[]A\H舟1H|$E1LcH 1H51Hl$(|$1HT$ HntD$ y$L1H5$螏Ld$ Ht H}L蓟 FH-$1LHOHD$8dH+%(u(H@HL11[]A\rfAVf1AUL-ATLUSHH@dH%(HD$8HI1)D$L)$)D$ HD$,Ht?H@ Ht68H-pM11L`H H-CHH41HPL 1Lsp A^XHf11LL)D$)$HD$)D$ 脻HtGH@ Ht>8H-1ɺ1L qLH H-HHH1PL 41Lr A[]HH-pf11HL)D$)$HD$)D$ ͺHH@ H8IH-11LHF HL5R1HAVLEr1L ܅ _AXHf11LL)D$)$HD$)D$ (HH@ H8 H-d1ɺ1L LKH HH1HSL 1Lql YI^H1AVH-MLH XZHxH5`fWHHDŽ11HL)D$)$HD$)D$ (HH@ H8H-dI11LTH HH1HSL F1Lpp AYIAZL~HxH5S(耠fHH11HL)D$)$HD$)D$ HHtCH@ Ht:8H-I11L|Hɷ H-[HH1HSL ^1Lo A\IA]L{H-h1H*= HD$8dH+%(H@HLa}1[]1A\A]A^LHf.H-S@H-@H-{7@LH^LHPLpҞfAWE11AVAUATUSHH8HW8H|$ t$4IHt$pIAdH%(H$(1HjH j%j 1PHD$HH H Dt$pEu@H|$(LH$(dH+%(H8D[]A\A]A^A_f.HD$(LhPIE0HD$@D$4D$2tD$E3D$4D$3t D$tD$4MH53DL蜖AƅNEL HEHt$@H$1ҹH|$XH1HL$`HT$X1LD$hwL|$`MtL]HT$h:C@$ H5Lt0 H5LҕtH5L躕u|HL$HyACHrHEHH H9LJHLE1t$HH5܄P1AT̆H ELND$$H<$7D$4tDD$$E!At$X|$Tt$h|$`1|fH=.HHtHt$HT$hHѣyHD$hHx8HtH5菘AƅSHlH=HH*HD$E111 HP8jjHIjH I%A 1PH IHH@Ht*HxHt!1HL$XHT$`H5`HD$H1ɿL-MLHP8LHIH I%A кgP1 LEH]]A_HD$HHH;D$LHt$@XL`ATL1贁AZA[D=y E H= HD$HHt$H|$HT$he%HT$h1E1L=RDZEH\$8DLt$CLHHLaL1SAXAYHT$h;ZLRH@I8AtIHtL9uL @HD$HLh1HP8HIH I%A к<PH5~1rY^H|$VDfH\$8HD$E111 HP8jjHIjH I%A 1PHD$XH H] LpMLd$HL=I MIIVI~InH9Mv I9!H„tHtH5}LH舑Ht@tH5HnHt@uHL$HHgH9^LHL-4}L1LH|$8BH|$Z@DL{1ɺH5|~H)@L{1ɺH5|~HpL`{1ɺ1H5|s~.LVBjE11j11 jD$pPD$0H IHHpHtHvHT$hH&HD$hX0 @8LAHDLz1ɺ1H5{}L-{1ɺ_1LuzL}HD$HLp1HP8HIH I%A кCPz(HB08A%HL$HHt H9L L|1H5{|Ly1ɺcL-z1L|H&H\$HC8HHH % H HH9LIRL-z1ɺPL1L^|H趃HD$(ZYHHt H;D$L % t$@PLxATVLx1ɺ2H5z{ELd$HH|$8?H|$HLTw1ɺoL-txL:w1ɺsLSzL;>H裁DHL$HHH9LHH t$HL1H5xyXZ HL$HHH9LHt$@KLATH|$=HL$HHH9LHt$@ELATH5vw1E1ay^_zHqfLH|LHL  NLHL  ~HD@1L$HL~v6H= H 螀HHHxHHHǀH1H)HH= SHaH@fLHD$8~H=W LpLHT$8H6A)AEt$AHBHE HHE(HE HEHDžHmHEPHEXHEHEE@HmE`HjHEH*HHD$hHUHP0BRHH H H%H 1HE8  @H|$L-Xu~HL$HHt3H9t.LHHt$HLQL L L L ܣ L У ML ģ L-t1ɺ1LsLvH|$8:H|$}L^s1ɺUHL$HHH9LHLj1"H5Mt=vXƄ$Lr1ɺ1H5tv*H$MHDItHtHpHHH)AI)AAA1ɉσM 8L >D9rL|r1ɺsL 0HL$HHtYH9tTLHHet$HLZHL$HHt.H9t)LHt$@LAT$L  L L}H51tH;H躎Lq1ɺL1yH5tǀ:HGH nvHDHL$Ht$XH Ht=H;L$t6LIRL P1AWVH5arVtH mL 6 HRGECL7fBL0$ECL7BL0gHBLfHAHuSI1HH FHkDqAHEx [1LH5|s1[AWAVAUATUSHH $HXL=+ dH%(H$H1Ld$@AIIHI;LHLpL1ɺ51L1ŅI?L/HgIƅHcL11胊A>IEAnGH$HdH+%(HXD[]A\A]A^A_1IMLHSLox]1L1!Ņ6貆E18M1PH L|oPH5ۀ1q_AXTLü1ɺH51E1q(8E1膃M1ɺPHLoPH5i1iqLA>HM1PHLnPH5+1+qXZ@ 1MẵPH+E1PH5Ln1pY^V?ff.@AUATIHUHـLLhLzxIHtRLHH蔉E11LLH HzH5KHtL]A\A]f.L1H5o,pf.UHAWAVAUATSHXHLHdH%(HE1HHI9AD$LHI%HHHH)H9tHH$H9u%H)HH&LNHHID$H@ .HHHHH HH(H H0HH8H0AG[tIGPHL%H>AŅcIH9H@@LqAŅLLIH5m1On)f.L(HϟHID$H@ LQIT$HHB HHHLIHLSH55m1m[A\E1@HLHHwHLHH5 łAŅHa)HIGPHL%lLLLAwH1l_LAX1LlIGPHLLAwH1LlAYL1AZL|lL1L\l9f.LLIH5k1!lHEdH+%(HeD[A\A]A^A_]@HLrDLJ(HKkLh1ɺXHHƿ1kE\$LE]E1LE1ME@DH@IHH؋IHދL`MID$Xu|uuHFHtlH@XuauZHLL9DIHL HI9HsLtDHfDAt2AIHDHHXIHDHHXAFLAA9EMLE D9IVJt D99 B DžE11DHLfDLLIH L$PH5Cc1cAZA[M$$I9I$uH@LpAuAA+D9`LIV@HtH Ht H9hL ; `HbHH1ɺ.1L_cH1ɺ51L_E1bfDDLLNHL1EAR#H5bbHEH@PH_AXYLHHILD1E1LLH5abHLKHDHJ@HHHH9{LJH PL1H5aDaH[A\WHDH@PH:LHLPLH5`nL]1ɺ1H5`aLKHIFHP HHHLHIF@HE1SLLAH5$`RP1`H mAT$Lt`BM$I$H@H4 I HaXH HHaXH9uߋE1L@H_tNLAŅAL\1ɺH޿1_AT$LAD9vHDH HtA4LMtI$H@HLDI$HDHHHMXHA@ZtIILH9HHLLﾀH@HHH1\LLL1oHPIGPHHHxfHHLTMtAMHLHBHIHHH1$\L`[1ɺIGPLHxfHHHBHAT$LpL 9 }1ɺAL[H5]"^LZ1ɺ1H5]]HP(LLIGPHHAt$LL1LHD)M$AŅHLH;uDHL9IGPHsH8|AŅuL!Z1ɺ_1H5\4]HApLEIH5\1\L1 H5T\\HA L<IH5\1\oL\Y1ɺ:1H5[o\[AT$LE1nLLM)DIDIDAD9(IDE$H[D EuIDEuL L;GIIAH5"LHHBHDTLHIDIQ1DLLLBXAL.IyH0H;HHCH5ZHHBHDKDHHS1DLLBXA@H{?AWLMLwHLHDžESHL>LrW1ɺH5ZZIMHxHHIt HtHLH)H)HHH;waLW1ɺ1H5YZnoLVLTIH5gY1YLV1ɺALfL1H޿LtVYAT$LI$LlAM҉ALLL6V1ɺH5XKYHLALHIymLuWISH5|X1XZY1ɺrE1LUH5LXXHHALHIyLVIS1ɺE1LFUH5WgXAfATUHSḤHmAHEL%HLmAHEtmH5wHsmAHEtSH5fHYmALEt9HcHHAEHD$8dH+%(uFH@DA\fBT@LL1ɺ 1H5pOeAWAVAUATU1SHHHH$Ht$T$0D$L$4LD$(LL$ u LMHtxHD$D$HHD$@EH[HtH;uLKAY<@tUEtL!1ɺ3 1H5oNH[HuE1H$AHHD[]A\A]A^A_@AyUEuAy*MymHD$LHD$L9LH\$8LIfDHI9HsLcuH\$8Ht>LuL9IvLct!DM6L9IvLpcuH$Pt$H$1LdD$f.ELx1ɺ, H5gnM\L1ɺ% 1H5Cn_M3f.E LȰ1ɺ< 1H5 n&MAH$HtfHD$L|$LM9HED$H\$8HMfH9IfDMmL9IuLbuHD$H|$ H@@~HHHH9HBHLѰ` ATL$@QPDL$TH5m1A)LH ZM6M9DH\$8D$fHD$LL;t$DD$Et)IvH$1M6L9t$H$1H5ЃuLUAƺI H5[lwKIMID H\$8.H$1H5%oVLAƺl H5kKGD$HL$(H Ht&HI@H)HHH9HRHtHHt H9tLIL w RLsZ AT1H5`kAvJXZHXw LAƺq H5"k>JsHtHI@HHHtyH9ttHRHtHHt H9tHAHv RMLP] MLAƺN H5jIHv Hv HD$H|$ Hx@tIHHHH9H@HL׭ AWL$@QPDL$T$uhHL$(HAHt&HQ@HHHH9H@HtjHHtbH9t]HRPMLR| AvL HHD$(Ht Hx@~vIRL{y AWH{u Hru Hfu pATE1E11SHH1AHjSjH t HD[A\fAHC011C8LD H5hGHD[A\fAVAUATIUSLA8H1LsQL=IHL5?v LWLHWLHlHLOIHtd1HHS1MLH@HLDxi[L]A\A]A^DNIHtL[]A\A]A^L1H5Ff.L=H51E1Fk@ATIIUSHHH?dH%(H$1HHCHzVLHXHNHts9ud@H$dH+%(H[]A\DH$HxHHHHLHLHH) H)։Hf$tTfT@1LbH5PE1UD$ۉTT@H-HiMSH1UDL 1LW>XZLPhLHL k fH 2sSSG`Ht@gC`HcCXt9 ~H {TJHCT[ÐHHt H9L j 1L:CH5)`=C`gC`HcCXuHHH9LHL1[JH5_4=@QHHtQH9tLLHH1Lˉ1RH5_Q"HIL18IFPj1ɋ$xALH8RDL$LAZA[Aą?AGaL衲Hŋ ކ L L{E"H޿HLDH1U8AXAYIHdL9[LH1L 1ɺ H5[Z7AwXH=K 1LAG`DII HHD$1Ld$HD$Mu'HT$HD$HHT$I9HI9s LH)HD$AT1LCtK8sH1H޺q"PH=L BPL]416Y^r=AGaLLd$Hl$Iŋ@ R2 t"L OLHzLDHATUAU=IFPHHHDL ,HxjALHXZ[Iŋ I "L LHLDHUATAUH޿1E15H AwXH== .L<E1 L ib @軯H>V1L{IQ"H޿1D5LI腯HIIFPHHDL ,Hxj@A]1ɺa"IXj1ATL5H޿4 b XZ0IE1I :L[212H5W24L2212H5.2d4AwXH= -L7L112H514AwXH= i-LEWIAWAVAUATUSHH $HE1H|$HHt$hHT$ L$`LD$xdH%(H$1H$HD$H$H$H$HD$@H$H$HH9tHAH9uL=U1LrL%3HD$ D$dD$tD$pL DH M,$1XL9d$ I|$G`%G`mLMIID$1҃H=D pX-I$ID$HBHH$ HD$I$H$ID$H$L(IL$ML9t$ I~G`%G`MIe83XID$HHHH9HJHP8QLRLMHIH I%A кP11I$ID$HBHID$IH` AYAZL9t$ tI~G`%G`71AL~L=1L$I$MHD$L;d$^H$HD$0@ID$HHH~H9uLJL1Lz~0It$D$pD$dN` HHHt"H$Ht`1|$`uID$H= pX)I|$JI$ID$HBHH$HD$@I$H$ID$H$L(L$Ll$IEML;l$;HD$ID$LD$011H= HDŽ$pX ,L$H$H|$(IpHL|0IL$HA8yXHHH % H1HH9LNHLLWRP15/Il$DŽ$H HD$he`Ht1H|$HHH Lt$(Ll$P11HD$8HD$Ld$XMAHLABELONEI9$ZEqID$H9It$ϦA;D$TEHIHuH|$Ll$PLd$XLD$8HL$(HL$Ht$M`LH|$HH HHP$HEHHH9H@HIL51P1L-ID$AZA[HHHH9LJL1LD{s-D$tD$d @HقL(I9I}HLHuMmHI9uDHEHH9H@H8I1PL1L,XZENIEH\$8AHD$EDHUHt_H9tZLJS1LLYP'1,Y^L iY @L YY @HIY N@L 9Y HEHt7H9t2LHHLL1S# ,_AXPL X L(1ɺ~1L+AHD$ L L9\$dLLlSD$|PD$1}+Y^HD$xHtHt$@L蒷H$dH+%(H[]A\A]A^A_fHEHt/H9t*LHL1ɺ/1L+@L W HH9LHHLW11RL*ID$AXAYHfDL W @HEHtOH9tJLHH;1SLLQ*XZf.H )W K@L W H W 1@L V 2@HEHtgH9tbLH=x xLL11)HHH蕏HHt8fC CL yV HEHt?H9t:LH11LDwLQ)uM`@L !V HEHtH9ueL V =w LL,11(HHHHHtdfC CtLHH $H5&)H=7)W6=fAVAUIATIUH8dH%(HD$(1D$ d>HLt$L`HL0LpHD$HD$MtAD$auA11LD$ LLHD$(dH+%(uTH8H]A\A]A^7f.At$XH=t /!LHD$(dH+%(u H8]A\A]A^=@AUIATIUHSH.tpI]I9uCDH̀A`I9t0HKA`tqXH= HKHA`̀A`I9uHLLH[E1]1A\A]%DH1ɺ?[L#H5I]A\A]&AUIATIUHSHD-t`I$I9u3DHI9t&HCHt@atpXH=/ HI9uHLLH[E1]1A\A]uDH1ɺ.[L#H5H]A\A]7&AWH(AVAUIATUSHH(HL$LD$HD$HtHHD$AuLHE1lHxHDuELH@IL$AUPA$ϻID$HHCAHXAELHxD9O;vHkHMLsLb5LD`D賞H|$DLHH=IELHxP5HlHPH_LD$MDLL Aą@L!1ɺ1H5D$IfD1ɺ E1Le!H5eE$LR!11 H5Ce$H(D[]A\A]A^A_LL$LrH5C1E1$$fLL$LD9wALL$LLL$L{DLL$L*[DH1Mt$ E1LH5B^#XZAVAAUIATUHSHGHHx*IHt>LDHH7t[L]A\A]A^DHCLE1Hx<LF1H57"AMDAWIAVMAUIATUDSH1HH8HHL$HL$dH%(HD$(1D$LT$HIFHP(LX(tJH@HHtAIL$@H9t7HIL$ LM\$@H<H94))4ID$0HLH uXMOIHCL9:H@H ME1P1LoH56!ZYIL$ H<1H9j1HL$ HCQHL$ QAKL\$QH QHHLWLQLV1PD$pH@L\$HIHHHHtH9tzHBM PL1AW H55AsAQLK H Mt t IL$` HD$(dH+%(H8L[]A\A]A^A_fDHqM Mt AMHHtHHt H9H8M M PL1AWH5351AsAQLK H ZfDHHt HHtH9uSHL HMPH54Lm1^_fHB_HBf.HyL 4ff.@ATSHH $HHHOdH%(H$1HIHHA-u.H$dH+%(HD[A\f{38t00I1PHL>PH521XZfD(1E1L҉H52q^3AWAVAUATUSH8H|$Ht$HT$(HHyD$$11H|$E1E1zfÀu_.IM ADA@tI"tD D$$tHD$(AAB _A]EHD$(D$$AAB EHH;D$s>HT$L,A]t,EL;d$s" jEaEE1HH;D$rH8[]A\A]A^A_fD$$fDUHH $HH |HcdH%(H$1HIHx+H+H$dH+%(u3H]L1ɺ1H52ATUSHH $H`H a9 HdH%(H$X1II@I IH\$PD$ AAHA 1H5gH3HHaLd$H¾@L+H1HT$ H5LQ)u 9\$D9d$AmDATL aL~S\$SAVVLQ1RP1^H@H=.!&8!$1LPHL sPL1XZjD&8#1LPHL .PLS1Y^ D#l$ fD;&8#1LPHO/LPL 1g_AX%8<#1ɺLPHBL PL1AYAZBq&AWAVAUATUSHH $HH $HHL-- HN'LdH%(H$8 1Ld$0L@~^ Y o  L.L|$, L5^"HH>fDH)HPLH9uAyt@9uAA9u Ayt@1HT$(LLLL $L $1L|H5rHF)HvDH&H$8 dH+%(HH []A\A]A^A_H= H] H@Htf.HH@Hu@H{ ,HCHHH@HufDD$,HcD$(H='] AЉD$HH IcDD$H H%H ‰HT$$|4$DD$HH3,VfDC#8 M1ɺPHL P1H5jqoXZ;H[Huf.H$0L[ fH=)\ D$HHactivate/activate.cGetting target version for %sFound %s target v%u.%u.%u./usr/sbin/modprobe%smodule/dm_%sModule directory %s exists./lib/modules%s/%s/modules.builtin%s: %s failed: %skvdodm-%sfcloseInterrupted...misc/lvm-signal.cLogical volume %s in use.metadata/snapshot_manip.cactivate/dev_manager.csnapshotthin-poolChecking device id for LV %s.%*u:%*u %u (no device driver)Counted %d open LVs in VG %s.Found active component LV %s.Found active holder LV %s. [Test mode: skipping this]Not mSkipping %smonitor of %s.%s%s already monitored.Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%s temporary noscanmetadata/raid_manip.cSkipping: Activating %s.Activating %s%s%s%s%s.LV %s is already active.No host tag matches %slocking for suspendunlocking on resumeGetting driver versiondevice_mapper/libdm-common.cFailed to get driver versioncache/lvmcache.c#orphansbase/data-struct/list.chead->ndevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstis not used foris used forhas nohasis notis not inis inlvmcache label scan beginResolving duplicate devicesPV %s: %s %s dm. %s %s dm.PV %s: %s %s LV. %s %s LV.Adding chosen duplicate %slvmcache label scan doneno longerdevice cannot be useddevice not founddevice is a duplicate[unknown](root)How LVM uses block devices. allocationshellHost tag settings. abort_on_errorsprofile_dirdevice_id_sysfs_dir/sys/#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfile@DEFAULT_USE_DEVICES_FILE@system.devicesdevicesfile_backup_limitsearch_for_devnamesdevice_ids_refreshdevice_ids_refresh_checks#Sproduct_uuid#Shostname#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_modecache_policycache_settingspolicy_settingscache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogjournaloverwritelevelindentcommand_namesactivate_filedebug_classesdebug_file_fieldsdebug_output_fieldsbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasktestunitssi_unit_consistencysuffixfallback_to_lvm1format_librariessegment_libraries/proc@DEFAULT_PROC_DIR@Location of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_defaultraid1@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activation@DEFAULT_EVENT_ACTIVATION@use_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendlvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_restore_executable/usr/sbin/thin_restore@THIN_RESTORE_CMD@thin_check_optionsthin_repair_options#Sthin_restore_optionsthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_restore_executable/usr/sbin/cache_restore@CACHE_RESTORE_CMD@cache_check_optionscache_repair_optionscache_restore_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeerror_when_fullreadaheadraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallmonitoringpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatacopiesvgmetadatacopiespvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colsalignedbufferedheadingslist_item_separatorprefixesquotedcolumns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagshost_listsystem_idextra_system_idshost_idmodule string allocation failedsnap_seg module string allocation failed%s configuration setting defined: Checking the list to match %s.No item supplied in %s configuration setting matches %s.Ignoring invalid string in config file %s.Ignoring empty string in config file %s.Ignoring empty tag in config file %sactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionModules path %s/%s/modules.builtin is too long.Found %s as built-in kernel module.module_present module name too long: %sInternal error: Target present version called when activation is disabled.Found suspended LV %s in critical section().Found suspended layered LV %s in critical section().Snapshot merge is in progress, querying status of %s instead.Logical volume %s is used by another device.Logical volume %s contains a filesystem in use.Retrying open_count check for %s.Checking snapshot percent for LV %s.Internal error: Cannot get origin from snapshot %s.Checking mirror percent for LV %s.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Checking raid data offset and dev sectors for LV %s/%sChecking raid device health for LV %s.Checking raid mismatch count for LV %s.Checking raid sync_action for LV %s.Unable to send message to an inactive logical volume.Internal error: %s is not a writecache logical volume.Internal error: Cannot check status for unused cache pool %s.Cannot check status for deleted cache volume %s.Checking status for cache volume %s.Checking thin pool status for LV %s.More then one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Preloading detached hidden volume %s as visible volume %s.Cannot determine activation status of %s%s.Counted %d active LVs in VG %sRAID module does not support RAID4. Cache pool activation for clearing only.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.WARNING: Failed to %smonitor %s.WARNING: %s: segment unmonitoring failed.WARNING: %s: %s segment monitoring function failed.%s %smonitoring still pending: waiting...WARNING: %sonitoring %s failed.Cannot deactivate logical volume %s.Cannot deactivate subvolume %s of logical volume %s.Activation of logical volume %s is prohibited while logical volume %s is active.activation/volume_list configuration setting not defined: Checking only host tags for %s.Not activating %s since it does not pass activation filter.No degraded or partial activation for raid with integrity.Integrity must be removed before degraded or partial activation of raid.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Cannot use partial or degraded activation with writecache.Refusing activation of RAID LV %s with visible SubLVs.Refusing activation of LV %s containing an unrecognised segment.WARNING: lookup found duplicate VGID %s for VGs %s and %s.Internal error: vginfo_lookup %s has_duplicate_local_vgname.vginfo_lookup %s has_duplicate_local_vgname return none.vgnameid_list allocation failed.vgnameid_list member allocation failed.Skip multipath component checks with single device for PVID %sDifferent wwids for duplicate PVs %s %s %s noneDifferent wwids for duplicate PVs %s %s %s %sFound multiple multipath devices for PVID %s WWID %s: %s %s.Same wwids for duplicate PVs %s %sFound multipath device %s for PVID %s WWID %s.Using multipath device %s for PVID %s.Ignoring multipath component %s with PVID %s (dropping info)Ignoring multipath component %s with PVID %s (dropping duplicate)Found multiple md devices for PVID %s: %s %sFound md device %s for PVID %s.Using md device %s for PVID %s.Ignoring md component %s with PVID %s (dropping info)Ignoring md component %s with PVID %s (dropping duplicate)PV %s with duplicates unselected using %s.PV %s with duplicates unselected comparing alternativesPV %s with duplicates comparing alternatives for %sPV %s compare duplicates: %s %u:%u. %s %u:%u. device_hint %s.PV %s: size %llu. %s is %llu. %s is %llu.PV %s: %s %s subsystem. %s %s subsystem.PV %s: %s %s mounted fs. %s %s mounted fs.PV %s with duplicates will use %s.Internal error: PV %s with duplicates no alternate list entry for %sPV %s with duplicates will change from %s to %s.PV %s with duplicates will continue using %s.Dropping unchosen duplicate %sWARNING: Not using device %s for PV %s.WARNING: PV %s prefers device %s because %s.PV %s: device_id %s. %s is %s. %s is %s.Checking for multipath components for duplicate PVID %s_lvmcache_update: vgid hash insertion failed: %slvmcache %s: VG %s: set VGID to %.32s.Internal error: NULL vgname handed to cacheFailed to update VG %s info in lvmcache.lvmcache %s mda%d VG %s set seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s older seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s newer seqno %u checksum %x mda_size %zuWARNING: scan of VG %s from %s mda%d found mda_checksum %x mda_size %zu vs %x %zulvmcache %s: VG %s %s exported.cache creation host alloc failed for %s.lvmcache %s: VG %s: set creation host to %s.cache lock_type alloc failed for %slvmcache %s: VG %s: set lock_type to %s.cache system_id alloc failed for %slvmcache %s: VG %s: set system_id to %s.How LVM configuration settings are handled. How LVM selects space and applies properties to LVs. How LVM log information is reported. How LVM metadata is backed up and archived. In LVM, a 'backup' is a copy of the metadata for the current system, and an 'archive' contains old metadata configurations. They are stored in a human readable text format. Settings for running LVM in shell (readline) mode. Miscellaneous global LVM settings. LVM report command output formatting. Settings for the LVM event daemon. LVM settings that are specific to the local host. If enabled, any LVM configuration mismatch is reported. This implies checking that the configuration key is understood by LVM and that the value of the key is the proper type. If disabled, any configuration mismatch is ignored and the default value is used without any warning (a message about the configuration key not being found is issued in verbose mode only). Abort the LVM process if a configuration mismatch is found. Directory where LVM looks for configuration profiles. Directory in which to create volume group device nodes. Commands also accept this as a prefix on volume group names. Location of sysfs for finding device ids (for testing.) Directories containing device nodes to use with LVM. Obtain the list of available devices from udev. This avoids opening or using any inapplicable non-block devices or subdirectories found in the udev directory. Any device node or symlink not managed by udev in the udev directory is ignored. This setting applies only to the udev-managed device directory; other directories will be scanned fully. LVM needs to be compiled with udev support for this setting to apply. Enable device information from udev. If set to "udev", lvm will supplement its own native device information with information from libudev. This can potentially improve the detection of MD component devices and multipath component devices. Use a local file to remember which devices have PVs on them. Some commands will use this as an optimization to reduce device scanning, and will only scan the listed PVs. Removing the hint file will cause lvm to generate a new one. Disable hints if PVs will be copied onto devices using non-lvm commands, like dd. # Accepted values: all Use all hints. none Use no hints. # Select which path name to display for a block device. If multiple path names exist for a block device, and LVM needs to display a name for the device, the path names are matched against each item in this list of regular expressions. The first match is used. Try to avoid using undescriptive /dev/dm-N names, if present. If no preferred name matches, or if preferred_names are not defined, the following built-in preferences are applied in order until one produces a preferred name: Prefer names with path prefixes in the order of: /dev/mapper, /dev/disk, /dev/dm-*, /dev/block. Prefer the name with the least number of slashes. Prefer a name that is a symlink. Prefer the path with least value in lexicographical order. # Example preferred_names = [ "^/dev/mpath/", "^/dev/mapper/mpath", "^/dev/[hs]d" ] # Enable or disable the use of a devices file. When enabled, lvm will only use devices that are lised in the devices file. A devices file will be used, regardless of this setting, when the --devicesfile option is set to a specific file name. The name of the system devices file, listing devices that LVM should use. This should not be used to select a non-system devices file. The --devicesfile option is intended for alternative devices files. The max number of backup files to keep in /etc/lvm/devices/backup. LVM creates a backup of the devices file each time a new version is created, or each time a modification is detected. When the max number of backups is reached, the oldest are removed to remain at the limit. Set to 0 to disable backups. Only the system devices file is backed up. Look outside of the devices file for missing devname entries. A devname entry is used for a device that does not have a stable device id, e.g. wwid, so the unstable device name is used as the device id. After reboot, or if the device is reattached, the device name may change, in which case lvm will not find the expected PV on the device listed in the devices file. This setting controls whether lvm will search other devices, outside the devices file, to look for the missing PV on a renamed device. If "none", lvm will not look at other devices, and the PV may appear to be missing. If "auto", lvm will look at other devices, but only those that are likely to have the PV. If "all", lvm will look at all devices on the system. Find PVs on new devices and update the device IDs in the devices file. If PVs are restored or moved to a new system with new devices, but an old system.devices remains with old device IDs, then search for the PVIDs on new devices and update the device IDs in system.devices. The original device IDs must also not be found on the new system. See device_ids_refresh_check for conditions that trigger the refresh. Conditions that trigger device_ids_refresh to locate PVIDs on new devices. product_uuid: refresh if /sys/devices/virtual/dmi/id/product_uuid does not match the value saved in system.devices. hostname: refresh if hostname does not match the value saved in system.devices. (hostname is used if product_uuid is not available.) Remove values from this list to prevent lvm from using them. Limit the block devices that are used by LVM commands. This is a list of regular expressions used to accept or reject block device path names. Each regex is delimited by a vertical bar '|' (or any character) and is preceded by 'a' to accept the path, or by 'r' to reject the path. The first regex in the list to match the path is used, producing the 'a' or 'r' result for the device. When multiple path names exist for a block device, if any path name matches an 'a' pattern before an 'r' pattern, then the device is accepted. If all the path names match an 'r' pattern first, then the device is rejected. Unmatching path names do not affect the accept or reject decision. If no path names for a device match a pattern, then the device is accepted. Be careful mixing 'a' and 'r' patterns, as the combination might produce unexpected results (test changes.) Run vgscan after changing the filter to regenerate the cache. # Example Accept every block device: filter = [ "a|.*|" ] Reject the cdrom drive: filter = [ "r|/dev/cdrom|" ] Work with just loopback devices, e.g. for testing: filter = [ "a|loop|", "r|.*|" ] Accept all loop devices and ide drives except hdc: filter = [ "a|loop|", "r|/dev/hdc|", "a|/dev/ide|", "r|.*|" ] Use anchors to be very specific: filter = [ "a|^/dev/hda8$|", "r|.*|" ] # Limit the block devices that are used by LVM system components. Because devices/filter may be overridden from the command line, it is not suitable for system-wide device filtering, e.g. udev. Use global_filter to hide devices from these LVM system components. The syntax is the same as devices/filter. Devices rejected by global_filter are not opened by LVM. List of additional acceptable block device types. These are of device type names from /proc/devices, followed by the maximum number of partitions. # Example types = [ "fd", 16 ] # Restrict device scanning to block devices appearing in sysfs. This is a quick way of filtering out block devices that are not present on the system. sysfs must be part of the kernel and mounted.) Allow LVM LVs to be used as PVs. When enabled, LVM commands will scan active LVs to look for other PVs. Caution is required to avoid using PVs that belong to guest images stored on LVs. When enabled, the LVs scanned should be restricted using the devices file or the filter. This option does not enable autoactivation of layered VGs, which requires editing LVM udev rules (see LVM_PVSCAN_ON_LVS.) Ignore devices that are components of DM multipath devices. The path to the multipath wwids file used for multipath component detection. Set this to an empty string to disable the use of the multipath wwids file. Enable detection and exclusion of MD component devices. An MD component device is a block device that MD uses as part of a software RAID virtual device. When an LVM PV is created on an MD device, LVM must only use the top level MD device as the PV, and should ignore the underlying component devices. In cases where the MD superblock is located at the end of the component devices, it is more difficult for LVM to consistently identify an MD component, see the md_component_checks setting. The checks LVM should use to detect MD component devices. MD component devices are block devices used by MD software RAID. # Accepted values: auto LVM will skip scanning the end of devices when it has other indications that the device is not an MD component. start LVM will only scan the start of devices for MD superblocks. This does not incur extra I/O by LVM. full LVM will scan the start and end of devices for MD superblocks. This requires an extra read at the end of devices. # Ignore devices that are components of firmware RAID devices. LVM must use an external_device_info_source other than none for this detection to execute. Align the start of a PV data area with md device's stripe-width. This applies if a PV is placed directly on an md device. default_data_alignment will be overridden if it is not aligned with the value detected for this setting. This setting is overridden by data_alignment_detection, data_alignment, and the --dataalignment option. Align the start of a PV data area with this number of MiB. Set to 1 for 1MiB, 2 for 2MiB, etc. Set to 0 to disable. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with sysfs io properties. The start of a PV data area will be a multiple of minimum_io_size or optimal_io_size exposed in sysfs. minimum_io_size is the smallest request the device can perform without incurring a read-modify-write penalty, e.g. MD chunk size. optimal_io_size is the device's preferred unit of receiving I/O, e.g. MD stripe width. minimum_io_size is used if optimal_io_size is undefined (0). If md_chunk_alignment is enabled, that detects the optimal_io_size. default_data_alignment and md_chunk_alignment will be overridden if they are not aligned with the value detected for this setting. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with this number of KiB. When non-zero, this setting overrides default_data_alignment. Set to 0 to disable, in which case default_data_alignment is used to align the first PE in units of MiB. This setting is overridden by the --dataalignment option. data_alignment_offset_detectionShift the start of an aligned PV data area based on sysfs information. After a PV data area is aligned, it will be shifted by the alignment_offset exposed in sysfs. This offset is often 0, but may be non-zero. Certain 4KiB sector drives that compensate for windows partitioning will have an alignment_offset of 3584 bytes (sector 7 is the lowest aligned logical block, the 4KiB sectors start at LBA -1, and consequently sector 63 is aligned on a 4KiB boundary). This setting is overridden by the --dataalignmentoffset option. Ignore DM devices that have I/O suspended while scanning devices. Otherwise, LVM waits for a suspended device to become accessible. This should only be needed in recovery situations. Do not scan 'mirror' LVs to avoid possible deadlocks. This avoids possible deadlocks when using the 'mirror' segment type. This setting determines whether LVs using the 'mirror' segment type are scanned for LVM labels. This affects the ability of mirrors to be used as physical volumes. If this setting is enabled, it is impossible to create VGs on top of mirror LVs, i.e. to stack VGs on mirror LVs. If this setting is disabled, allowing mirror LVs to be scanned, it may cause LVM processes and I/O to the mirror to become blocked. This is due to the way that the mirror segment type handles failures. In order for the hang to occur, an LVM command must be run just after a failure and before the automatic LVM repair process takes place, or there must be failures in multiple mirrors in the same VG at the same time with write failures occurring moments before a scan of the mirror's labels. The 'mirror' scanning problems do not apply to LVM RAID types like 'raid1' which handle failures in a different way, making them a better choice for VG stacking. Allow use of pvcreate --uuid without requiring --restorefile. Minimum size in KiB of block devices which can be used as PVs. In a clustered environment all nodes must use the same value. Any value smaller than 512KiB is ignored. The previous built-in value was 512. Issue discards to PVs that are no longer used by an LV. Discards are sent to an LV's underlying physical volumes when the LV is no longer using the physical volumes' space, e.g. lvremove, lvreduce. Discards inform the storage that a region is no longer used. Storage that supports discards advertise the protocol-specific way discards should be issued by the kernel (TRIM, UNMAP, or WRITE SAME with UNMAP bit set). Not all storage will support or benefit from discards, but SSDs and thinly provisioned LUNs generally do. If enabled, discards will only be issued if both the storage and kernel provide support. allow_changes_with_duplicate_pvsAllow VG modification while a PV appears on multiple devices. When a PV appears on multiple devices, LVM attempts to choose the best device to use for the PV. If the devices represent the same underlying storage, the choice has minimal consequence. If the devices represent different underlying storage, the wrong choice can result in data loss if the VG is modified. Disabling this setting is the safest option because it prevents modifying a VG or activating LVs in it while a PV appears on multiple devices. Enabling this setting allows the VG to be used as usual even with uncertain devices. Allow PVs in the same VG with different logical block sizes. When allowed, the user is responsible to ensure that an LV is using PVs with matching block sizes when necessary. Advise LVM which PVs to use when searching for new space. When searching for free space to extend an LV, the 'cling' allocation policy will choose space on the same PVs as the last segment of the existing LV. If there is insufficient space and a list of tags is defined here, it will check whether any of them are attached to the PVs concerned and then seek to match those PV tags between existing extents and new extents. # Example Use the special tag "@*" as a wildcard to match any PV tag: cling_tag_list = [ "@*" ] LVs are mirrored between two sites within a single VG, and PVs are tagged with either @site1 or @site2 to indicate where they are situated: cling_tag_list = [ "@site1", "@site2" ] # Use a previous allocation algorithm. Changes made in version 2.02.85 extended the reach of the 'cling' policies to detect more situations where data can be grouped onto the same disks. This setting can be used to disable the changes and revert to the previous algorithm. Use blkid to detect and erase existing signatures on new PVs and LVs. The blkid library can detect more signatures than the native LVM detection code, but may take longer. LVM needs to be compiled with blkid wiping support for this setting to apply. LVM native detection code is currently able to recognize: MD device signatures, swap signature, and LUKS signatures. To see the list of signatures recognized by blkid, check the output of the 'blkid -k' command. wipe_signatures_when_zeroing_new_lvsLook for and erase any signatures while zeroing a new LV. The --wipesignatures option overrides this setting. Zeroing is controlled by the -Z/--zero option, and if not specified, zeroing is used by default if possible. Zeroing simply overwrites the first 4KiB of a new LV with zeroes and does no signature detection or wiping. Signature wiping goes beyond zeroing and detects exact types and positions of signatures within the whole LV. It provides a cleaner LV after creation as all known signatures are wiped. The LV is not claimed incorrectly by other tools because of old signatures from previous use. The number of signatures that LVM can detect depends on the detection code that is selected (see use_blkid_wiping.) Wiping each detected signature must be confirmed. When this setting is disabled, signatures on new LVs are not detected or erased unless the --wipesignatures option is used directly. mirror_logs_require_separate_pvsMirror logs and images will always use different PVs. The default setting changed in version 2.02.85. Stripe across all PVs when RAID stripes are not specified. If enabled, all PVs in the VG or on the command line are used for raid0/4/5/6/10 when the command does not specify the number of stripes to use. This was the default behaviour until release 2.02.162. cache_pool_metadata_require_separate_pvsCache pool metadata and data will always use different PVs. This has been replaced by the allocation/cache_mode setting. Sets default metadata format for new cache. # Accepted values: 0 Automatically detected best available format 1 Original format 2 Improved 2nd. generation format # The default cache mode used for new cache. # Accepted values: writethrough Data blocks are immediately written from the cache to disk. writeback Data blocks are written from the cache back to disk after some delay to improve performance. # This setting replaces allocation/cache_pool_cachemode. The default cache policy used for new cache volume. Since kernel 4.2 the default policy is smq (Stochastic multiqueue), otherwise the older mq (Multiqueue) policy is selected. Settings for the cache policy. See documentation for individual cache policies for more info. Replace this subsection name with a policy name. Multiple subsections for different policies can be created. The minimal chunk size in KiB for cache pool volumes. Using a chunk_size that is too large can result in wasteful use of the cache, where small reads and writes can cause large sections of an LV to be mapped into the cache. However, choosing a chunk_size that is too small can result in more overhead trying to manage the numerous chunks that become mapped into the cache. The former is more of a problem than the latter in most cases, so the default is on the smaller end of the spectrum. Supported values range from 32KiB to 1GiB in multiples of 32. The maximum number of chunks in a cache pool. For cache target v1.9 the recommended maximumm is 1000000 chunks. Using cache pool with more chunks may degrade cache performance. thin_pool_metadata_require_separate_pvsThin pool metadata and data will always use different PVs. Older version of lvm2 cropped pool's metadata size to 15.81 GiB. This is slightly less then the actual maximum 15.88 GiB. For compatibility with older version and use of cropped size set to 1. Thin pool data chunks are zeroed before they are first used. Zeroing with a larger thin pool chunk size reduces performance. The discards behaviour of thin pool volumes. # Accepted values: ignore nopassdown passdown # The chunk size calculation policy for thin pool volumes. # Accepted values: generic If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size based on estimation and device hints exposed in sysfs - the minimum_io_size. The chunk size is always at least 64KiB. performance If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size for performance based on device hints exposed in sysfs - the optimal_io_size. The chunk size is always at least 512KiB. # Zero whole metadata area before use with thin or cache pool. The minimal chunk size in KiB for thin pool volumes. Larger chunk sizes may improve performance for plain thin volumes, however using them for snapshot volumes is less efficient, as it consumes more space and takes extra time for copying. When unset, lvm tries to estimate chunk size starting from 64KiB. Supported values are in the range 64KiB to 1GiB. Default physical extent size in KiB to use for new VGs. Enables or disables compression when creating a VDO volume. Compression may be disabled if necessary to maximize performance or to speed processing of data that is unlikely to compress. Enables or disables deduplication when creating a VDO volume. Deduplication may be disabled in instances where data is not expected to have good deduplication rates but compression is still desired. Enables or disables whether VDO volume should tag its latency-critical writes with the REQ_SYNC flag. Some device mapper targets such as dm-raid5 process writes with this flag at a higher priority. The minimum IO size for VDO volume to accept, in bytes. Valid values are 512 or 4096. The recommended value is 4096. Specifies the amount of memory in MiB allocated for caching block map pages for VDO volume. The value must be a multiple of 4096 and must be at least 128MiB and less than 16TiB. The cache must be at least 16MiB per logical thread. Note that there is a memory overhead of 15%. The speed with which the block map cache writes out modified block map pages. A smaller era length is likely to reduce the amount time spent rebuilding, at the cost of increased block map writes during normal operation. The maximum and recommended value is 16380; the minimum value is 1. Deprecated option to set default check point frequency for VDO volume. Enables sparse indexing for VDO volume. Specifies the amount of index memory in MiB for VDO volume. The value must be at least 256MiB and at most 1TiB. Specifies the size in MiB of the increment by which a VDO is grown. Using a smaller size constrains the total maximum physical size that can be accommodated. Must be a power of two between 128MiB and 32GiB. Specifies the number of threads to use for acknowledging completion of requested VDO I/O operations. The value must be at in range [0..100]. Specifies the number of threads to use for submitting I/O operations to the storage device of VDO volume. The value must be in range [1..100]. Each additional thread after the first will use an additional 18MiB of RAM, plus 1.12 MiB of RAM per megabyte of configured read cache size. Specifies the number of I/O operations to enqueue for each bio-submission thread before directing work to the next. The value must be in range [1..1024]. Specifies the number of threads to use for CPU-intensive work such as hashing or compression for VDO volume. The value must be in range [1..100]. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. The value must be at in range [0..100]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. A logical thread count of 9 or more will require explicitly specifying a sufficiently large block map cache size, as well. The value must be in range [0..60]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on physical block addresses. Each additional thread after the first will use an additional 10MiB of RAM. The value must be in range [0..16]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the write policy: auto - VDO will check the storage device and determine whether it supports flushes. If it does, VDO will run in async mode, otherwise it will run in sync mode. sync - Writes are acknowledged only after data is stably written. This policy is not supported if the underlying storage is not also synchronous. async - Writes are acknowledged after data has been cached for writing to stable storage. Data which has not been flushed is not guaranteed to persist in this mode. async-unsafe - Writes are handled like 'async' but there is no guarantee of the atomicity async provides. This mode should only be used for better performance when atomicity is not required. Specified the maximum size of discard bio accepted, in 4096 byte blocks. I/O requests to a VDO volume are normally split into 4096-byte blocks, and processed up to 2048 at a time. However, discard requests to a VDO volume can be automatically split to a larger size, up to 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the empty header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. For more information about selection criteria in general, see lvm(8) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metadata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Disable event based autoactivation commands. WARNING: setting this to zero may cause machine startup to fail. Previously, setting this to zero would enable static autoactivation services (via the lvm2-activation-generator), but the autoactivation services and generator have been removed. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin pool metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_restore command. LVM uses this command to restore generated data for a thin pool metadata device. Also see thin_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. List of options passed to the thin_restore command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_restore command. LVM uses this command to restore generated data for a cache metadata device. Also see cache_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. List of options passed to the cache_restore command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename, version4 # Example vdo_disabled_features = [ "online_rename", "version4" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID. (appmachineid is recommended to avoid exposing the confidential machine-id.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Memory size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronizing or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, radid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over log/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. json_std JSON format that is more compliant with JSON standard. Compared to original "json" format: - it does not use double quotes around numeric values, - it uses 'null' for undefined numeric values, - it prints string list as proper JSON array of strings instead of a single string. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Format of LVM command's report output headings. Accepted values: 0 no headings, 1 headings with column abbreviations, 2 headings with full column names. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as adecimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The lvmlockd sanlock host_id. This must be unique among all hosts, and must be between 1 and 2000. Applicable only if LVM is compiled with lockd support dm_list_addחA Setting %scache_segtype/cache.ccommands/toolcontext.cSetting host tag: %swritecache/writecache.cwritecachewritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agepause_writebackwritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %umetadata_only = %upause_writeback = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"integrity/integrity.cdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %lludevice_mapper/libdm-deptree.cNo integrity meta uuid.queue/daxLV %s dev %s is pmem.metadata/metadata.cLV %s dev %s not pmem.LV %s on pmemrealmisc/lvm-string.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitchunk_size = %ucache_mode = "%s"metadata = "%s"metadata_format = %ucache_pool = "%s"cleaner = 1metadata_start = %lumetadata_len = %lumetadata_id = "%s" Chunk size %s Metadata format %u Mode %s Policy %sdevice_mapper/libdm-config.ccache_pool_corigmetadata_startmetadata_lenmetadata_idCache supports %s.SMQMissing cache's data uuid %s.migration_thresholdfilelinemessagelvmcache %s: now in VG %s %slocalhostWARNING: %s: fopen failed: %sLVM_SUPPRESS_SYSLOGmisc/lvm-globals.cLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINES%s%s%s failed: %sLogging initialised at %sLVM_ configuration invalid.host_filterhost_filter not supported yet%s/lvm%s%s.confFailed to create config treeprofile_params alloc failedraid/raid.cthin/thin.cInitialised segtype: %scache-poolvdo/vdo.cvdo-poolInitialised segtypes: %s, %s._init_hostnameunamearchive_init failed.backup_init failed./run/lvm/lvmpolld.socketLVM_LVMPOLLD_SOCKETdevice_mapper/mm/pool.c [%p] %s/dev/Ignoring %s: %s.device/dev-cache.cIgnoring %s: Not a directory.dir_list allocation failedReloading config files and aliases cache-mqsequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustmentDuplicate segment type %s: unloading shared library %s_set_tag: str_list_add %s failedorigin not specified in segment %s of logical volume %s.origin must be a string in segment %s of logical volume %s.Unknown LV specified for writecache origin %s in segment %s of logical volume %s.writecache not specified in segment %s of logical volume %s.writecache must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for writecache in segment %s of logical volume %s.writecache block_size must be set in segment %s of logical volume %s.Unknown writecache_setting in segment %s of logical volume %s.dm-writecache module version older than minimum 1.0.0Integrity target version older than minimum 1.6.0String list allocation failed for writecache module.String list allocation failed for integrity module.String list allocation failed for cache module.Internal error: Passed segment is not integrity._integrity_add_target_line zero sizeMissing integrity's meta uuid %s.Missing integrity's origin uuid %s.Internal error: Passed segment is not writecache.Internal error: Passed segment has no writecache.WARNING: ignoring writecache setting "cleaner" which is not supported by kernel for LV %s.WARNING: ignoring writecache setting "max_age" which is not supported by kernel for LV %s.Invalid mix of cache device types in %s.Failed to build LVM dlid for %s.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Unknown LV specified for integrity origin %s in segment %s of logical volume %s.integrity data_sectors must be set in segment %s of logical volume %s.integrity mode must be set in segment %s of logical volume %s.integrity mode invalid in segment %s of logical volume %s.integrity tag_size must be set in segment %s of logical volume %s.integrity block_size invalid in segment %s of logical volume %s.integrity internal_hash must be set in segment %s of logical volume %s.integrity internal_hash failed to be set in segment %s of logical volume %s.meta_dev must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for integrity in segment %s of logical volume %s.integrity recalculate error in segment %s of logical volume %s.Unknown integrity_setting in segment %s of logical volume %s.Cache pool %s is missing cache policy, using %s.Cache pool %s uses implicit metadata format %u.Cache pool %s is missing cache mode, using %s.Internal error: Incorrect policy_settings tree, %s.Internal error: LV %s is using unknown cache metadada format %u.Couldn't read cache chunk_size in segment %s of logical volume %s.WARNING: Ignoring unsupported value for %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.policy must be a string in segment %s of logical volume %s.Failed to duplicate policy in segment %s of logical volume %s.policy_settings must have a policy_name in segment %s of logical volume %s.policy_settings must be a section in segment %s of logical volume %s.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Unknown cache metadata format %u number in segment %s of logical volume %s.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Could not read cache cleaner in segment %s of logical volume %s.Couldn't read cache metadata_format in segment %s of logical volume %s.Couldn't read metadata_start in segment %s of logical volume %s.Couldn't read metadata_len in segment %s of logical volume %s.Couldn't read data_start in segment %s of logical volume %s.Couldn't read data_len in segment %s of logical volume %s.Couldn't allocate metadata_id in segment %s of logical volume %s.Couldn't read metadata_id in segment %s of logical volume %s.Couldn't format metadata_id in segment %s of logical volume %s.Couldn't allocate data_id in segment %s of logical volume %s.Couldn't read data_id in segment %s of logical volume %s.Couldn't format data_id in segment %s of logical volume %s.WARNING: The cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache policy %s is available%s.Target %s does not support %s.Target %s %s support disabled by %sInternal error: Passed segment is not cache.cache_add_target_line lv %s pool %sInternal error: LV %s has unknown cache mode %d.LV %s has metadata format %u unsuported by kernel.Using metadata2 format for %s.Internal error: LV %s has unknown metadata format %u.Internal error: LV %s using unsupported ranges with cache pool.Internal error: LV %s has invalid ranges metadata %llu %llu data %llu %llu.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.WARNING: %s cache policy does not support "%s=%lu" setting, remove with 'lvchange --cachesettings "%s=default" ...'.Internal error: Unable to find configuration for log/%s.log/%s contains a value which is not a string. Ignoring.Unrecognised value for log/%s: %sInternal error: _destroy_config: cmd config tree not destroyed fullylvmcache adding vg list alloc failed %slvmcache adding vg name alloc failed %sWARNING: fix duplicate VGID %s for VGs %s and %s (see vgchange -u).Ignoring %s with conflicting VG info %s %s.lvmcache adding vginfo for %s %slvmcache adding vginfo found duplicate VG name %sInternal error: lvmcache_update_vgname %s %s %s %sWARNING: VG name %s is used by VGs %s and %s.Fix duplicate VG names with vgrename uuid, a device filter, or system IDs.lvmcache adding vginfo to name hash failed %slvmcache adding vg to name hash failed %sWARNING: Empty system ID supplied.WARNING: Invalid system ID format: %sWARNING: system ID may not begin with the string "localhost".WARNING: Failed to allocate system ID.WARNING: Ignoring extra line(s) in system ID file %s.TEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.WARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".Failed to obtain pid and starttime.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".Internal error: Unable to find configuration for log/debug_classes.log/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %dUnrecognised configuration setting for global/units: %sConfigured time format is empty string.Configured time format contains non-printable characters.Invalid time format "%s" supplied.Invalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failed_init_profiles: dm_strncpy failedFailed to allocate memory for %s segtypeFailed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtypeFailed to allocate memory for VDO segtypes.Failed to allocate memory for writecache segtypeFailed to allocate memory for integrity segtype_init_hostname: dm_pool_strdup kernel_vsn failed_init_hostname: dm_pool_strdup failedWARNING: Metadata changes will NOT be backed upReleasing activation in critical section.libdevmapper exiting with %d device(s) still suspended.device_mapper/ioctl/libdm-iface.cYou have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Unable to find configuration for devices/scan.Invalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheInternal error: Unprocessed pending delete for %d devices.raid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_6aAbBcCdDeFGghHIjklmMpPrRsStTuUVwWxXyYzZ%deHImMSuUVwWycCxXyYglobal/cache_disabled_featurescache@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@_get_config_node_version: couldn't create version stringInternal error: Profile %s already added as %s type, but requested type is %s._config_array_line: dm_pool_strdup failedPersistent cache directory name too long.Couldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.struct device allocation failedWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldUsing metadata size 960 KiB for non-standard page size %d.WARNING: async io still in flight.Limit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control blockDevice seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingFailed to add allias to dev cache.Couldn't add name to hash in dev cache.Failed to allocate configuration check handle.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.struct dm_str_list allocation failedInternal error: _cfg_def_make_path: supplied buffer too small for %s/%s%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. _get_def_array_values: strdup failedInternal error: Default array value malformed for "%s", value: "%s", token: "%s".Failed to create default empty array for %s.Failed to duplicate token for default array value of %s.Failed to create default config array value for %s.Internal error: inconsistent state reached in _check_value_differs_from_defaultFailed to create default config setting node.Internal error: _add_def_node: unknown typeFailed to create default config setting node value.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.WARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Internal error: %s cfg tree element not declared as boolean._log_array_value_used: failed to write node value%s not found in config: defaulting to %sInternal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeFailed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section._check_profile: profile check handle allocation failedInternal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Failed to allocate config source.Internal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.%s not found in config: defaulting to %ldWARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.bcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)concurrent write lock attemptedbcache failed to get block %u di %dref count on bcache block already zero_get_sysfs_value: %s: no valueDevice directory given in config file too longWARNING: unknown external device info source, using none.WARNING: failed to init udev for external device info, using none.WARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationDM_DISABLE_UDEV environment variable set.Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.manage logical volume symlinks in device directoryLVM activation checks disabledWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %ldKB, using default %dKB.WARNING: local/system_id is set, so should global/system_id_source be "lvmlocal" not "%s"?WARNING: sd_id128_get_machine_app_specific() failed %s (%d).%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xWARNING: Unrecognised system_id_source "%s".WARNING: No system ID found from system_id_source %s.%sdevices/virtual/dmi/id/product_uuid_insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache.%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.Found dev %d:%d %s - exists. %.8sCouldn't insert device into binary tree.Found dev %d:%d %s - new alias.Found dev %d:%d %s - existing device, path was previously %d:%d.Found dev %d:%d %s - new device, path was previously %d:%d.Found dev %d:%d %s - failed to use.Creating list of system devices.WARNING: Cannot use dir %s, %s.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyconfig/config.cdatastruct/btree.cdevice/bcache.cio_destroyWARNING: %s failed: %s.misaligned data bufferio_geteventsunable to allocate sync_iodisk/lstat/dev/nvmeLVM-%s is not a regular file%s is emptyfilename strdup failed<#option%s# Configuration %s %s. %s# %s%s#%s%s - %s%s%s%s%s%s%s # %.*s%s%s section integer float stringSetting %s to %sUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cachedatastruct/str_list.cstr_list allocation failedfgetsSet umask from %04o to %04o%s/%s/mounts_get_sysfs_dir fopensysfsDM_DISABLE_UDEVLVM will %s.LVM activation checks enabled/dev/ioerror stat failed: %sunknown devicelvmlocalappmachineid%s/machine-idproduct_uuid%s: Not available device node%sdev/block/%d:%d/holders/opendir%sblock/%s/devclosedirFound dev %d:%d %s - new.Dir path %s is too longPath %s/%s is too long.Drop alias for %d:%d %s.Failed to udev_enumerate_new.j:dm_list_add_hundefinedfilemerged filesstringcommand profilemetadata profilespecial purposeD,!@T"4system.devices-/dev/%sFound %s for %d:%d from sys%sdev/block/%d:%d/dm/name%u %u %llu %128sFound %s for %d:%d from %snaa.eui.t10.device/device_id.c%sdev/block/%d:%d/%spartVERSIONCRYPT-not found in configdev_cachepreferred device name matcherstrdup dev_dir failed.Not a block device %s.Failed to get device %smetadata_versionDevice %s %s is %s.device/dev-md.c1.00.90%s/devices/dmeventd.devices%s/devices/%s%Y%m%d.%H%M%S%s/devices/%s-unused.%sDevices file moved to %s%s/devicesCreating %s.Failed to create %s %dInvaild device type %s.mpath-device/vpd_pg83t10.%seui.%snaa.%sdevice/serialdevice/vpd_pg80/dev/vd%s/class/block/%s/serialmd/uuidloop/backing_file(deleted)__QEMUsys_wwidsys_serialdevnamempath_uuidcrypt_uuidlvmlv_uuidmd_uuidloop_filewwid_naawwid_euiwwid_t10/dev/dm-/dev/mapper/Match %s %s to %s (auto)pvcreatevgcreateCreating devices file %s%s_newunlinkw+Cannot open to write %s.PRODUCT_UUID=%s HOSTNAME=%s VERSION=%u.%u.%uFailed to write devices file.%s/devices/backup/Wrote backup %sdirfdRemove backup %sunlinkatDevice not found for %s.%s/D_%sDevices file update skipped.not setpersistentDrop incorrectly matched %susablempathserial missing for %sserial %s pvid %s %sserial %s nolabel %sserial %s no pvid %sfwraidserial %s pvid %s filtered %sSearch for PVID %s.Search for PVIDs filtering.Search for PVIDs on %slvmdeviceswxpvids: %d %u devs: %d %u device_ids_read already donedevice_ids_read %s# HASH=0# HASHSYSTEMIDHOSTNAMEread devices file hostname %sPRODUCT_UUIDread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTCannot access device %s.Match %s %s PVID %s: done %sDevices file not found: %s%sdev/block/%d:%d/device/blockFound %s for %d:%d from sys dm.Failed to create sysfs path for %sWARNING: cannot open devices file to read.check devices file version %s prev %sDevice '%s' has been left open (%d remaining references).Internal error: %d device(s) were left open and have been closed.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Preferred device name pattern matcher creation failed.Failed to allocate a preferred device name pattern.Couldn't create binary tree for sysfs-only devices in dev cache.Couldn't create binary tree for dev-cache.Drop alias for %d:%d invalid path %s %d:%d.Ignoring dev with no valid paths for %s.Device path %s is invalid for %d:%d %s.Dropping aliases for device entry %d:%d %s for new device %d:%d %s.Dropping aliases for %d:%d before adding new path %s.dev_cache_get filter excludes %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathCannot access device %s for %d:%d.No device name found from %d:%d.Cannot access device %s from %d:%d.Found %s devno %d:%d expected %d:%d.Device lookup failed for %d:%d %s%s: failed to insert device list to device cache index.%s: failed to allocate device list for device cache index.device_id_system_read reduced underscores %s to %sMatch dm names %s %s for %d:%d (from cache)Match dm names %s %s for %d:%d (from stat)Match %s %s to %s: using vpd_pg83 %s %sdevice_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.Failed to allocate buffer size %d for devices file.Failed to write buffer for devices file content.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s # LVM uses devices listed in this file. # Created by LVM command %s%s pid %d at %s# HASH=%u Failed to write devices file header.Failed to replace devices file.Wrote devices file %s hash %u hashed size %u total size %u%s/devices/backup/system.devices-%s.%04uWARNING: Failed to create backup file %sWARNING: Failed to write backup file %sWARNING: Failed to sync backup file %sWARNING: Failed to sort backup devices files.Limit backup %u found %u sorted %d removing %u.WARNING: devices to use does not include %sdevice_id update %s pvid %s vgid %s to %sCannot create devices file, missing devices directory %s.WARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dSkip devices file update (busy).Skip devices file update (changed).Validating devices file entriesValidating %s %s PVID %s: initial match %sValidate %s %s PVID %s on %s: not scannedValidate %s %s PVID %s on %s: not readValidate %s %s PVID %s on %s: filtered (%s)Validate %s %s PVID %s on %s: wrong PVID %ssuspect device id serial %s for %sDevice %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Validate %s %s PVID %s on %s: correctValidate %s %s PVID %s on %s: outdated DEVNAME %sWARNING: fixing devices file IDNAME %s for PVID %s device %sValidate %s %s PVID %s on %s: wrong PVID %s.Validate %s %s PVID %s: found on %sValidate %s %s PVID %s: no device foundValidate %s %s PVID %s: no device found, remove incorrect PVIDValidate %s %s PVID none: remove entry with repeated devnameValidate %s %s PVID %s: no idname, set invalid.Validate %s %s PVID %s: no device for idtype devname, set invalid.Validated device ids: invalid=%d, update disabled.Validated device ids: invalid=%d, trying to update devices file.Validated device ids: hash mismatch, update disabled.Validated device ids: hash mismatch, trying to update devices file.Validated device ids: invalid=%d, no update needed.Override device_ids_invalid for complete hints.Finding all devs with suspect serial numbers.Reading and filtering %d devs with suspect serial numbers.Checking %d PVs with suspect serial numbers.Matching suspect serial device id %s PVID %s prev %sMatch suspect serial device id %s PVID %s to %sMatch PVID failed in %d devs checked.Matching suspect serial device id %s unmatched PVID %s prev %sNo device matches devices file PVID %s with duplicate serial number %s previously %s.Device %s with serial number %s has PVID %s (devices file %s)Drop incorrectly matched serial %sDevices file %s %s PVID %s not found.Search for PVIDs %d trigger %d all_ids %d search all %d auto %d none %dSearch for PVIDs skipped for matching %sSearch for PVIDs reading labels.Search for PVIDs skip %s (stable id)WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Search for PVID %s found on %s.Devices file PVID %s has new device ID %s %s from %s.Found new device name %s for PVID %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatessearched_devnames_create error fopen %dsearched_devnames_create error open dir %d# Created by LVM command %s pid %d system.devices %s at %ssearched_devnames_create error fflush %d fclose %dsearched_devnames_create error rename %dsearched_devnames created pvids %d %u devs %d %uCannot open devices file to read.Devices file invalid hash value errno %dDevices file hostname %s vs local %s.read devices file product_uuid %sDevices file product_uuid %s vs local %s.WARNING: failed to process devices file entry.Devices file comment hash %u calc hash %uDevices file refresh: missing product_uuidDevices file refresh: missing product_uuid and hostnameDevices file not found, ignoring.Failed to lock the devices file to read.Failed to read the devices file.Matching devices file entries to devicesMatch %s %s PVID %s: done previously %sMatch %s %s PVID %s: done %s (immediate)Match %s %s PVID %s: wrong devname %sMatch %s %s PVID %s: no device matchesMatch %s %s PVID %s: no idnameMatch %s %s PVID %s: idname not foundMatch %s %s PVID %s: dev %s already matched to an entryDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Failed to lock the devices file to create.Failed to lock the devices file.0ء8@P`pСP` PPD /run/lvm/run/lvm/searched_devnames_new/run/lvm/searched_devnames/proc/partitionsdevice/dev-ext.cdevice/dev-io.cClosed %sdevice/dev-luks.cLUKSblacklist_exceptionsblacklistdevice/dev-mpath.cmultipath wwid %s in %s %s/etc/multipath.confnot %sdev/block/%d:%dreadlinkDevice name is not valid.%sblock/%s/holdersPath %s is not a directory.Device %s has no holders dir%sblock/%s/dm/uuiddevice/dev-type.cAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.NOT display/display.cPV Name %s PV UUID %sTotal PE / Free PE %u / %u O_EXCLRWRO%s: Not using O_NOATIME%s: Not using O_DIRECTOpened %s %s%s%s (test mode - suppressed)%s: size is %lu sectorsdevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPENDIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_membermpath pool creation failed.%sdev/block/%d:%d/dm/uuidFailed to read %s.blkextdrbddasdemcpowerVxDMPlooppower2device-mapper%sdev/block/%d:%d/partitionsysfs file %s does not exist.%s/dev/block/%d:%d/md/%sdm_snprintf md %s failed%s/block/md%d/md/%sdm_snprintf old md %s failedmpath_memberDM_MULTIPATH_DEVICE_PATHunusedFailed libblkid probe for %sNo file system found on %s.No file system type on %s.BLOCK_SIZEFSLASTBLOCKFSBLOCKSIZELVM2_memberLVM1_memberSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELDM_snapshot_cowsoftware RAID md superblockswap signatureLUKS signaturedevice/dev-dasd.cioctl BIODASDINFO2%sdev/block/%d:%d/holdersdevice/filesystem.cMissing %s for %s.Cannot open %s.Unrecognized holder %s of %sFound holder %s of %s.No holder in %sWARNING: Failed to open %s.device/online.cWARNING: No info in %s.vg:No vgname in %sdev:No devname in %s/run/lvm/pvs_onlineFound PVs online %d for %s/run/lvm/vgs_onlineUnlink vg online: %sCreate vg online: %sFailed to create %s: %d%d:%d vg:%s dev:%s Create pv online: %s %d:%d %sCheck pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/pvs_lookupUnlink pvs_lookup: %scling_by_tagsnext freeclvmFailed to get LV path %s/etc/mtab%s mtab mntpath %s/proc/mounts%4096s %4096s %4096sLVRESIZE_FS_HELPER_PATH--fsreduce--fstype--lvpath--newsizebytes--mountdir--unmount--mount--fsck/dev/dm-%d--cryptresize--cryptpathmanage--remountReduced file system %s on %s.--fsextend%.2fPercentage %d does not fit.SCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic MultipathingUdev database has incomplete information about device %s.Found md ddf magic at %llu wrong crc %x disk %x %smultipath config ignored %d wwidsSysfs path string is too long.Cannot find device name in sysfs path.Cannot find '/' in device name.Failed to get primary device for %d:%d.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentFatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: PV Status %sallocatableWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %d%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detachedAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedCannot open device %d:%d with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Discarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sFound md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s.mpath hash table creation failed.multipath wwids file disabled.Sysfs dm uuid path for %s is too long.Failed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config fileFailed to read sysfs path for %sFailed to read sysfs partition value for %sWARNING: %s: partition path is too long.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %s_md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sdev_is_mpath_component %s no primary devdev_is_mpath_component %s %s in wwids fileFailed libblkid probe setup for %sFound blkid fstype %s fsblocksize %s on %slibblkid TYPE %s BLOCK_SIZE %d FSLASTBLOCK %llu FSBLOCKSIZE %u fs_last_byte %lluFailed to create a new blkid probe for device %s.Failed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.WARNING: sysfs file %s not in expected format: %sCouldn't create holder path for %s.WARNING: No device numbers in %s.WARNING: Ignoring invalid vg field in %s.WARNING: Ignoring invalid vgname in %s (%s).WARNING: Ignoring invalid devname field in %s.WARNING: Ignoring invalid devname in %s (%s).Found PV online %s for VG %s %spvscan[%d] Path %s/%s is too long.Cannot create online file path for %s %d:%d.pvscan[%d] Cannot create online file path for %s %d:%d.Incomplete online file for %s %d:%d vg %s.Incomplete devname in online file for %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s %d:%d is duplicate for PVID %s on %d:%d %s.pvscan[%d] PV %s %d:%d is duplicate for PVID %s on %d:%d %s.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.Internal error: Path %s/%s is too long.Incorrect VG lookup file %s PVID %s %s.Found PV online lookup %s for VG %s on %s.Found PVs online lookup %d for %s.Unrecognised allocation policy %sFull LV name "%s/%s" is too long.LV %s mounted at %s also mounted at %s.LV %s mounted at %s may have been renamed (from %s).File system resizing not supported: fs utilities do not support renamed devices./usr/libexec/lvresize_fs_helperReducing file system %s to %s (%llu bytes) on %s...Failed to reduce file system with lvresize_fs_helper.Extending file system %s to %s (%llu bytes) on %s...Failed to extend file system with lvresize_fs_helper.Extended file system %s on %s.DASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)Ceph rados object as a Linux block deviceSUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)contiguouscclinglcling_by_tagstnormalnanywhereainheritiWiping %s signature on %s./etc/multipath/conf.d%s: Skipping: Unrecognised LVM device type %luInternal error: Destroying regex filter while in use %u times.read/write (activated read only)--- Historical Logical volume ---LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sChecking thin status for LV %s.WARNING: LV %s maps %s while the size is only %s.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized compression state: %u.LV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversiondtree node segment allocation failederror module string list allocation failedInternal error: Destroying composite filter while in use %u times.Internal error: Destroying sysfs filter while in use %u times.Internal error: Destroying md filter while in use %u times.Internal error: Destroying firmware RAID filter while in use %u times.Internal error: Destroying mpath filter while in use %u times.Internal error: Destroying partitioned filter while in use %u times.Internal error: Destroying lvm_type filter while in use %u times.Internal error: Destroying usable device filter while in use %u times.Internal error: Destroying signature filter while in use %u times.Internal error: Destroying deviceid filter while in use %u times.%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].%d:%d: filter cache skipping (no name)%s: filter cache skipping (cached bad)%s: filter cache using (cached good)Ignore invalid filter result %d %sFailed to hash alias to filter.Internal error: Destroying persistent filter while in use %u times.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.md filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detection%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]%s: Skipping mpath component deviceWARNING: devices file is missing %s (%d:%d) using multipath component %s.See lvmdevices --update for devices file update.%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]%s: Skipping: dev_get_size failed%s: Skipping: error in signature detectionDoubling metadata output buffer to %uRandom lvid creation failed for %s/%s.WARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.Filter patterns must be enclosed in quotes.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.filter-sysfs disabled: /sys/dev/block not foundCouldn't scan the archive directory (%s).Couldn't create new archive file.Created path %s/%s is too long.Couldn't create text instance object.Internal error: Passed file path name %s is too long.Couldn't copy archive directory name.Couldn't copy backup directory name.Couldn't create text format object.Consider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Failed to allocate format instance.Failed to find cached info for PV %s.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to duplicate empty name.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"Internal error: PV name for uuid %s missing from text metadata export hash table.pv device name size is out of bounds.Internal error: problem tracking indentationCould not allocate memory for ancestor list buffer.Couldn't create temporary archive name.Couldn't create FILE object for archive.Consider pruning %s VG archive with more then %u MiB in %u files (see archiving settings in lvm.conf).Test mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Internal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.filters/filter-type.c%s: Skipping (deviceid)filters/filter-deviceid.cfilters/filter-regex.cread/writeread onlyINACTIVErecoveringnormaloffline (partial)LV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %s--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%metadata/vdo_manip.cLV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %derroerror/errseg.cfilters/filter-composite.cfilters/filter-sysfs.cfilters/filter-md.cfilters/filter-fwraid.cfilters/filter-mpath.cfilters/filter-partitioned.cfilters/filter-usable.cfilters/filter-signature.cimporting unknown segmentunknown/unknown.cstart_extentextent_countgoodbadfilters/filter-persistent.cfilter caching %s %s%s: New preferred name%s: Skipping (regex)failed to create sysfs path%s: Skipping (sysfs)*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.ID_PART_TABLE_TYPEDEVTYPE%s: Skipping unusable device.%s: Skipping: %s%s: Skipping lvm1 device%s: Skipping gfs-pool deviceformat_text/export.cBuffer reallocation failed.format_text/format-text.cWARNING: No cache info for %sMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaWARNING: Invalid input '%s'.[n] Accepted input: [%c]filter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".Regex filter initialised.%sdev/blockformat_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %sArchive file %s not found.archive_params alloc failedbackup_params alloc failedFailed to find device for PV.# %g %s2.03.24(2)-RHEL9 (2024-05-16)version = %ddescription = "%s"creation_time = %lu # %sstatus = %sflags = %sseqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"lock_args = "%s"extent_size = %umax_lv = %umax_pv = %uallocation_policy = "%s"profile = "%s"metadata_copies = %uphysical_volumes {%s {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %lucreation_timecreation_host = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %u+%sstart_extent = %uextent_count = %ureshape_count = %utype = "%s%s"segment%u {text pv_namespv%dhistorical_logical_volumes {removal_timeorigin = "%s%s"descendants = %suname failed: %s%s/%s_%05u-%d.vgArchive file name too long.%s: rename to %s failed: %smisc/lvm-file.c%s: rename to %s failedExpiring archive %sArchive rename failed for %s%ss = ["%s", %u%s"%s", "%s"%sStatus value is not a string.format_text/flags.cCACHE_VOLUnknown status flag '%s'.PARTIALALLOCATABLEEXPORTEDMISSINGRESIZEABLEPVMOVEREADWRITEWRITE_LOCKEDNOAUTOACTIVATECLUSTEREDSHAREDFIXED_MINORVISIBLENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_USES_CACHEVOLKilobytesMegabytesGigabytesTerabytesPetabytesExabytesToo small to hold a PVnoyes?@P?(ignored)(used)empty prefdopenWriting %s metadata to %sfsyncRenaming %s to %sUnlinking %smda_context allocation failedTest mode: Skipping renameformat_text/text_label.cDevice %s %s is %lu bytes.raid%draid_disksDevice %s %s is %d.queue/minimum_io_sizequeue/optimal_io_sizealignment_offsetPV %s missing from cachepe_startMDA1 startba_startdisk sizelabel scan sizeMDA0 endpe_endba_endformat_instance%s.tmpcontentsmissing contents fieldformat_text/import_vsn1.cText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find section '%s'.Could not find status flags.Could not read status flags.Could not read flags.descriptionEmpty pv section.dev_sizedevice_id_typecreation_hostlock_typeseqnophysical_volumesCouldn't read pv summariesdescendantsmetadata/lv_manip.cba_sizeImporting logical volume %s.allocation_policyread_aheadEmpty logical volume section.Empty segment section.reshape_countstripedSegment allocation failed_mimagetmpsegment_countmajormax_lvmax_pvmetadata_copieshistorical_logical_volumesmirrormetadata/mirror.cread_vgs, mda2 ( mda1 ( da1 ( ba1 (Scanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.Failed to allocate dir_listlabel/label.ctext_orphanInitialised format: %sformat_text/import.cFailed to read VG %s from %sRead volume group %s from %sWrite from %s.Write[%u] from %s.VG %s metadata writing failedVG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.Failed to write metadata area headerstruct mda_header allocation failedWARNING: Removing metadata location on %s with bad mda header.Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.Test mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.Creating metadata area on %s at sector %lu size %lu sectorsstruct data_area_list allocation failedPV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedPV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %lluRequested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.Adjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to mininum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.PV %s is a different format (seqno %s)PV %s too large for extent size %s.Internal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %lluNot enough space available for metadata area with index %u on PV %s.struct mda_context allocation failedstruct metadata_area allocation failedInternal error: can't remove metadata area with index %u from PV %s. Metadata layou not supported by %s format.Failed to move metadata area with index 1 while resizing PV %s.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.Couldn't allocate text_fid_context.Couldn't allocate format_instance object.Can't process text format file - %s.Couldn't read uuid for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device_id_type in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device hint in read_pv_sum.Empty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Removed logical volume structure allocation failedCouldn't read uuid for volume group %s.Couldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.Couldn't find volume group in file.Couldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Failed to allocate generic logical volume structure.Failed to allocate list item for historical logical volume %s/%s%sUnknown historical logical volume %s/%s%sFound an item that is not a stringCouldn't read status flags for physical volume.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Failed to allocate memory for device_id_type in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device hint in read_pv.Empty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Unable to allocate logical volume structureLost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Cannot duplicate segment string.Couldn't read segtype for logical volume %s.WARNING: Unrecognised flag %s in segment type %s.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.Cannot duplicate segtype string.Couldn't create pv hash table.Couldn't create lv hash table.Unrecognised format %s for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Failed to allocate memory for system_id in _read_vg.%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sInternal error: %s label header currently requires a data area.Found pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: scanning %s mda1 failed to read metadata summary.WARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.Failed to allocate text format type structure.Couldn't allocate labeller object.Couldn't create text label handler.Couldn't allocate memory for labeller list object.Couldn't register text label handler.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.'%s' does not contain volume group '%s'.There are %d physical volumes missing.text_export buffer allocation failedError parsing metadata for VG %s.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %skvHH]v#orphans_lvm2printDM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=686CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %s#globallabel allocaction failedrwrwexCannot extend bcache fd tableFailed to set bcache fd.open %s %s di %d fd %dio_setup failed %dFailed to set up sync io.dev_read bcache not set up %sclose and reopen to write %sFailed to open device %sFailed to write label to %ssome blocks are still lockedclose and reopen excl %slabel/hints.cnewhints createdtouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sclear_hints open errno %dunlink_hints errno %d %sclear_hints flush errno %d %sclear_hints close errno %d %sunlock_hints no existing fdunlock_hints flock errno %dlock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %sFinding devices to scanFailed to set up devices.Failed to get device list.get_hints: pvscan recreateget_hints: nohints filenohints_exist errno %d %snewhints_exist errno %d %sget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entriesValidating hintsInvalid hints: none used.No size for %s./dev/mdclear_hint_file%s/P_%slocking/file_locking.c%s/V_%sUnrecognised lock type: %dmisc/lvm-flock.cLocking %s %c%c convertLocking %s %c%c:auxmemlock reset.mm/memlock.cglobal flock already held exlocking/locking.cstderrstdoutstdindup2dup2(%d, %d) returned %dread%d Cannot parse content of %s.metadata/cache_manip.cmetadata/lv.cfailed to write log file: %s failed to write log file Unknown cache mode: %s.another LVCan't convert internal LV %s.%s_cpoolFlushing of %s aborted.smqreporter_poolmetadata/writecache_manip.cFailed to deactivate %s.flush_on_suspendRemoving previous wcorig %s%s=%s%s=%llumetadata/integrity_manip.cbitmapunassigned:%u-%u(%u)not enablednot monitoredvsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).Device open %s has DEV_IN_BCACHE already setDevice open %d:%d has no path names.Device open %s already open with di %d fd %dCan't open %s exclusively. Mounted filesystem?Drop alias for %d:%d failed open %s (%d)Invalid path %s for device %d:%d, trying different path._SC_PAGESIZE returns negative value.couldn't create control block setFailed to set up async io, using sync io.WARNING: _SC_PAGESIZE returns negative value.bcache block size must be a multiple of page sizeFailed to set up io layer with %d blocks.Error opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096Label handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.Error writing device value %s at %llu length %u.dev_set_bytes bcache not set up %sScanning for labels to wipe from %sFailed to read label from %s sector %lluFailed to remove label from %s at sector %llu%s: Wiping label at sector %llu# Created empty by %s pid %d %sEnable full md component check.Filtering devices to scan (nodata)Filtering devices to scan done (nodata)Clear pvid and info for filtered dev %s.get_hints: applied using %d other %d vgname %sWARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Will scan %d remaining devicesextra md component check skip %llu %llu device_hint %s dev %sIgnoring PV from md component %s with PVID %s (metadata %s %llu)extra md component check %llu %llu device_hint %s dev %sInvalid hint device %d:%d %s pvid %s had vgname %s no PV info.Too long locking filename %s/P_%s.Too long locking filename %s/V_%s.Failed to convert flock on %s %dInternal error: Unknown locking mode %s.Internal error: reopen_standard_stream called on non-standard stream %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluCannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.WARNING: Ignoring unrecognized journal value.Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cannot set cache mode for non cache volume %s.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Can't prepare new cachepool name for %s.WARNING: Skippping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Failed to sync local devices when clearing cache volume %s.Failed to sync local devices after final clearing of cache %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.WARNING: Cannot detect default cache metadata format, using format: %u.Cache metadata format %u is not supported by kernel target.Replacing chunk size %s in cache pool %s with chunk size %s from profile.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Detected default cache metadata format: %u.Internal error: Failed to wipe cache pool for volume %s.Skipping wipe of %s volume with %s segtype.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sLV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to activate LV %s for flushing writecache.Failed to sync local devices before detaching writecache.Failed to flush writecache for %s.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to deactivate LV %s for detaching writecache.Failed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.LV %s segment is unsupported raid for integrity.LV %s segment has no integrity metadata device.LV %s integrity segment has no originFailed to update and reload LV after integrity remove.Failed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Failed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.Invalid raid integrity mode (use "bitmap" or "journal")_format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvseggs: extent range dm_snprintf failed_format_pvsegs: extent number dm_snprintf failed_format_pvsegs: list item dmsnprintf failed_format_pvsegs: failed to add item to list_format_pvsegs: list item dm_pool_zalloc failedWARNING: Thin volume %s maps %s while the size is only %s.`1,..--..P,pre-cmdcmdorphanpvlabelvglvshellprocessing_vprint_logfatalerrorwarnnoticeinfodebug/proc/self/stat/run/lvm/hints/run/lvm/nohints/run/lvm/newhints %s/%s uses %sFailed to allocate memory with PV tags: Changing Considering%s is %son %stpoolvpoollvpath snprintf faileddm_pool_alloc failedFailed to duplicate hostnameActivating logical volume %s.Thin volume %s is active.Stack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.metadata/pv_manip.cqueue/discard_max_bytesqueue/discard_granularityNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %smetadata areaup to contiguous metadata/pv_map.cpvl->pv->devdm_pool_begin_object faileddm_pool_grow_object failedCling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areascreate_pv_maps alloc failed_cdata_tdatarimagemetadata/pool_manip.c%s_%s%s_%s_%u%s_rmeta_%uFailed to insert layer for %sMemory reallocation for parallel areas failed.PV tags string allocation failed.PV tags string extension failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.Internal error: for_each_sub_lv failure.LV %s using PV %s is not redundant.Internal error: Bad pvmove structureInternal error: Cannot find mirror segment.Failed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s.LV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s.Generating list of PVs that %s/%s uses:Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentInternal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.Internal error: alloc_lv_segment: Missing segtype.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Internal error: No single component user of logical volume %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Failed to remove temporary SubLVs from %sDropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sSegment extent reduction %u not divisible by #stripes %uUnable to deactivate spare logical volume %s.Internal error: Removing still active LV %s.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %lu sectors on %s.release_pv_segment with unallocated segment: %s PE %uRemove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedInternal error: Bad metadata_area_countLog size needs too many extents %lu with region size of %u sectors.Adjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Couldn't create physical volume maps in %sParallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %lu extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Not using free space on existing parallel PV %s.Internal error: _alloc_parallel_area called without any allocation to do.alloced_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.allocation handle allocation failedInternal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Adding segment of type %s to LV %s.Internal error: Pool %s already has extents.Name of logical volume %s is too long to be a pool name.%s: Required device-mapper target(s) not detected in your kernel.WARNING: Pool %s is created without initialization.Aborting. Failed to activate pool metadata %s.Aborting. Failed to wipe pool metadata %s.Aborting. Could not deactivate pool metadata %s.Failedto deactivate pool volume %s.Manual intervention may be required to remove abandoned LV(s) before retrying.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Insufficient suitable allocatable extents for logical volume %sextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sUnable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering._create_mapsunknownnonepublicprivatehistorylinearstripedmirrorraidthincachesparseoriginthinoriginmultithinoriginthickoriginmultithickorigincacheoriginextthinoriginmultiextthinoriginsnapshotthinsnapshotthicksnapshotpvmoveimagelogmetadatapooldatasparevdovirtualraid0raid0_metaraid1raid10raid4raid5raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_nclockdsanlockcachevolwritecachewritecacheoriginintegrityintegrityoriginhistorical Failed to create new nameCannot rename locked LV %s and openlv_info failed: aborting.--dry-run--verbose--yes--force%s: discarding failed.Can't resize reshaping LV %s.ReducExtendpv_list allocation failed merging origin clustered and DISCARD with %u snapshots(s) with snapshot %sphysicallogicalat most LV %s in VG %s is now hidden.Historical lVolume group %s is read-onlymetadata/thin_manip.cFailed to remove cachevol %s.Failed to deactivate LV %sFailed to update pool %s.Removing snapshot volume %s.lvremovevgremovePostponing write and commit.WARNING: Failed to unlock %s.cache originexternal originVDO pool (origin only)unlocking on revertHistorical resize2fs+crypto_LUKSequal tosmaller thanlarger than cryptsetup, mount, fsck, unmount, xfs_growfsNo size change.shupdatenorefreshlocking/lvmlockd.cgfs2ocfs2%s/%s/%sFailed to activate %s.checksizeresize_fsadmFilesystem check failed.Filesystem resize failed.ext2ext3ext4xfsFile system %s%s found on %s.reiserfsnochangeFile system not reduced.Skip unmount in test mode.Skip fsck in test mode.Skip mount in test mode.Skip cryptsetup in test mode.Skip fs reduce in test mode.Problem deactivating %s.Resized %s to %u extents.File system extend error.Found fs %s last_byte %lluFile system not extended.Skip fs extend in test mode.Removing layer %s for %sFailed to find layer %s in %s_mimageCreation of layer LV failedInserting layer %s for %sCannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.%sLogical Volume "%s" already exists in volume group "%s"WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.Cannot use misconfigured fsadm executable to resize %s.Couldn't create LV path for %s.Couldn't generate new LV size string.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Cannot resize a RAID %s directly for %sCannot resize %s LV %s. Convert to more stripes first.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.RAID module does not support shrinking.Cannot reduce LV with integrity.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.Ignoring PVs on command line when reducing.%sing logical volume %s to %s%sSize of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Internal error: LV is not specified.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Cannot resize logical volume %s with active component LV(s).Cannot resize logical volume %s while it is tracking a split image.Cannot resize inactive VDO logical volume %s.Cannot resize inactive VDO POOL volume %s.Cannot resize external origin logical volume %s.Do you really want to remove%s%s%s%s logical volume %s%s? [y/n]: Logical volume %s not removed.lvresize_extents_from_percent type %d extents %u percent_value %uReducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.Failed to allocate generic volume list item for indirect glv %sparallel_areas allocation failedFailed to find segment for %s extent %uLV %s in VG %s is now visible.Internal error: Missing volume group.Can't remove logical volume %s under snapshot.Can't remove external origin logical volume %s.Can't remove logical volume %s used by a mirror.Can't remove logical volume %s used as mirror log.Can't remove logical volume %s used as RAID device.Can't remove logical volume %s used by a pool.Internal error: Thin LV %s without pool.Can't remove locked logical volume %s.Internal error: data_lv_from_thin_pool arg not thin pool %sFailed to detach writecache from %sInternal error: Updated LV %s is not thin pool.Ignoring update failure of pool %s.Error releasing logical volume %s with pending delete.Unable to deactivate logical volume %s.Detach cachevol before removing.Releasing %slogical volume "%s"Error releasing %slogical volume "%s"Failed to update thin pool %s.%sogical volume "%s" successfully removed.Failed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume %s.Removing snapshot %s that failed to merge may leave origin %s inconsistent. Proceed? [y/n]: Removing origin logical volume %s with %u snapshots(s).Removing merging origin logical volume %s.Unable to remove %s, volume is merged to %s.Removing external origin logical volume %s.Unable to fully deactivate unused cache-pool %s.Removal of pool metadata spare logical volume %s disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Removing %s %s will remove %u dependent volume(s). Proceed? [y/n]: Updating logical volume %s on disk(s)%s.Dropping origin_only for %s as lock holds %sFailed to suspend logical volume %s.Failed to revert logical volume %s.Updating logical volume %s in kernel.Problem reactivating logical volume %s.Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Can't resize internal logical volume %s.--poolmetadatasize can be used only with thin pools.Extending thin pool metadata to %llu for larger dataLV in VG %s with lock_type %s requires lvmlockd.LV path too long for lvmlockd refresh.Cannot activate to resize %s without using device-mapper kernel driver.Ignoring fs resizing options for LV type %s.The LV must be active to safely reduce (see --fs options.)Failed to activate %s to check for fs.Logical volume %s must be active for file system %s.File system not found for --resizefs or --fs options.LUKS dm-crypt device must be active for fs resize.File system size %llub is adjusted for crypt data offset %ub.Found fs %s last_byte %llu newsize_bytes_fs %lluFile system %s%s found on %s mounted at %s.File system reduce for reiserfs requires --fs resize_fsadm.File system device usage is not available from libblkid.File system size (%s) is %s the requested size (%s).File system reduce is not needed, skipping.File system reduce is required (see resize2fs or --resizefs.)File system reduce is required and not supported (%s).File system reduce is required using resize2fs.File system needs to be mounted to reduce fs (see --fsmode).File system needs to be unmounted to reduce fs (see --fsmode).Unknown file system resize options: --fs %s --fsmode %sFile system unmount is needed for reduce.File system fsck will be run before reduce.File system mount is needed for reduce.cryptsetup resize is needed for reduce.Continue with %s file system reduce steps:%s%s%s%s%s? [y/n]:crypt device is already reduced to %llu bytes.crypt reduce is required (see --resizefs or cryptsetup resize.)Failed to resize crypt dev with lvresize_fs_helper.Failed to lock VG, cannot reduce LV.VG was changed during fs operations, restarting.File system last byte %llu is greater than new size %llu bytes.Resized thin pool metadata %s to %u extents.File system extend for reiserfs requires --fs resize_fsadm.File system extend is not supported (%s).File system must be mounted to extend (see --fsmode).File system type %s not handled.File system fsck skipped for extending mounted fs.File system unmount is needed for extend.File system fsck will be run before extend.File system mount is needed for extend.cryptsetup resize is needed for extend.Continue with %s file system extend steps:%s%s%s%s%s? [y/n]:Internal error: Wrong layer %s in %sInvalid %d segments in %s, expected only 1.Invalid %d area count(s) in %s, expected only 1.Invalid seg_type %d in %s, expected LV.Layer doesn't match segment in %s.Inconsistent extent count (%u != %u) of layer %s.Layered name is too long. Please use shorter LV name.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Internal error: Empty list of LVs given for wiping.Internal error: LVs must be set visible before wiping.Failed to activate localy %s for wiping.Failed to sync local device names after deactivation of wiped volumes.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.P`ȸp_tdata_cdata_corig_wcorig_vdata_tpool%d_tdata_cdata_corig_wcorig_vdataNONEVGFREELVPVSORIGINLV %s invalid: %s for %s segmentLV %s invalid: %s (is %u) for %s segmentmin recovery larger than max recoveryWARNING: Read-only activated logical volume %s not zeroed.WARNING: Logical volume %s not zeroed.Signature wiping on logical volume %s not requested.Rounding size %s (%u extents) %s to stripe boundary size %s (%u extents).Maximum number of logical volumes (%u) reached in volume group %sMetadata does not support %s segments.Volume group %s does not support tags.Metadata only supports readahead values between 2 and 120.Stripe size may not exceed %s.Can't create %s without using device-mapper kernel driver.WARNING: Skipping zeroing and wipping, compiled without activation support.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Internal error: Unable to create new logical volume with no extents.Unable to create %s smaller than 1 chunk.Number of stripes (%u) must not exceed number of physical volumes (%d)Internal error: Cannot create %s volume without %s pool.Couldn't find volume %s in Volume group %s.Cannot use locked pool volume %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Aborting. Failed to locally activate thin pool %s.Cannot read thin pool %s transaction id locally, perhaps skipped in lvm.conf volume_list?Cannot use thin pool %s with transaction id %lu for thin volumes. Expected transaction id %lu.Deactivating public thin pool %s.Aborting. Could not deactivate thin pool %s.Cannot create new thin volume, free space in thin pool %s reached threshold.Origin volume %s not found in Volume group %s.Caching of origin cache volume smaller then chunk size is unsupported.Internal error: Pool LV for cache is missing.Logical volume %s is not a cache pool.Using reduced mirror region size of %sWARNING: New %s won't be synchronized. Don't read what you didn't write!Logical volume %s is not a thin pool.Snapshots of locked devices are not supported.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Virtual size matching available free logical size in VDO pool.Volume group "%s" has insufficient free space (%u extents): %u required.Setting read ahead sectors %u.Setting device number to (%d, %d).lockd_init_lv: unknown lock_type.Cannot create snapshot without origin LV in shared VG.Failed to find origin LV %s/%sFailed to lock origin LV %s/%sFailed to find thin pool %s/%sFailed to lock thin pool %s/%sCreate thin pool and thin LV separately with lock type %sUnknown thin options for lock init.Internal error: Segment in %s is not a thin pool segment.Multiple-segment mirror is not supported.Test mode: Skipping activation, zeroing and signature wiping.Aborting. Failed to activate LV %s.Aborting. Failed to activate LV %s locally exclusively.Failed to suspend thin snapshot origin %s.Aborting. Failed to read transaction_id from thin pool %s.WARNING: Metadata for thin pool %s have transaction_id %lu, but active pool has %lu.Restoring previous transaction_id %lu for thin pool %s.Failed to activate thin pool %s.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Failed to deactivate thin pool %s.Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate temporary volume for VDO pool creation.Aborting. Couldn't deactivate VDO LV %s with skipped activation.Aborting. Leaving cache pool %s and uncached origin volume %s.Reverting created caching layer.LV %s has no suffix for cachepool (skipping rename).Aborting. Couldn't deactivate snapshot COW area %s.Failed to sync local devices before creating snapshot using %s.Zero segment type for virtual origin not foundVirtual origin name is too long.Failed to activate sparce volume %s.Aborting. Manual intervention required.Failed to sync local devices before reverting %s.Unable to deactivate failed new LV %s. Manual intervention required.Failed to resume thin snapshot origin %s.Internal error: Unsupported creation of cache and cache pool volume.Internal error: Logical volume is not cache %s.Logical volume %s is now cached.Internal error: Creation of pool for unsupported segment type %s.Temporary logical volume "%s" created.LV %s invalid: segment %u is referencing different LV.LV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u with len=%u has inconsistent area_len %uLV %s: segment %u has same LV %s for both origin and snapshotLV %s, segment %u invalid: %s for %s segment.is not referencing cache pool LVhas invalid cache metadata formathas invalid cache's feature flagis missing METADATA_FORMAT flagdoes not support flag ERROR_WHEN_FULL.log LV does not point back to mirror segmentregion size is bigger then LV itselflog LV is not a mirror log or a RAID imageLV %s invalid: maximum supported areas %u (is %u) for %s segmentDataLV without RAID image flagMetaLV without RAID metadata flagdata LV does not refer back to pool LVmetadata LV does not refer back to pool LVmust not have pool metadata LV setis not flagged as thin pool LVis a thin volume that must not contain thin pool segmentis not flagged as thin volume LVis a thin pool that must not contain thin volume segmentis not referencing thin pool LVexternal LV is not flagged as a external origin LVmerge LV is not flagged as a thin LVmerge LV is not flagged as mergingis not referencing VDO pool LVLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %u uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %uLV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s: inconsistent LE count %u != %uLV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u linksLV %s is indirectly used by historical LV %sbut that historical LV does not point back to LV %sLV %s is indirectly used by LV %sbut that LV does not point back to LV %sLV %s must have exactly one segment.LV %s: segment 1 pool data LV does not point back to same LVLV %s: thin pool metadata LV does not use _tmeta.LV %s: cache pool metadata LV does not use _cmeta.LV %s: external origin count does not match.LV %s: external origin cant't be writable.LV segment %s:%u-%u is incorrectly listed as being used by LV %sUnable to split the %s segment at LE %u in LV %sCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentSegment with extent %u in LV %s not foundPhysical volume %s not in volume group %sName cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.New volume group name "%s" is invalid.%s: already exists in filesystemRemoving physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedPhysical extent size used for volume group %s is less than logical block size (%u bytes) that %s uses.WARNING: Device %s has size of %lu sectors which is smaller than corresponding PV size of %lu sectors. Was device resized?metadata/merge.cno meta areasnon power of 2 stripe sizenon-zero region_sizenon-zero write behindnon-zero min recovery ratenon-zero max recovery ratereshapenon power of 2 region sizenon-zero stripe sizeminimum 2 areas requiredminimum 5 areas requiredminimum 4 areas requirednon-zero writebehindno raid image SubLVvisible raid image LVno raid meta SubLVvisible raid meta LVlvol%dsnapshot exception storestart of new LVmetadata/vg.cFailed to find vdo pool %s/%sFailed to lock vdo pool %s/%sCannot find free device_id.Found free pool device_id %u.Adding integrity to new LVCache pool is prepared.Failed to activate thin %s.Failed to activate new LV %s.Aborting. Failed to wipe %s.%s_voriginCouldn't create snapshot.lvconvertvpool%dLogical volume "%s" created.mirror image is not mirroredis not flagged as cache LVis missing cache pool LVsets cleaner_policyis missing cache policy namehas invalid chunk size.sets METADATA_FORMAT flagsets cache metadata formatsets cache modesets policy namesets policy settingslog LV is not a mirror logregion size is zero_mlogregion size is non power of 2zero area countzero areasextents_copied too largenon-zero origin LVnon-zero cow LVnon-zero origin_listno DataLVDataLV size variationsno MetaLVMetaLV size variationsbogus RAID segment typeis missing a pool data LVis missing a pool metadata LVzero_new_blocks is invalidsets zero_new_blockssets discardssets thin_messages listsets CROP_METADATA flagis missing thin pool LVhas too large device idsets device_idsets external LVsets merge LVsets indirect_origin LVis not flagged as VDO pool LVis missing a VDO pool data LVis not VDO pool data LVsets invalid VDO parameter(s)sets vdo_pool_header_sizesets vdo_pool_virtual_extentssets vdo_paramsis not flagged as VDO LVis missing VDO pool LVsets pool LVsets chunk_sizesets transaction_idset segtype_privateLV %s: has no segment._cmetaName is zero length.vg_remove_mdas %s failed%s: Couldn't get size.@pSkipping clustered VG %s.snprintf random bit failed.%s: read_ahead is %u sectors2.4.Adding PVs to VG %s.Adding PV %s to VG %s.PV %s has wrong block size.vg_createSettingClearingFailed to allocate pvid hash.Failed to hash pvid.Failed to allocate uuid hashFailed to hash lvname.Failed to hash lvid.Writing metadata for VG %s.Failed to write VG %s.#orphans_lvm2PV %s size is zero.pv allocation failedmissingnaReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundVolume group "%s" not found.Reading VG %s without a lock.Volume group %s is exportedVolume group %s is read-only.Failed to import written VG.vg_devs_checkRescanning devices for %s %sReading VG %s %sAllowing forced access to clustered vg %sFailed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sInternal error: Read ahead data missing.WARNING: Failed to open %s to get readahead %s.WARNING: %s: ioctl BLKRAGET %s.Internal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Internal error: Invalid character at index %u of lock_args "%s"Internal error: Invalid colon at index %u of lock_args "%s"Volume group %s does not support tagsFailed to add tag %s to volume group %sFailed to duplicate tag %s from %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Calculated readahead of LV %s is %uWARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceFormat does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Volume group %s is not resizeable.WARNING: PV %s has unknown block size.Devices have inconsistent block sizes (%u and %u)Devices have inconsistent logical block sizes (%u and %u).Adding physical volume '%s' to volume group '%s'Physical volume '%s' is already in volume group '%s'PV %s is used by a VG but its metadata is missing.Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%lu) exceeds limit (%u).PV %s cannot be added to VG %s.vg->name allocation failed for '%s'pv_list allocation for '%s' failedCouldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Adjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sInternal error: LV %s (UUID %s) not found in committed metadata.Internal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sFailed to allocate lv_name hashInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Failed to allocate lv_lock_args hashInternal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has invalid lock_args charsInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: LV %s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s shouldn't have lock_args %s.Internal error: LV %s with no lock_type has lock_args %s.Internal error: LV %s/%s appearing in VG's historical list is not a historical LVInternal error: Historical LV %s points to different VG %s while it is listed in VG %sInternal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sInternal error: Duplicate historical LV id %s detected for %s in %sInternal error: Duplicate historical LV name %s detected in %sFailed to hash historical LV nameFailed to hash historical LV idInternal error: Name %s appears as live and historical LV at the same time in VG %sInternal error: Historical LV %s is not part of any LV chain in VG %sCannot allocate lock for new LV.Automatically removing historical logical volume %s/%s%s.Failed to handle historical LVs in VG %s.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!Internal error: lvmcache_get_outdated_devs no vginfo %sInternal error: lvmcache_get_outdated_mdas no vginfoWARNING: wiping mda on outdated PV %sFailed to read outdated pv mda header on %sFailed to write outdated pv mda header on %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sInternal error: lvmcache_del_outdated_devs no vginfoInternal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.Internal error: lvmcache_get_mdas no vginfo %sRescan for text mismatch - no mdas.Rescan for text mismatch - no mda dev.bcache_invalidate: block (%d, %llu) still heldRescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan for text offset mismatch - now %llu prev %llu.Rescan skipped - unchanged offset %llu checksum %x.Failed to read existing physical volume '%s'No cached label for orphan PV %sMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sWARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.Failed to allocate pv structure.Volume group name "%s" has invalid characters.WARNING: activating multiple VGs with the same name is dangerous and may fail.Cannot reopen rw device %d:%d with no valid paths di %d fd %d.Cannot reopen rw device %d:%d with no valid name di %d fd %d.Failed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Internal error: Cannot change not opened DI with FD:%dreopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dIgnoring metadata for VG %s from missing dev.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.Internal error: lvmcache_update_vg %s no vginfoWARNING: outdated PV %s seqno %u has been removed in current VG %s seqno %u.See vgck --updatemetadata to clear outdated metadata.lvmcache_update_vg %s no info for %s %slvmcache_update_vg %s for info %slvmcache_update_vg %s failed to update info for %slvmcache_update_vg %s copy ignored mdas for %slvmcache_update_vg %s failed to update mdas for %svg_read %s ignore mda for outdated dev %sWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.Failed to destroy record about historical LV %s/%s.WARNING: failed to strip outdated historical lvs.Outdated record for historical logical volume "%s" automatically destroyed.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %pCannot change VG %s with unknown segments in it!Reopen writeable %s uncached fd %d di %dFailed to change to rw fd %s di %d fd %d.Invalid index (%u) of mirror image supplied to shift_mirror_images().Device path name too long - log header not written (%s).Writing log header for LV %s to device %s.%s: not found: log header not written.Failed to open %s/%s to write log header.Failed to write log header to %s.Intermediate VG commit for orphan volume failed.Failed to sync local devices when reactivating %s.Adding PE range: start PE %u length %u on %s.Overlapping PE ranges specified (%u-%u, %u-%u) on %s.Failed to build new mirror image name for %s.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror segment. Remove new LV and retry.WARNING: Physical volume %s not allocatable.WARNING: Physical volume %s is missing.WARNING: No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failed.PE range error: start extent %u to end extent %u.Physical extent parsing error at %s.Failed to find mirror_seg for %sLV %s on %s is not a mirror segments.Internal error: Log LV %s is not top level LV for initialization.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Aborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Aborting. Failed to sync local devices before initialising mirror log %s.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Unable to determine mirror sync status of %s.Unable to split non-mirrored LV %s.Internal error: split_count is zero!Detaching %d images from mirror %s.Insufficient removable PVs given to satisfy request.Failed to build new mirror, %s.Failed to build new image name for %s.Failed to generate new image names for %s.Failed to group split images into new mirror.Failed to rename newly split LV in the kernelUnable to rename newly split LV.Failed to build new mirror log name for %s.Adjusting region_size to %s for mirrored log.Failed to initialise mirror log.Unable to allocate extents for mirror(s).Reducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_images.Unable to remove primary mirror image while mirror volume %s is not in-sync.%s being removed due to failures.Failed error target substitution for %s.Failed to initialize log device %s.Unable to determine mirror sync status.Full resync required to convert inactive mirror volume %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Mirror %s already has a %s log.Log type "mirrored" creation/conversion is not supported for regular operation!Log type "mirrored" is DEPRECATED. Use RAID1 LV or disk log instead.Unable to allocate extents for mirror log.Removing more than existing: %d <= %d.Persistent log is not supported on segment-by-segment mirroring.Segment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%lx/0x%lxInternal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.Failed to create historical LV representation for removed logical volume %s.Initialization of historical LV representation for removed logical volume %s failed.%s is referenced by more then one segments (%s, %s).Pool segment not found for %s.%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Updating chunk size %s for pool %s to %s.Size %s of pool metadata volume %s is bigger then maximum usable size %s.Reducing pool metadata size %s to maximum usable size %s.Can't use volume %s with size %s as pool metadata. Minimal required size is %s.Extending pool metadata size %s to required minimal size %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s" to "%s/%s".Preparing pool metadata spare volume for Volume group %s.Unable to deactivate pool metadata spare LV. Manual intervention required.Can't create pool metadata spare. Name of pool LV %s is too long.Renaming %s as pool metadata spare volume %s.WARNING: recovery of pools without pool metadata spare LV is not automated.Dropping unused pool metadata spare LV %s.Adding new pool metadata spare %u extents.Extending pool metadata spare from %u to %u extents.Internal error: PV %s unexpectedly not in cache.No specified PVs have space available.Failed to create PV entry for missing device.Physical Volume "%s" not found in Volume Group "%s".Segment with extent %u in PV %s not foundMissing PV segment on %s at %u.Unable to allocate mirror extents for %s.Failed to split segment at %s extent %u.Failed to add mirror areas to %s.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to build pvmove LV-type mirror %s.Internal error: Unknown mirror flag.Failed to find segment for %s extent %u.Internal error: _merge_free_pv_seg called on a segment that is not free.Internal error: WARNING: PV %s is without initialized PE ranges.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uAllowing allocation on %s start PE %u length %uCannot restripe LV %s from %u to %u stripes during conversion.Adjusting region_size from %s to %s for %s.Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Adjusting region size of %s LV from %s to %s.Internal error: Missing image sub lv in area %u of LV %s.Failed to prevent PVs holding image components from LV %s being used for allocation.Internal error: LVs must be set visible before removing.Failed to sync local devices after removing %u LVs in VG %s.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisable by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Checking raid device count for LV %s/%sNo proper new segment length for %s!Aborting. Unable to tag.metadata/pv_list.cAllocation of list failed._mimage_%d%s_mimage_%%dLV %s assigned to be split.lv_list alloc failed.Unable to allocate memory._mlogtmp_%dFailed to create mirror log.Failed to form mirrored log. and no log volumeFailed to add mirror images.All mimages of %s are gone.%u image(s) removed from %s.coreFailed to convert mirror logNot a mirror segment.Discarding message for LV %s.%s_pmsparemetadata/pv.cSkipping invalid tag %s.Failed to clone PV name.pv_segment allocation failed_mimage_0%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uto_go <= pva->countMemory allocation failed.%s_%s%sFailed to allocate new name.rmeta%s_%s_%%draid0_metaFailed to get device count.Failed to get device health.consume_pv_areaLogical volume %s is already of requested type %s.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Failed to build list of PVs for %s.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Converting the segment type for %s from %s to %s is not supported yet.Extracting image components %s and %s from %s.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Allocating metadata LVs for %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Failed to allocate metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: Unrecognised segment type flag 0x%016lxExtracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Failed to initialize metadata LVs.Adding metadata LVs back into %s.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Unable to convert %s while it is not in-sync.Clearing newly allocated metadata LVs.Failed to allocate metadata LV for %s in %s.Failed to allocate meta areas memory.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.Failed to allocate memory for unknown segtypeWARNING: Unrecognised segment type %sCan't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Logical volume %s NOT converted to "%s".Failed to remove RAID layer after linear conversion.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.RAID module does not support rebuild+emptymeta.Unable to add RAID images to %s of segment type %s.Failed to clear REBUILD flag for %s components.Allocation of new meta areas failed.Allocation of new areas failed.%s is out-of-sync! Please try refreshing first.%s must be active to perform this operation.Internal error: New segtype not specified.Unable to handle raid arrays with more than %u devices.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.Converting %s LV %s to 2 stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %s%s%s%s? [y/n]: Can't convert RAID LV %s while under snapshot.RAID module does not support reshape.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Unable to convert stacked volume %s.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Failed to adjust LV %s to new size!Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Minimum 3 stripes required for %s LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Reshape request failed on LV %s.Invalid conversion request on %s.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.Internal error: No segment for %s.Failed to retrieve raid0 segments from %s.Cannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Internal error: Invalid data lvs for raid0 LV %s.Failed to allocate new raid0 segment for LV %s.Cannot convert striped LV %s with varying stripe count to raid0.Are you sure you want to convert %s back to the older %s type? [y/n]: Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to handle mirrors with more than %u devices.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: Name %s lags image part.Snapshot volume cannot be smaller than 3 chunks (%u extents, %s).an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Failed to sync local devices before deactivating origin LV %s.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.Internal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsitent external origin.Internal error: LV %s is not a thin pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message._rimage_metadata/segtype.cRemoving mirror log %s.Failed to remove mirror log.Adding %s to %s.Failed to add %s to %s.Setting new segtype for %s.Renaming %s to %s.Failed to allocate name.%s called on non-raid1 LV._rimage_0Rea--stripes-I/--stripesize-R/--regionsizeLV %s already has %u stripes.Too few stripes requested.Converting %s from %s to %s.Adjust data LVs of %s._mimage_Data LV renamed to %s.raid with integritylocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesFailed to resume %s.Added %s message.      _raid_reshape_remove_images_raid_reshapeNew size %lu for %s%s not an exact number of new extents.New extent count %lu for %s%s exceeds 32 bits.Couldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.Couldn't read 'mirror_count' for segment '%s'.Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.struct mirr_state allocation failedMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).Couldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Bad volume name in areas array for segment %s.Couldn't find volume '%s' for segment '%s'.Missing data device in areas array for segment %s.Incorrect number of areas in area array for segment '%s'.Failed to import RAID component pairs.mirror string list allocation failedWARNING: Failed to reserve memory, %d bytes missing.Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sInternal error: thin_pool_is_active called with non thin pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Thin pool discards type "%s" is unknown.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more then %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.Size of %s data volume cannot be smaller than chunk size %s.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).Preferred pool metadata size %s.Cannot use %s volume %s as external origin.Cannot use active LV for the external origin.Internal error: Unrecognized index state: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedSysinfo free:%llu bufferram:%llu sharedram:%llu freehigh:%llu unit:%u.Failing to parse value from %s. %s RAM for physical volume size %s%s %s RAM for virtual volume size %s%s %s RAM for block map cache size %s%sNot enough free memory for VDO target. %s RAM is required, but only %s RAM is available.VDO requires %s RAM, currently available %s RAM.Failed to allocate VG hostname hashtable.Failed to allocate volume group structureInternal error: global memory pool used for VG %sPhysical Extent size must be a multiple of %s when not a power of 2.Metadata format only supports Physical Extent sizes that are powers of 2.Extent size must be between %s and %sExtent size must be multiple of %sVolume group "%s" must be resizeable to change PE sizeNew extent size is not a perfect fitVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"Internal error: Missing command.Failed to sync local device names before forking.wait4 child process %u failed: %sInternal error: Unable to find configuration for %s options.Too many options for %s command.Invalid string in config file: global/%s_options.Failed to build device path for VDO formatting of data volume %s.Slab size %s converted to %u bits.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Using bigger VDO virtual size unaligned on extent size by %s.Rounding size up to 4,00 KiB VDO logical extent boundary: %s.Test mode: Skipping formatting of VDO pool volume.Cannot format VDO pool volume %s.Cannot deactivate formatted VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.Can't prepare vdo pool name for %s.Can't generate new name for %s.Aborting. Failed to wipe VDO data store %s.Names including "%s" are reserved. Please choose a different LV name.Names starting "%s" are reserved. Please choose a different LV name.Missing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Couldn't find mirror log uuid %s.Internal error: Name is too long.Failed to create udev library context.Lock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dSkipping %slocking of memory maps (running in VALGRIND).Raised task priority %d -> %d.WARNING: setpriority %d failed: %s.Entering critical section (%s).Entering prioritized section (%s).Restoring original task priority %d.WARNING: setpriority %u failed: %s.Unlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dInternal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference., perhaps skipped in lvm.conf volume_list?Cannot activate thin pool %s%sPool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Failed to suspend %s with queued messages.Failed to sync local devices LV %s.Unexpected errno: %d on lockfile open, returning runningUnexpected errno: %d on lockf, returning runningdbus damon not running, not notifyingorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %ddevice_countstripe_count Mirrors %umirror/mirrored.c Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations: Raid Data LV%2d Raid Metadata LV%2d %smirror_countextents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %uFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.raid0_lvsstripe_sizemin_recovery_ratemax_recovery_rateNo areas found for segment %s_rmeta_locale/locale-archiveUnlmunlockalllseekmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesraid0_lvstripe_count = %ustripe_size = %udevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %u has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupperformanceCropping metadata size to %s.nopassdownSetting chunk size to %s.Setting chunk size %s.Enabling%s pool zeroing on default.internalwritableclosedopeningclosingstatistics/data_blocks_usedasyncasync-unsafeUnknown VDO write policy %s.AnonPagesMemAvailableMemFreeMemTotalShmemSwapFree%s/meminfoParsed %s = %lu KiB. %s RAM for index memoryVDO configuration needs%s.Allocated VG %s at %p.Failed to allocate VG name.Freeing VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255misc/lvm-exec.cExecuting:%sforkexecvpChild %u exited abnormally%s failed: %uSTDINwaitpid--logical-size=%luK--slab-bits=%u--uds-memory-size=%u--uds-memory-size=0.%2u--uds-sparseCommand %s failed.Skipping VDO formatting %s._vdata%s_vpool%%dsync_dir failed in strdup%s: write error_undo_flock %sUnlocking %sflock_drop_shared_flock %s.SIG_SETMASKsigprocmasksigaction_block_signals_do_flock %s %c%cGiving up waiting for lock.pvmovelog uuid pool_strdup failedmisc/lvm-wrappers.cCould not get udev state.Assuming udev is not running.read_urandom: /dev/urandomLocking memory%s/self/mapsproc_dir too longgetprioritysuspendingUnlocking memory/var/lock/lvm/lvmdbusdLVM_DBUSD_LOCKFILEnotify/lvmnotify.cFailed to connect to dbus: %dcom.redhat.lvmdbus1Nofify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %s/LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libedit.so./libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./libzstd.so./etc/selinux===>>==D-Bus notification failed[vdso][vsyscall][vectors]pvmovesnapshot_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_vorigin0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- and,,@Cdevice_mapper/libdm-report.cqueueallocatableRaid transient status %s.raid0shrinkingrebuild+emptymetareshapingraid4Unsupported raid type %s.report/report.cFailed to get segtype name.time_now@%ld:@%ldlvname snprintf faileddm_pool_strdup failedunmanagedInternal error: Using string as sort value for numerical field.Active raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.Target raid does not support %s.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!raid module string list allocation failedalloc_time_item: dm_pool_zalloc faileddm_report_field_string: dm_pool_strdup failedInternal error: Unknown discards type encountered.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.Failed to allocate buffer for host.Failed to create cache for values used during reporting._get_now: failed to cache current time_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failed_get_now: dm_pool_zalloc failedFailed to get value for parsed time specification.Failed to allocate space to store time range.Failed to create list of writecache settings.modules str_list allocation failedNo lv_raid found for lv_image %s lv_iorig %sNo raid seg found for lv_raid %s lv_image %s lv_iorig %sNo raid health for seg area %u lv_raid %s lv_image %s lv_iorig %sraid health %c for seg area %u lv_raid %s lv_image %s lv_iorig %sNo seg area found for lv_raid %s lv_image %s lv_iorig %sNo lv_image found for lv_iorig %sFailed to allocate buffer for mode.Failed to allocate buffer for time.[Esdunknown01'*  ''''''''' !!" !##$ #%#&#' '( () )* *+,/)0)1)2)3)4)5)6)7)8)9):)cachecrypterrorlinearmirrorsnapshotsnapshot-originsnapshot-mergestriped zero writecache integrity thin-pool thinvdoraid0raid0_metaraid1raid10raid4raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6_n_6raid6_zrraid6_nrraid6_ncraid6_ls_6raid6_rs_6raid6_la_6 raid6_ra_6raid5raid6raid10_nearextendablepartialinitial image syncconvertingallocation lockedfixed minormerge failedsnapshot invalidlive table presentinactive table presentcheck neededskip activationhistoricalsnapshot-merge Device ID %uFailed to allocate buffer.writeableread-only-overridesharedimage syncedmergingactive locallyrefresh neededmismatches existwritemostlyout_of_datasnapshot/snapshot.cmerging_storecow_storestriped/striped.ccow_store = "%s"merging_store = "%s"thin_pool = "%s"transaction_id = %ludevice_id = %dexternal_origin = "%s"merge = "%s"snapshot-originzero/zero.c Stripes %u Stripe size %s Stripe size %u KB Stripe %d: Discards %s Thin count %u Transaction ID %lu Zero new blocks %sdiscards = "%s"zero_new_blocks = 1crop_metadata = %umessage%d {create = "%s"delete = %d# linearstripethin_poolexternal_originMissing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Thin pool delete %u.Thin pool create_%s %s.Missing thin pool uuid %s.abbrev_dup_uuid/uuid.cactive exclusivelyhexnew UUIDdataBlocksUsedlogicalBlocksUsedstatsVDO property %s = %lu%llu %llu %llu %lludevice_mapper/libdm-targets.c%llu %llu %sundefinedqueue when fullqueue if no spaceerror when fullerror if no spacero-overrider-overrideread-writeinactive tableinactivelive tableliveactive remotelyfixedundefdiscards_non_power_2metadata_resizeexternal_origin_extendUnique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Description of Device Type.Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.vg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Device Typesdevtype_Command LogInternal error: Unrecognized VDO write policy: %u.Failed to display layout for LV %s/%s.Failed to display role for LV %s/%s.Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Couldn't read 'stripe_count' for segment '%s'.Target snapshot may leak metadata.snapshot string list allocation failedString list allocation failed for thin_pool.String list allocation failed for thin.zero module string list allocation failedCouldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.Internal error: striped add_target_line called with no areas for %s.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.WARNING: Ignoring invalid string in config file %s.Internal error: Thin pool is missing metadata device.Thin pool target does not support %s chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.Failed to build uuid for pool LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Internal error: Segment %s has no pool.Internal error: Failed to add merged segment of %s.Device id %u is higher then %u.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.Missing thin external origin uuid %s.Delaying resume for new external origin %s.dm_report_set_output_field_name_prefix: dm_pool_strdup failedUUID contains invalid character '%c'Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.Failed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) failedWARNING: Failed to query uuid with LIST.Checking VDO pool stats message for LV %s.Internal error: Corrupted message structure returned: start %d > end %dInternal error: Message response doesn't contain terminating NUL characterCannot parse %s in VDO DM stats message.Get read ahead request failed: device name unrecorded.WARNING: Cannot find matching %s segment for %s.WARNING: Detected %s segment type does not match expected type %s for %s.Failed to parse writecache params: %s.Failed to parse integrity params: %s.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).Getting device info for %s [%s].Reserved value for undefined numeric value.Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronization log.For mirrors, the UUID of the LV holding the synchronization log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Use REQ_SYNC for writes (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can recieve (vdopool).Specified write policy (vdopool).Header size at front of vdopool.Physical Extent number of start of segment.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Logical Volume Device Info and Status Combinednoyes0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#global/thin_disabled_featuresthinthin-poolInternal error: _emit_target cannot handle segment type %s.Number of segments in active LV %s does not match metadata.Skipping %s callback registration for command %s.Internal error: Registering unsupported pool callback.Failed to allocated path for callback.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.WARNING: Check is skipped, please install recommended missing binary %s!Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Failed to add device (%u:%u) to dtree.Tracking pending delete for %s-%s (%s).Couldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't construct name of volume group directory.Interval string conversion got truncated.Failed to process request with error %s (errno: %d).%s not found in config: defaulting to "%s"WARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u).Using error for pending delete of %s-%s._add_new_lv_to_dtree: pool alloc failed for %s %s.%soaded thin volume %s with id %u is %smatching id %u.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened.Internal error: LV %s is not merging snapshot.Couldn't find snapshot origin uuid %s.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Skipping users for already added external origin LV %s.Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Using error for pending delete %s.sysfs_path dm_snprintf failed.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.Cached as present %s %s (%d:%d).Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Tracking pending delete for %s%s%s (%s).Aborting. LV %s is incomplete and --activationmode partial was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: _add_error_or_zero_device called with bad segment.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.No space to stack fs operationInternal error: Cannot create tree for %s.Partial dtree creation failed for %s._clean_tree: Couldn't split up device name %s.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s.Failed to create symlinks for %s._clean_tree: Failed to duplicate uuid.Sucessfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.Internal error: Use of lvmpolld requires uuid setInternal error: Use of lvmpolld requires vgname setInternal error: Use of lvmpolld requires lvname setAsking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Unsupported poll operationInternal error: use of lvmpolld requires uuid being setAsking lvmpolld for progress status of an operation on %s/%s.Failed to create progress_info request.No polling operation in progress regarding LV %s.Command executed by lvmpolld got terminated by signal (%d).LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.For more information see lvmpolld messages in syslog or lvmpolld log file.Polling finished successfully.Fail to allocate PV list for VG %sFail to allocate PV path for VG %sExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV %s name too long - extended size not zeroed.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.LV percent: %sdm_build_dm_name failed-cmeta%s/%s%slv_dmpath snprintf failedRunning check command on %s-Vbetterolderactivate/fs.c%s/groupCouldn't create path for %s.Removing %sLinking %s -> %ssymlinkRemoving link %sCreating directory %smkdirRemoving directory %sLVM_SYSTEM_DIRlvmpolld/lvmpolld-client.clvname = %svgname = %slvid = %scmdline = %sinterval = %sFailed to create %s request.abort = %ldhandle_missing_pvs = %ldsysdir = %sdevicesfile = %sCached as inactive %s.PrelAdding new LV %s%s%s to dtree%sblock/dm-%u/holdersCached as not present %s.dev_managermissing_%d_%dSyncing device names origin-onlyCreating %s%s tree for %s.Deleting tracked UUID %s. abortmerge_thinprogress_infoin_progressreasonsignalnot_foundpath_num = %ldFailed to create pvs request.path[%d] = %%sFail to any PVs for VG %sVG %s find PV device %sPRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANvg_name = %spid = %ldinit_vgvg_lock_type = %sVG %s init failed: %dvg_lock_argsvdo_poolvdo_offsetvdo_pool = "%s"vdo_offset = %u Virtual size %s Header size %sCompression %s %sDeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sUnknown logical volume %s.block_map_era_lengthheader_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sV%u %*s %lu %*u %uMissing VDO's data uuid %s.online_renameversion4dumpconfig.ccurrentdiffIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadataDumping configuration to %sFailure while writing to %sUnknown sector size %u.Failed to create internal lv.opts = %svg_lock_args = %sUnknown lock_type.start_initstart_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dinit_lvlv_uuid = %slv_name = %slv_lock_argslv_lock_args not returnedlockd global mode %slock_glRetrying %s global lockGlobal lock failed: error %dGlobal lock failed: error %d.lvextendlvresizelvchangeLocking failed for LV %s/%sRefresh lvmlockFailed to refresh %s.No vdo pool for %s/%sFailed to unlock LV %s/%s.free_vg_long_long_ARGcommand.cStringSelect--uuidstr prev ...lvcreatelvreduce -%c|%s (, %c%c [ --type %s ] (implied)[ --type %s|%s ] (implied) [ -l|--extents [ COMMON_OPTIONS ] [lvchange.cMonitoring LV %sUnmonitoring LV %sPolling LV %sdevtypesdumpconfigformatsfullreportDisplay full reporthelpDisplay help for commandslastlogChange logical volume layoutCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfigManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvspvscanList all physical volumessegtypesList available segment typessystemidvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplitThe name of a cache pool. The name of a cache volume. The size of cache to use. See \fBlvmreport\fP(7). No longer used. Display long help text. Output columns as rows. The name of a thin pool LV. Display version information. Display help text. Only report PVs. ERRy|n[+|-]Number[+]Numberpartial|degraded|completey|n|ayauto|1|2passdown|nopassdown|ignorecore|disk[+|-]Size[k|UNIT][+|-]Size[m|UNIT][+]Size[m|UNIT][-]Size[m|UNIT][+|-]Number[PERCENT][+]Number[PERCENT][-]Number[PERCENT]rw|rsanlock|dlm|noneauto|none|Numberall|unmanaged|NumberPV[:t|n|y]check|repairbasic|json|json_stdlog|vg|lv|pv|pvseg|segnone|abbrev|full|0|1|2Couldn't read '%s' for VDO segment.VG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: vg_write vg_commitVG %s init failed: lock_args alloc failedUnknown VDO pool logical volume %s.Internal error: Passed segment is not VDO type.Internal error: Passed segment is not VDO pool.Checking VDO pool table line for LV %s.Failed to parse VDO parameters %s for LV %s.WARNING: Unknown VDO table line version %u.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.String list allocation failed for VDO module.Only one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type list--valuesonly has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.Failed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree.# This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundUsing sector size %u for sanlock LVVG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leasesFailed to deactivate sanlock lv %s/%sVG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %s init %dFailed to activate sanlock lv %s/%sVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockdLock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedExclusive locks are not allowed with readonly option.Reading without shared global lock.Global lock failed: check that lvmlockd is running.lockd global mode %s already held.Start a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: storage failed for sanlock leasesSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: VG with global lock was removedSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedGlobal lock failed: held by other host.WARNING: shared LV may require refresh on other hosts where it is active.Shared activation not compatible with LV type %s of %s/%slockd LV %s/%s mode %s uuid %sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%sLV locked by other host: %s/%sWARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dLV locks are not allowed with readonly option.Lock on incorrect thin lv type %s/%sCannot find thin pool for %s/%sLock on incorrect vdo lv type %s/%sLV %s/%s must be inactive on all hosts.Cannot change VG %s with active LVsCannot free VG sanlock, lvmlockd is not in use.Cannot free VG sanlock, lvmlockd is not connected.Global lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_argsLockspace for "%s" not stopped on other hosts_free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.Parsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown lv type %s.Parsing command defs: unknown opt arg: %s.Parsing command defs: unknown pos arg: %s.Too many args, increase CMD_RO_ARGS.Too many args, increase CMD_OO_ARGS.Too many args, increase CMD_IO_ARGS.Parsing command defs: option %s must be followed by an arg.Parsing command defs: options must be specified in long form: %s.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: no OO line found for %s.Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Logical volume %s is not active.Failed to change monitoring for %s volume.Display and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume group#pvmove Abort any pvmove operations in progress. If a pvmove was started with the --atomic option, then all LVs will remain on the source PV. Otherwise, segments that have been moved will remain on the destination PV, while unmoved segments will remain on the source PV. #lvpoll Stop processing a poll operation in lvmpolld. Determines if LV activation is allowed when PVs are missing, e.g. because of a device failure. \fBcomplete\fP only allows LVs with no missing PVs to be activated, and is the most restrictive mode. \fBdegraded\fP allows RAID LVs with missing PVs to be activated. (This does not include the "mirror" type, see "raid1" instead.) \fBpartial\fP allows any LV with missing PVs to be activated, and should only be used for recovery or repair. For default, see \fBlvm.conf\fP(5) activation_mode. See \fBlvmraid\fP(7) for more information. Adds a tag to a PV, VG or LV. This option can be repeated to add multiple tags at once. See \fBlvm\fP(8) for information about tags. Add a device to the devices file. Remove a device from the devices file. When used alone, --deldev specifies a device name. When used with --deviceidtype, --deldev specifies a device id. Remove devices file entries with no matching device. Find a device with the PVID and add the device to the devices file. Remove a device with the PVID from the devices file. Use with --separator to align the output columns Determines the allocation policy when a command needs to allocate Physical Extents (PEs) from the VG. Each VG and LV has an allocation policy which can be changed with vgchange/lvchange, or overridden on the command line. \fBnormal\fP applies common sense rules such as not placing parallel stripes on the same PV. \fBinherit\fP applies the VG policy to an LV. \fBcontiguous\fP requires new PEs be placed adjacent to existing PEs. \fBcling\fP places new PEs on the same PV as existing PEs in the same stripe of the LV. If there are sufficient PEs for an allocation, but normal does not use them, \fBanywhere\fP will use them even if it reduces performance, e.g. by placing two stripes on the same PV. Optional positional PV args on the command line can also be used to limit which PVs the command will use for allocation. See \fBlvm\fP(8) for more information about allocation. Makes a pvmove operation atomic, ensuring that all affected LVs are moved to the destination PV, or none are if the operation is aborted. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). When configuration is displayed, the configuration settings recognized at this LVM version will be considered only. This can be used to display a configuration that a certain LVM version understands and which does not contain any newer settings for which LVM would issue a warning message when checking the configuration. This option is used when automatically importing devices for the root VG. The auto import is intended to be done once, on first boot, to create an initial system.devices file for the root VG. When this option is used, the vgimportdevices --rootvg command does nothing if system.devices exists, or the file auto-import-rootvg does not exist (both in the /etc/lvm/devices/ directory.) Specify if autoactivation is being used from an event. This allows the command to apply settings that are specific to event activation, such as device scanning optimizations using pvs_online files created by event-based pvscans. Set the autoactivation property on a VG or LV. Display the property with vgs or lvs "-o autoactivation". When the autoactivation property is disabled, the VG or LV will not be activated by a command doing autoactivation (vgchange, lvchange, or pvscan using -aay.) If autoactivation is disabled on a VG, no LVs will be autoactivated in that VG, and the LV autoactivation property has no effect. If autoactivation is enabled on a VG, autoactivation can be disabled for individual LVs. Use binary values "0" or "1" instead of descriptive literal values for columns that have exactly two valid values to report (not counting the "unknown" value which denotes that the value could not be determined). Reserve space for the bootloader between the LVM metadata area and the first PE. The bootloader area is reserved for bootloaders to embed their own data or metadata; LVM will not use it. The bootloader area begins where the first PE would otherwise be located. The first PE is moved out by the size of the bootloader area, and then moved out further if necessary to match the data alignment. The start of the bootloader area is always aligned, see also --dataalignment and --dataalignmentoffset. The bootloader area may be larger than requested due to the alignment, but it's never less than the requested size. To see the bootloader area start and size of an existing PV use pvs -o +pv_ba_start,pv_ba_size. #pvscan Scan one or more devices and record that they are online. #vgscan This option is no longer used. #lvscan This option is no longer used. Specifies the cache metadata format used by cache target. Specifies when writes to a cache LV should be considered complete. \fBwriteback\fP considers a write complete as soon as it is stored in the cache pool. \fBwritethough\fP considers a write complete only when it has been stored in both the cache pool and on the origin LV. While writethrough may be slower for writes, it is more resilient if something should happen to a device associated with the cache pool LV. With \fBpassthrough\fP, all reads are served from the origin LV (all reads miss the cache) and all writes are forwarded to the origin LV; additionally, write hits cause cache block invalidates. See \fBlvmcache\fP(7) for more information. The name of a device to use for a cache. Checks the content of the devices file. Reports incorrect device names or PVIDs for entries. The command profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. Controls whether compression is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Config settings for the command. These override \fBlvm.conf\fP(5) settings. The String arg uses the same format as \fBlvm.conf\fP(5), or may use section/field syntax. See \fBlvm.conf\fP(5) for more information about config. \fBcurrent\fP prints the config settings that would be applied to an lvm command (assuming the command does not override them on the command line.) This includes: settings that have been modified in lvm config files, settings that get their default values from config files, and default settings that have been uncommented in config files. \fBdefault\fP prints all settings with their default values. Changes made in lvm config files are not reflected in the output. Some settings get their default values internally, and these settings are printed as comments. Other settings get their default values from config files, and these settings are not printed as comments. \fBdiff\fP prints only config settings that have been modified from their default values in config files (the difference between current and default.) \fBfull\fP prints every setting uncommented and set to the current value, i.e. how it would be used by an lvm command. This includes settings modified in config files, settings that usually get defaults internally, and settings that get defaults from config files. \fBlist\fP prints all config names without values. \fBmissing\fP prints settings that are missing from the lvm config files. A missing setting that usually gets its default from config files is printed uncommented and set to the internal default. Settings that get their default internally and are not set in config files are printed commented with the internal default. \fBnew\fP prints config settings that have been added since the lvm version specified by --sinceversion. They are printed with their default values. \fBprofilable\fP prints settings with their default values that can be set from a profile. \fBprofilable-command\fP prints settings with their default values that can be set from a command profile. \fBprofilable-metadata\fP prints settings with their default values that can be set from a metadata profile. Also see \fBlvm.conf\fP(5). Align the start of a PV data area with a multiple of this number. To see the location of the first Physical Extent (PE) of an existing PV, use pvs -o +pe_start. In addition, it may be shifted by an alignment offset, see --dataalignmentoffset. Also specify an appropriate PE size when creating a VG. Shift the start of the PV data area by this additional offset. Controls whether deduplication is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Deletes a tag from a PV, VG or LV. This option can be repeated to delete multiple tags at once. See \fBlvm\fP(8) for information about tags. Detaches a metadata profile from a VG or LV. See \fBlvm.conf\fP(5) for more information about profiles. The type of device ID to use for the device. If the specified type is available for the device, then it will override the default type that lvm would use. Restricts the devices that are visible and accessible to the command. Devices not listed will appear to be missing. This option can be repeated, or accepts a comma separated list of devices. This overrides the devices file. A file listing devices that LVM should use. The file must exist in \fI#DEFAULT_SYS_DIR#/devices/\fP and is managed with the \fBlvmdevices\fP(8) command. This overrides the \fBlvm.conf\fP(5) \fBdevices/devicesfile\fP and \fBdevices/use_devicesfile\fP settings. Specifies how the device-mapper thin pool layer in the kernel should handle discards. \fBignore\fP causes the thin pool to ignore discards. \fBnopassdown\fP causes the thin pool to process discards itself to allow reuse of unneeded extents in the thin pool. \fBpassdown\fP causes the thin pool to process discards itself (like nopassdown) and pass the discards to the underlying device. See \fBlvmthin\fP(7) for more information. If set to no, the command will not attempt to use device-mapper. For testing and debugging. Dump headers and metadata from a PV for debugging and repair. Option values include: \fBheaders\fP to print and check LVM headers, \fBmetadata\fP to print or save the current text metadata, \fBmetadata_all\fP to list or save all versions of metadata, \fBmetadata_search\fP to list or save all versions of metadata, searching standard locations in case of damaged headers, \fBmetadata_area\fP to save an entire text metadata area to a file. Specifies thin pool behavior when data space is exhausted. When yes, device-mapper will immediately return an error when a thin pool is full and an I/O request requires space. When no, device-mapper will queue these I/O requests for a period of time to allow the thin pool to be extended. Errors are returned if no space is available after the timeout. (Also see dm-thin-pool kernel module option no_space_timeout.) See \fBlvmthin\fP(7) for more information. Force metadata restore even with thin pool LVs. Use with extreme caution. Most changes to thin metadata cannot be reverted. You may lose data if you restore metadata that does not match the thin pool kernel metadata precisely. Report/display foreign VGs that would otherwise be skipped. See \fBlvmsystemid\fP(7) for more information about foreign VGs. Control file system resizing when resizing an LV. \fBchecksize\fP: Check the fs size and reduce the LV if the fs is not using the reduced space (fs reduce is not needed.) If the reduced space is used by the fs, then do not resize the fs or LV, and return an error. (checksize only applies when reducing, and does nothing for extend.) \fBresize\fP: Resize the fs by calling the fs-specific resize command. This may also include mounting, unmounting, or running fsck. See --fsmode to control mounting behavior, and --nofsck to disable fsck. \fBresize_fsadm\fP: Use the old method of calling fsadm to handle the fs (deprecated.) Warning: this option does not prevent lvreduce from destroying file systems that are unmounted (or mounted if prompts are skipped.) \fBignore\fP: Resize the LV without checking for or handling a file system. Warning: using ignore when reducing the LV size may destroy the file system. Control file system mounting behavior for fs resize. \fBmanage\fP: Mount or unmount the fs as needed to resize the fs, and attempt to restore the original mount state at the end. \fBnochange\fP: Do not mount or unmount the fs. If mounting or unmounting is required to resize the fs, then do not resize the fs or the LV and fail the command. \fBoffline\fP: Unmount the fs if it is mounted, and resize the fs while it is unmounted. If mounting is required to resize the fs, then do not resize the fs or the LV and fail the command. Allows a polling operation to continue when PVs are missing, e.g. for repairs due to faulty devices. Type of headings to use in report output. \fBnone\fP or \fB0\fP: No headings. \fBabbrev\fP or \fB1\fP: Column name abbreviations. \fBfull\fP or \fB2\fP: Full column names. Exclude advanced configuration settings from the output. Ignore the local section. The local section should be defined in the lvmlocal.conf file, and should contain config settings specific to the local host which should not be copied to other hosts. Allows a command to continue with read-only metadata operations after locking failures. Do not interact with dmeventd unless --monitor is specified. Do not use this if dmeventd is already monitoring a device. Exclude unsupported configuration settings from the output. These settings are either used for debugging and development purposes only or their support is not yet complete and they are not meant to be used in production. The \fBcurrent\fP and \fBdiff\fP types include unsupported settings in their output by default, all the other types ignore unsupported settings. Add devices to the devices file. Record information in the systemd journal. This information is in addition to information enabled by the lvm.conf log/journal setting. command: record information about the command. output: record the default command output. debug: record full command debugging. By default the PV is labelled with an LVM2 identifier in its second sector (sector 1). This lets you use a different sector near the start of the disk (between 0 and 3 inclusive - see LABEL_SCAN_SECTORS in the source). Use with care. Print a list of LVs that use the device. Print the VG that uses the device. Check if all the devices used by a VG or LV are present, and print "complete" or "incomplete" for each listed VG or LV. This option is used as a part of event-based autoactivation, so pvscan will do nothing if this option is set and event_activation=0 in the config settings. Used to pass options for special cases to lvmlockd. See \fBlvmlockd\fP(8) for more information. Start the lockspace of a shared VG in lvmlockd. lvmlockd locks becomes available for the VG, allowing LVM to use the VG. See \fBlvmlockd\fP(8) for more information. Stop the lockspace of a shared VG in lvmlockd. lvmlockd locks become unavailable for the VG, preventing LVM from using the VG. See \fBlvmlockd\fP(8) for more information. #vgchange Change the VG lock type to or from a shared lock type used with lvmlockd. See \fBlvmlockd\fP(8) for more information. #vgcreate Specify the VG lock type directly in place of using --shared. See \fBlvmlockd\fP(8) for more information. Suppress command report and display only log report. Change the VG system ID if the majority of PVs in the VG are present (one more than half). Sets the maximum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. An alias for --mergethin, --mergemirrors, or --mergesnapshot, depending on the type of LV. Merge LV images that were split from a raid1 LV. See --splitmirrors with --trackchanges. Merge COW snapshot LV into its origin. When merging a snapshot, if both the origin and snapshot LVs are not open, the merge will start immediately. Otherwise, the merge will start the first time either the origin or snapshot LV are activated and both are closed. Merging a snapshot into an origin that cannot be closed, for example a root filesystem, is deferred until the next time the origin volume is activated. When merging starts, the resulting LV will have the origin's name, minor number and UUID. While the merge is in progress, reads or writes to the origin appear as being directed to the snapshot being merged. When the merge finishes, the merged snapshot is removed. Multiple snapshots may be specified on the command line or a @tag may be used to specify multiple snapshots be merged to their respective origin. Merge thin LV into its origin LV. The origin thin LV takes the content of the thin snapshot, and the thin snapshot LV is removed. See \fBlvmthin\fP(7) for more information. When the command is run with --config and/or --commandprofile (or using LVM_COMMAND_PROFILE environment variable), --profile, or --metadataprofile, merge all the contents of the "config cascade" before displaying it. Without merging, only the configuration at the front of the cascade is displayed. See \fBlvm.conf\fP(5) for more information about config. Specifies the metadataignore property of a PV. If yes, metadata areas on the PV are ignored, and lvm will not store metadata in the metadata areas of the PV. If no, lvm will store metadata on the PV. The metadata profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. The approximate amount of space used for each VG metadata area. The size may be rounded. #lvcreate #lvchange Sets the minor number of an LV block device. #pvscan The minor number of a device. Sets the minimum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. Specifies the type of mirror log for LVs with the "mirror" type (does not apply to the "raid1" type.) \fBdisk\fP is a persistent log and requires a small amount of storage space, usually on a separate device from the data being mirrored. \fBcore\fP is not persistent; the log is kept only in memory. In this case, the mirror must be synchronized (by copying LV data from the first device to others) each time the LV is activated, e.g. after reboot. \fBmirrored\fP is a persistent log that is itself mirrored, but should be avoided. Instead, use the raid1 type for log redundancy. Only remove missing PVs from mirror LVs. Also checks the LVM special files in /dev that are needed for active LVs and creates any missing ones and removes unused ones. Start (yes) or stop (no) monitoring an LV with dmeventd. dmeventd monitors kernel events for an LV, and performs automated maintenance for the LV in response to specific events. See \fBdmeventd\fP(8) for more information. Add an "LVM2_" prefix plus the field name to the output. Useful with --noheadings to produce a list of field=value pairs that can be used to set environment variables (for example, in udev rules). Suppress the headings line that is normally the first line of output. Useful if grepping the output. Do not use the hints file to locate devices for PVs. A command may read more devices to find PVs when hints are not used. The command will still perform standard hint file invalidation where appropriate. Do not record history of LVs being removed. This has no effect unless the configuration setting metadata/record_lvs_history is enabled. Disable locking. Use with caution, concurrent commands may produce incorrect results. In conjunction with --uuid, this allows a uuid to be specified without also requiring that a backup of the metadata be provided. Suppress the suffix on output sizes. Use with --units (except h and H) if processing the output. Causes the creation of mirror, raid1, raid4, raid5 and raid10 to skip the initial synchronization. In case of mirror, raid1 and raid10, any data written afterwards will be mirrored, but the original contents will not be copied. In case of raid4 and raid5, no parity blocks will be written, though any data written afterwards will cause parity blocks to be stored. This is useful for skipping a potentially long and resource intensive initial sync of an empty mirror/raid1/raid4/raid5 and raid10 LV. This option is not valid for raid6, because raid6 relies on proper parity (P and Q Syndromes) being created during initial synchronization in order to reconstruct proper user date in case of device failures. raid0 and raid0_meta do not provide any data copies or parity support and thus do not support initial synchronization. Send a notification to D-Bus. The command will exit with an error if LVM is not built with support for D-Bus notification, or if the notify_dbus config setting is disabled. Disables udev synchronization. The process will not wait for notification from udev. It will continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. Specifies the name to use for the external origin LV when converting an LV to a thin LV. The LV being converted becomes a read-only external origin with this name. Overrides the automatically detected size of the PV. Use with care, or prior to reducing the physical size of the device. Specifies command specific settings in "Key = Value" form. Combine multiple settings in quotes, or repeat the settings option for each. When yes, start the background transformation of an LV. An incomplete transformation, e.g. pvmove or lvconvert interrupted by reboot or crash, can be restarted from the last checkpoint with --poll y. When no, background transformation of an LV will not occur, and the transformation will not complete. It may not be appropriate to immediately poll an LV after activation, in which case --poll n can be used to defer polling until a later --poll y command. The command to perform from lvmpolld. Use VDO type volume for pool data volume. The name of a an LV to use for storing pool metadata. #lvcreate #lvconvert Specifies the size of the new pool metadata LV. #lvresize #lvextend Specifies the new size of the pool metadata LV. The plus prefix \fB+\fP can be used, in which case the value is added to the current size. Enable or disable the automatic creation and management of a spare pool metadata LV in the VG. A spare metadata LV is reserved space that can be used when repairing a pool. An alias for --commandprofile or --metadataprofile, depending on the command. The number of metadata areas to set aside on a PV for storing VG metadata. When 2, one copy of the VG metadata is stored at the front of the PV and a second copy is stored at the end. When 1, one copy of the VG metadata is stored at the front of the PV. When 0, no copies of the VG metadata are stored on the given PV. This may be useful in VGs containing many PVs (this places limitations on the ability to use vgsplit later.) Enable or disable data integrity checksums for raid images. The block size to use for dm-integrity on raid images. The integrity block size should usually match the device logical block size, or the file system block size. It may be less than the file system block size, but not less than the device logical block size. Possible values: 512, 1024, 2048, 4096. Use a journal (default) or bitmap for keeping integrity checksums consistent in case of a crash. The bitmap areas are recalculated after a crash, so corruption in those areas would not be detected. A journal does not have this problem. The journal mode doubles writes to storage, but can improve performance for scattered writes packed into a single journal write. bitmap mode can in theory achieve full write throughput of the device, but would not benefit from the potential scattered write optimization. Prevent the command from making changes, including activation and metadata updates. #lvmdevices Search for missing PVs on new devices, and update the devices file with new device IDs for the PVs if they are found on new devices. This is useful if PVs have been moved to new devices with new WWIDs, for example. The device ID type and name may both change for a PV. WARNING: if a PV is detached from the system, but a device containing a clone or snapshot of that PV is present, then refresh would replace the correct device ID with the clone/snapshot device ID, and lvm would begin using the wrong device for the PV. Use deldev/adddev to safely change a PV device ID in this scenario. #vgchange #lvchange #vgmknodes If the LV is active, reload its metadata. This is not necessary in normal operation, but may be useful if something has gone wrong, or if some form of manual LV sharing is being used. Removes all missing PVs from the VG, if there are no LVs allocated on them. This resumes normal operation of the VG (new LVs may again be created, changed and so on). If this is not possible because LVs are referencing the missing PVs, this option can be combined with --force to have the command remove any partial LVs. In this case, any LVs and dependent snapshots that were partly on the missing disks are removed completely, including those parts on disks that are still present. If LVs spanned several disks, including ones that are lost, salvaging some data first may be possible by activating LVs in partial mode. Selects a PV to rebuild in a raid LV. Multiple PVs can be rebuilt by repeating this option. Use this option in place of --resync or --syncaction repair when the PVs with corrupted data are known, and their data should be reconstructed rather than reconstructing default (rotating) data. See \fBlvmraid\fP(7) for more information. #lvconvert Replace failed PVs in a raid or mirror LV, or run a repair utility on a thin pool. See \fBlvmraid\fP(7) and \fBlvmthin\fP(7) for more information. #pvck Repair headers and metadata on a PV. Repair headers and metadata on a PV. See command description. Replace a specific PV in a raid LV with another PV. The new PV to use can be optionally specified after the LV. Multiple PVs can be replaced by repeating this option. See \fBlvmraid\fP(7) for more information. Overrides current output format for reports which is defined globally by the report/output_format setting in \fBlvm.conf\fP(5). \fBbasic\fP is the original format with columns and rows. If there is more than one report per command, each report is prefixed with the report name for identification. \fBjson\fP produces report output in JSON format. \fBjson_std\fP produces report output in JSON format which is more compliant with JSON standard. See \fBlvmreport\fP(7) for more information. In conjunction with --uuid, this reads the file (produced by vgcfgbackup), extracts the location and size of the data on the PV, and ensures that the metadata produced by the program is consistent with the contents of the file, i.e. the physical extents will be in the same place and not be overwritten by new metadata. This provides a mechanism to upgrade the metadata format or to add/remove metadata areas. Use with care. Add a PV back into a VG after the PV was missing and then returned, e.g. due to a transient failure. The PV is not reinitialized. Initiates mirror synchronization. Synchronization generally happens automatically, but this option forces it to run. Also see --rebuild to synchronize a specific PV. During synchronization, data is read from the primary mirror device and copied to the others. This can take considerable time, during which the LV is without a complete redundant copy of the data. See \fBlvmraid\fP(7) for more information. Import devices used for the root VG. #pvs Produces one line of output for each contiguous allocation of space on each PV, showing the start (pvseg_start) and length (pvseg_size) in units of physical extents. #lvs Use default columns that emphasize segment information. String to use to separate each column. Useful if grepping the output. #vgcreate Create a shared VG using lvmlockd if LVM is compiled with lockd support. lvmlockd will select lock type sanlock or dlm depending on which lock manager is running. This allows multiple hosts to share a VG on shared devices. lvmlockd and a lock manager must be configured and running. See \fBlvmlockd\fP(8) for more information about shared VGs. #vgs #lvs #pvs #fullreport #vgdisplay #lvdisplay #pvdisplay Report/display shared VGs that would otherwise be skipped when lvmlockd is not being used on the host. See \fBlvmlockd\fP(8) for more information about shared VGs. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). This option is currently applicable only with --typeconfig new to display all configuration settings introduced since given version. Separates a cache pool from a cache LV, and keeps the unused cache pool LV. Before the separation, the cache is flushed. Also see --uncache. Splits the specified number of images from a raid1 or mirror LV and uses them to create a new LV. If --trackchanges is also specified, changes to the raid1 LV are tracked while the split LV remains detached. If --name is specified, then the images are permanently split from the original LV and changes are not tracked. Separates a COW snapshot from its origin LV. The LV that is split off contains the chunks that differ from the origin LV along with metadata describing them. This LV can be wiped and then destroyed with lvremove. Include deprecated configuration settings in the output. These settings are deprecated after a certain version. If a concrete version is specified with --atversion, deprecated settings are automatically included if the specified version is lower than the version in which the settings were deprecated. The current and diff types include deprecated settings in their output by default, all the other types ignore deprecated settings. Include unsupported configuration settings in the output. These settings are either used for debugging or development purposes only, or their support is not yet complete and they are not meant to be used in production. The current and diff types include unsupported settings in their output by default, all the other types ignore unsupported settings. Start polling an LV to continue processing a conversion. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not apply to existing allocated space, only newly allocated space can be striped. Extracts the metadata LV from a pool and replaces it with another specified LV. The extracted LV is preserved and given the name of the LV that replaced it. Use for repair only. When the metadata LV is swapped out of the pool, it can be activated directly and used with thin provisioning tools: \fBcache_dump\fP(8), \fBcache_repair\fP(8), \fBcache_restore\fP(8), \fBthin_dump\fP(8), \fBthin_repair\fP(8), \fBthin_restore\fP(8). Initiate different types of RAID synchronization. This causes the RAID LV to read all data and parity blocks in the array and check for discrepancies (mismatches between mirrors or incorrect parity values). \fBcheck\fP will count but not correct discrepancies. \fBrepair\fP will correct discrepancies. See \fBlvs\fP(8) for reporting discrepancies found or repaired. Indicates that vgchange/lvchange is being invoked from early system initialisation scripts (e.g. rc.sysinit or an initrd), before writable filesystems are available. As such, some functionality needs to be disabled and this option acts as a shortcut which selects an appropriate set of options. Currently, this is equivalent to using --ignorelockingfailure, --ignoremonitoring, --poll n, and setting env var LVM_SUPPRESS_LOCKING_FAILURE_MESSAGES. vgchange/lvchange skip autoactivation, and defer to pvscan autoactivation. #vgcreate Specifies the system ID that will be given to the new VG, overriding the system ID of the host running the command. A VG is normally created without this option, in which case the new VG is given the system ID of the host creating it. Using this option requires caution because the system ID of the new VG may not match the system ID of the host running the command, leaving the VG inaccessible to the host. See \fBlvmsystemid\fP(7) for more information. #vgchange Changes the system ID of the VG. Using this option requires caution because the VG may become foreign to the host running the command, leaving the host unable to access it. See \fBlvmsystemid\fP(7) for more information. Can be used with --splitmirrors on a raid1 LV. This causes changes to the original raid1 LV to be tracked while the split images remain detached. This is a temporary state that allows the read-only detached image to be merged efficiently back into the raid1 LV later. Only the regions with changed data are resynchronized during merge. While a raid1 LV is tracking changes, operations on it are limited to merging the split image (see --mergemirrors) or permanently splitting the image (see --splitmirrors with --name. The LV type, also known as "segment type" or "segtype". See usage descriptions for the specific ways to use these types. For more information about redundancy and performance (\fBraid\fP, \fBmirror\fP, \fBstriped\fP, \fBlinear\fP) see \fBlvmraid\fP(7). For thin provisioning (\fBthin\fP, \fBthin-pool\fP) see \fBlvmthin\fP(7). For performance caching (\fBcache\fP, \fBcache-pool\fP) see \fBlvmcache\fP(7). For copy-on-write snapshots (\fBsnapshot\fP) see usage definitions. For VDO (\fBvdo\fP) see \fBlvmvdo\fP(7). Several commands omit an explicit type option because the type is inferred from other options or shortcuts (e.g. --stripes, --mirrors, --snapshot, --virtualsize, --thin, --cache, --vdo). Use inferred types with care because it can lead to unexpected results. Command output is modified to be imported from a udev rule. Produce output immediately without sorting or aligning the columns properly. Separates a cache pool from a cache LV, and deletes the unused cache pool LV. Before the separation, the cache is flushed. Also see --splitcache. Update the content of the devices file. Specifies the cache policy for a cache LV. See \fBlvmcache\fP(7) for more information. Specifies tunable kernel options for dm-cache or dm-writecache LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --cachesettings for each option being set. These settings override the default kernel behaviors which are usually adequate. To remove cachesettings and revert to the default kernel behaviors, use --cachesettings 'default' for dm-cache or an empty string --cachesettings '' for dm-writecache. See \fBlvmcache\fP(7) for more information. Internal option used for generating config file during build. All sizes are output in these units: human-(r)eadable with '<' rounding indicator, (h)uman-readable, (b)ytes, (s)ectors, (k)ilobytes, (m)egabytes, (g)igabytes, (t)erabytes, (p)etabytes, (e)xabytes. Capitalise to use multiples of 1000 (S.I.) instead of 1024. Custom units can be specified, e.g. --units 3M. When used with --nameprefixes, output values in the field=value pairs are not quoted. Perform an operation according to the policy configured in \fBlvm.conf\fP(5) or a profile. Validate current configuration used and exit with appropriate return code. The validation is done only for the configuration at the front of the "config cascade". To validate the whole merged configuration tree, also use --mergedconfig. The validation is done even if \fBlvm.conf\fP(5) \fBconfig/checks\fP is disabled. When printing config settings, print only values without keys. Specifies the command is handling VDO LV. See --type vdo. See \fBlvmvdo\fP(7) for more information about VDO usage. The name of a VDO pool LV. See \fBlvmvdo\fP(7) for more information about VDO usage. Specifies tunable VDO options for VDO LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --vdosettings for each option being set. These settings override the default VDO behaviors. To remove vdosettings and revert to the default VDO behaviors, use --vdosettings 'default'. See \fBlvmvdo\fP(7) for more information. Number of copies of the VG metadata that are kept. VG metadata is kept in VG metadata areas on PVs in the VG, i.e. reserved space at the start and/or end of the PVs. Keeping a copy of the VG metadata on every PV can reduce performance in VGs containing a large number of PVs. When this number is set to a non-zero value, LVM will automatically choose PVs on which to store metadata, using the metadataignore flags on PVs to achieve the specified number. The number can also be replaced with special string values: \fBunmanaged\fP causes LVM to not automatically manage the PV metadataignore flags. \fBall\fP causes LVM to first clear the metadataignore flags on all PVs, and then to become unmanaged. The first command to see a complete VG will report it uniquely. Other commands to see the complete VG will report it differently. Display a one line comment for each configuration node. Display a full comment for each configuration node. For deprecated settings, also display comments about deprecation. Include general config file preamble. Include local config file preamble. Where appropriate, add more spaces in output for better readability. Also display a comment containing the version of introduction for each configuration node. If the setting is deprecated, also display the version since which it is deprecated. The maximum number of outstanding writes that are allowed to devices in a RAID1 LV that is marked write-mostly. Once this value is exceeded, writes become synchronous (i.e. all writes to the constituent devices must complete before the array signals the write has completed). Setting the value to zero clears the preference and allows the system to choose the value arbitrarily. Mark a device in a RAID1 LV as write-mostly. All reads to these drives will be avoided unless absolutely necessary. This keeps the number of I/Os to the drive to a minimum. The default behavior is to set the write-mostly attribute for the specified PV. It is also possible to remove the write-mostly flag by adding the suffix \fB:n\fP at the end of the PV name, or to toggle the value with the suffix \fB:t\fP. Repeat this option to change the attribute on multiple PVs. #pvscan Auto-activate LVs in a VG when the PVs scanned have completed the VG. (Only \fBay\fP is applicable.) #lvchange #vgchange Change the active state of LVs. An active LV can be used through a block device, allowing data on the LV to be accessed. \fBy\fP makes LVs active, or available. \fBn\fP makes LVs inactive, or unavailable. The block device for the LV is added or removed from the system using device-mapper in the kernel. A symbolic link /dev/VGName/LVName pointing to the device node is also added/removed. All software and scripts should access the device through the symbolic link and present this as the name of the device. The location and name of the underlying device node may depend on the distribution, configuration (e.g. udev), or release version. \fBay\fP specifies autoactivation, which is used by system-generated activation commands. By default, LVs are autoactivated. An autoactivation property can be set on a VG or LV to disable autoactivation, see --setautoactivation y|n in vgchange, lvchange, vgcreate, and lvcreate. Display the property with vgs or lvs "-o autoactivation". The \fBlvm.conf\fP(5) auto_activation_volume_list includes names of VGs or LVs that should be autoactivated, and anything not listed is not autoactivated. When auto_activation_volume_list is undefined (the default), it has no effect. If auto_activation_volume_list is defined and empty, no LVs are autoactivated. Items included by auto_activation_volume_list will not be autoactivated if the autoactivation property has been disabled. See \fBlvmlockd\fP(8) for more information about activation options \fBey\fP and \fBsy\fP for shared VGs. #lvcreate Controls the active state of the new LV. \fBy\fP makes the LV active, or available. New LVs are made active by default. \fBn\fP makes the LV inactive, or unavailable, only when possible. In some cases, creating an LV requires it to be active. For example, COW snapshots of an active origin LV can only be created in the active state (this does not apply to thin snapshots). The --zero option normally requires the LV to be active. If autoactivation \fBay\fP is used, the LV is only activated if it matches an item in \fBlvm.conf\fP(5) \fBactivation/auto_activation_volume_list\fP. \fBay\fP implies --zero n and --wipesignatures n. See \fBlvmlockd\fP(8) for more information about activation options for shared VGs. #vgreduce Removes all empty PVs if none are named on the command line. #pvchange Change all visible PVs. #vgimport Import all visible VGs. #lvscan #lvdisplay #lvs Show information about internal LVs. These are components of normal LVs, such as mirrors, which are not independently accessible, e.g. not mountable. #vgs List all VGs. Equivalent to not specifying any VGs. #pvs #pvdisplay Show information about devices that have not been initialized by LVM, i.e. they are not PVs. Specifies if metadata should be backed up automatically after a change. Enabling this is strongly advised! See \fBvgcfgbackup\fP(8) for more information. Only select active VGs. The VG is considered active if at least one of its LVs is active. #pvs Show information about PVs outside the devices file. Combine with -a|--all to include devices that are not PVs. #pvscan Show information about PVs outside the devices file. Displays the device ID for PVs included in the devices file. If the operation requires polling, this option causes the command to return before the operation is complete, and polling is done in the background. By default the snapshot VG will be renamed to the original name plus a numeric suffix to avoid duplicate naming (e.g. 'test_vg' would be renamed to 'test_vg1'). This option will override the base VG name that is used for all VG renames. If a VG already exists with the specified name a numeric suffix will be added (like the previous example) to make it unique. The size of chunks in a snapshot, cache pool or thin pool. For snapshots, the value must be a power of 2 between 4 KiB and 512 KiB and the default value is 4. For a cache pool the value must be between 32 KiB and 1 GiB and the default value is 64. For a thin pool the value must be between 64 KiB and 1 GiB and the default value starts with 64 and scales up to fit the pool metadata size within 128 MiB, if the pool metadata size is not specified. The value must be a multiple of 64 KiB. See \fBlvmthin\fP(7) and \fBlvmcache\fP(7) for more information. This option was specific to clvm and is now replaced by the --shared option with \fBlvmlockd\fP(8). Generate colon separated output for easier parsing in scripts or programs. Also see \fBvgs\fP(8) which provides considerably more control over the output. Display output in columns, the equivalent of \fBvgs\fP(8). Options listed are the same as options given in \fBvgs\fP(8). Sets or resets the contiguous allocation policy for LVs. Default is no contiguous allocation based on a next free principle. It is only possible to change a non-contiguous allocation policy to contiguous if all of the allocated physical extents in the LV are already contiguous. Set debug level. Repeat from 1 to 6 times to increase the detail of messages sent to the log file and/or syslog (if configured). Only show PVs belonging to exported VGs. #pvck Metadata file to read or write. #lvmconfig #dumpconfig #config Write output to the named file. #vgcfgbackup Write the backup to the named file. When backing up more than one VG, the file name is treated as a template, and %s is replaced by the VG name. #vgcfgrestore Read metadata backup from the named file. Usually this file was created by vgcfgbackup. Override various checks, confirmations and protections. Use with extreme caution. Specifies the command is handling a cache LV or cache pool. See --type cache and --type cache-pool. See \fBlvmcache\fP(7) for more information about LVM caching. Include historical LVs in the output. (This has no effect unless LVs were removed while \fBlvm.conf\fP(5) \fBmetadata/record_lvs_history\fP was enabled. Import exported VGs. Otherwise VGs that have been exported will not be changed (nor will their associated PVs). Report progress at regular intervals. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not change existing allocated space, but only applies to space being allocated by the command. When creating a RAID 4/5/6 LV, this number does not include the extra devices that are required for parity. The largest number depends on the RAID type (raid0: 64, raid10: 32, raid4/5: 63, raid6: 62), and when unspecified, the default depends on the RAID type (raid0: 2, raid10: 2, raid4/5: 3, raid6: 5.) To stripe a new raid LV across all PVs by default, see \fBlvm.conf\fP(5) \fBallocation/raid_stripe_all_devices\fP. The amount of data that is written to one device before moving to the next in a striped LV. Sets the maximum number of LVs allowed in a VG. #lvcreate Specifies the size of the new LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. #lvreduce #lvextend #lvresize Specifies the new size of the LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. #lvmconfig #dumpconfig #config List config settings with summarizing comment. This is the same as using options --typeconfig list --withsummary. #vgcfgrestore List metadata backup and archive files pertaining to the VG. May be used with --file. Does not restore the VG. #vgmerge Display merged destination VG like vgdisplay -v. #lvcreate Specifies the size of the new LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. #lvreduce #lvextend #lvresize Specifies the new size of the LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. When yes, makes the specified minor number persistent. #lvcreate #lvchange Sets the major number of an LV block device. #pvscan The major number of a device. Persistently sets (yes) or clears (no) the "activation skip" flag on an LV. An LV with this flag set is not activated unless the --ignoreactivationskip option is used by the activation command. This flag is set by default on new thin snapshot LVs. The flag is not applied to deactivation. The current value of the flag is indicated in the lvs lv_attr bits. Ignore the "activation skip" LV flag during activation to allow LVs with the flag set to be activated. #lvdisplay Display the mapping of logical extents to PVs and physical extents. To map physical extents to logical extents use: pvs --segments -o+lv_name,seg_start_pe,segtype #pvdisplay Display the mapping of physical extents to LVs and logical extents. #lvcreate Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. See the --nosync option for avoiding initial image synchronization. See \fBlvmraid\fP(7) for more information. #lvconvert Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. The plus prefix \fB+\fP can be used, in which case the number is added to the current number of images, or the minus prefix \fB-\fP can be used, in which case the number is subtracted from the current number of images. See \fBlvmraid\fP(7) for more information. #lvextend Not used. Specifies the type of on-disk metadata to use. \fBlvm2\fP (or just \fB2\fP) is the current, standard format. \fBlvm1\fP (or just \fB1\fP) is no longer used. #lvcreate #lvconvert Specifies the name of a new LV. When unspecified, a default name of "lvol#" is generated, where # is a number generated by LVM. #pvmove Move only the extents belonging to the named LV. #vgsplit Move only PVs used by the named LV. Do not perform fsck when resizing the file system with --resizefs. Only show PVs not belonging to any VG. Comma-separated, ordered list of fields to display in columns. String arg syntax is: [\fB+\fP|\fB-\fP|\fB#\fP]\fIField1\fP[\fB,\fP\fIField2\fP ...] The prefix \fB+\fP will append the specified fields to the default fields, \fB-\fP will remove the specified fields from the default fields, and \fB#\fP will compact specified fields (removing them when empty for all rows.) Use \fB-o help\fP to view the list of all available fields. Use separate lists of fields to add, remove or compact by repeating the -o option: -o+field1,field2 -o-field3,field4 -o#field5. These lists are evaluated from left to right. Use field name \fBlv_all\fP to view all LV fields, \fBvg_all\fP all VG fields, \fBpv_all\fP all PV fields, \fBpvseg_all\fP all PV segment fields, \fBseg_all\fP all LV segment fields, and \fBpvseg_all\fP all PV segment columns. See the \fBlvm.conf\fP(5) report section for more config options. See \fBlvmreport\fP(7) for more information about reporting. Comma-separated ordered list of columns to sort by. Replaces the default selection. Precede any column with \fB-\fP for a reverse sort on that column. Sets the maximum number of PVs that can belong to the VG. The value 0 removes any limitation. For large numbers of PVs, also see options --pvmetadatacopies, and --vgmetadatacopies for improving performance. Set access permission to read only \fBr\fP or read and write \fBrw\fP. Commands will do their best to activate LVs with missing PV extents. Missing extents may be replaced with error or zero segments according to the missing_stripe_filler setting. Metadata may not be changed with this option. Suppress output and log messages. Overrides --debug and --verbose. Repeat once to also suppress any prompts with answer 'no'. Sets read ahead sector count of an LV. \fBauto\fP is the default which allows the kernel to choose a suitable value automatically. \fBnone\fP is equivalent to zero. Resize the fs using the fs-specific resize command. May include mounting, unmounting, or running fsck. See --fsmode to control mounting behavior, and --nofsck to disable fsck. See --fs for more options (--resizefs is equivalent to --fs resize.) Size of each raid or mirror synchronization region. \fBlvm.conf\fP(5) \fBactivation/raid_region_size\fP can be used to configure a default. #vgcreate Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128 KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. #vgchange Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128 KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. Before increasing the physical extent size, you might need to use lvresize, pvresize and/or pvmove so that everything fits. For example, every contiguous range of extents used in a LV must start and end on an extent boundary. #lvcreate Create a snapshot. Snapshots provide a "frozen image" of an origin LV. The snapshot LV can be used, e.g. for backups, while the origin LV continues to be used. This option can create a COW (copy on write) snapshot, or a thin snapshot (in a thin pool.) Thin snapshots are created when the origin is a thin LV and the size option is NOT specified. Thin snapshots share the same blocks in the thin pool, and do not allocate new space from the VG. Thin snapshots are created with the "activation skip" flag, see --setactivationskip. A thin snapshot of a non-thin "external origin" LV is created when a thin pool is specified. Unprovisioned blocks in the thin snapshot LV are read from the external origin LV. The external origin LV must be read-only. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. COW snapshots are created when a size is specified. The size is allocated from space in the VG, and is the amount of space that can be used for saving COW blocks as writes occur to the origin or snapshot. The size chosen should depend upon the amount of writes that are expected; often 20% of the origin LV is enough. If COW space runs low, it can be extended with lvextend (shrinking is also allowed with lvreduce.) A small amount of the COW snapshot LV size is used to track COW block locations, so the full size is not available for COW data blocks. Use lvs to check how much space is used, and see --monitor to to automatically extend the size to avoid running out of space. #lvconvert Combine a former COW snapshot LV with a former origin LV to reverse a previous --splitsnapshot command. #pvdisplay Only display the size of the given PVs. #vgdisplay Give a short listing showing the existence of VGs. #pvscan Short listing format. Select objects for processing and reporting based on specified criteria. The criteria syntax is described by \fB--select help\fP and \fBlvmreport\fP(7). For reporting commands, one row is displayed for each object matching the criteria. See \fB--options help\fP for selectable object fields. Rows can be displayed with an additional "selected" field (-o selected) showing 1 if the row matches the selection and 0 otherwise. For non-reporting commands which process LVM entities, the selection is used to choose items to process. Run in test mode. Commands will not update metadata. This is implemented by disabling all metadata writing but nevertheless returning success to the calling function. This may lead to unusual error messages in multi-stage operations if a tool relies on reading back metadata it believes has changed but hasn't. Specifies the command is handling a thin LV or thin pool. See --type thin, --type thin-pool, and --virtualsize. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Update VG metadata to correct problems. If VG metadata was updated while a PV was missing, and the PV reappears with an old version of metadata, then this option (or any other command that writes metadata) will update the metadata on the previously missing PV. If a PV was removed from a VG while it was missing, and the PV reappears, using this option will clear the outdated metadata from the previously missing PV. If metadata text is damaged on one PV, using this option will replace the damaged metadata text. For more severe damage, e.g. with headers, see \fBpvck\fP(8). #pvchange Generate new random UUID for specified PVs. #pvscan Show UUIDs in addition to device names. #vgchange Generate new random UUID for specified VGs. Specify a UUID for the device. Without this option, a random UUID is generated. This option is needed before restoring a backup of LVM metadata onto a replacement device; see \fBvgcfgrestore\fP(8). As such, use of --restorefile is compulsory unless the --norestorefile is used. All PVs must have unique UUIDs, and LVM will prevent certain operations if multiple devices are seen with the same UUID. See \fBvgimportclone\fP(8) for more information. Set verbose level. Repeat from 1 to 4 times to increase the detail of messages sent to stdout and stderr. The virtual size of a new thin LV. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Using virtual size (-V) and actual size (-L) together creates a sparse LV. \fBlvm.conf\fP(5) \fBglobal/sparse_segtype_default\fP determines the default segment type used to create a sparse LV. Anything written to a sparse LV will be returned when reading from it. Reading from other areas of the LV will return blocks of zeros. When using a snapshot to create a sparse LV, a hidden virtual device is created using the zero target, and the LV has the suffix _vorigin. Snapshots are less efficient than thin provisioning when creating large sparse LVs (GiB). Controls detection and subsequent wiping of signatures on new LVs. There is a prompt for each signature detected to confirm its wiping (unless --yes is used to override confirmations.) When not specified, signatures are wiped whenever zeroing is done (see --zero). This behaviour can be configured with \fBlvm.conf\fP(5) \fBallocation/wipe_signatures_when_zeroing_new_lvs\fP. If blkid wiping is used (\fBlvm.conf\fP(5) \fBallocation/use_blkid_wiping\fP) and LVM is compiled with blkid wiping support, then the blkid(8) library is used to detect the signatures (use blkid -k to list the signatures that are recognized). Otherwise, native LVM code is used to detect signatures (only MD RAID, swap and LUKS signatures are detected in this case.) The LV is not wiped if the read only flag is set. Enable or disable allocation of physical extents on this PV. Enables or disables the addition or removal of PVs to/from a VG (by vgextend/vgreduce). Do not prompt for confirmation interactively but always assume the answer yes. Use with extreme caution. (For automatic no, see -qq.) #lvchange Set zeroing mode for thin pool. Note: already provisioned blocks from pool in non-zero mode are not cleared in unwritten parts when setting --zero y. #lvconvert For snapshots, this controls zeroing of the first 4 KiB of data in the snapshot. If the LV is read-only, the snapshot will not be zeroed. For thin pools, this controls zeroing of provisioned blocks. Provisioning of large zeroed chunks negatively impacts performance. #lvcreate Controls zeroing of the first 4 KiB of data in the new LV. Default is \fBy\fP. Snapshot COW volumes are always zeroed. For thin pools, this controls zeroing of provisioned blocks. LV is not zeroed if the read only flag is set. Warning: trying to mount an unzeroed LV can cause the system to hang. #pvcreate #vgcreate #vgextend Controls if the first 4 sectors (2048 bytes) of the device are wiped. The default is to wipe these sectors unless either or both of --restorefile or --uuid are specified. writethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_search@DDDhD(D`__8`_jiiijiijdjijlinearstripedsnapshotcachecachepoolintegritymirrorraidraid0 raid1 raid10 raid4 raid5 raid6thinthinpoolvdovdopoolvdopooldatawritecachezeroerrorglobal/vdo_disabled_featureskvdoInternal error: Missing function for command definition %d:%s.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.Read ahead is already auto for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already %u for %s.Setting read ahead to %u for %s.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum, adjusting.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sCannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.Operation not permitted on hidden LV %s.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Cannot activate LVs in a foreign VG.Cannot change LV properties when activating component LVs.WARNING: Combining activation change with other commands is not advised.Refreshing logical volume %s (if active).Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.Unable to deactivate %s for resync.WARNING: Failed to sync local dev names.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.RAID logical volume %s cannot be active remotely.Internal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Thin pool data or metadata volume must be specified. (E.g. "%s_tdata")%s must be a RAID logical volume to perform this action.Kernel driver does not support this action: %s"%s" is not a supported sync operation.%s state is currently "%s". Unable to switch to "%s".Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Do you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.Cannot convert %s LV %s to %s.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'Internal error: Changing conv_type from %d to %d.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearInternal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Cannot specify mirrors with linear type.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Internal error: Unknown mirror log count %d.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesSplitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Failed to write changes for %s.Failed to suspend %s before committing changes.Failed to commit changes for %s.Failed to resume %s after committing changes.Only up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.Unable to find image to satisfy request.Unable to split additional image from %s while tracking changes for %s.Conversions to --type mirror require -m/--mirrorsUnknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?LV %s has no suffix for cachevol (skipping rename).%s is not a mergeable logical volume.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Thin repair command is not configured. Repair is disabled.Cannot repair active pool %s. Use lvchange -an first.Failed to build thin metadata path.Failed to build pool metadata spare path.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Can't prepare new metadata name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.(inherited)disabled%s:yLogical volume %s changed.No settings changed. and %u other snapshot(s)Failed to prepare message.disk-logged core-logged clustered Failed to clear %s %s for %s.intermediateidlefrozenresyncrecoverNo --rebuild found!lvconvert.cMergedConverted_mimagetmp_%dlayer name creation failed.Failed to insert resync layerNo usable images left in %s.Setting logging type to %s.Logical volume %s converted.raid1 with reducingenhancingLogical volume %s NOT split.Cannot convert LV %s.Conversion aborted.Volume %s replaced origin %s.-i-otransaction="%s_meta%%dg`T_T_T_T_T_T_cT_T_T_T_cT_T_T_T_T_T_T_T_T_T_T_bT_T_T_T_T_)bg`PaT_T_T_T_T_T_aT_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_T_`T_T_T_T_T_T_PaT_T_`nonedevtypes_generalformats_generalfullreport_generalhelp_generallastlog_generallvchange_activatelvchange_monitorlvchange_persistentlvchange_poll lvchange_properties lvchange_rebuild lvchange_refresh lvchange_resync lvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_combine_split_snapshotlvconvert_integritylvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshotlvconvert_merge_thinlvconvert_plainlvconvert_raid_typeslvconvert_repairlvconvert_replace_pvlvconvert_split_and_keep_cachelvconvert_split_and_remove_cachelvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_polllvconvert_swap_pool_metadata lvconvert_to_cache_with_cachepool!lvconvert_to_cache_with_cachevol"lvconvert_to_cache_with_device#lvconvert_to_cachepool$lvconvert_to_cachepool_or_swap_metadata%lvconvert_to_thin_with_data&lvconvert_to_thin_with_external'lvconvert_to_thinpool(lvconvert_to_thinpool_or_swap_metadata)lvconvert_to_vdopool*lvconvert_to_vdopool_param+lvconvert_to_writecache,lvconvert_to_writecache_with_device-lvcreate_and_attach_cachedevice_for_cache.lvcreate_and_attach_cachedevice_for_writecache/lvcreate_and_attach_cachepool0lvcreate_and_attach_cachepool_v21lvcreate_and_attach_cachepool_v32lvcreate_and_attach_cachevol_for_cache3lvcreate_and_attach_cachevol_for_writecache4lvcreate_cachepool5lvcreate_cow_snapshot6lvcreate_cow_snapshot_with_virtual_origin7lvcreate_error_vol8lvcreate_linear9lvcreate_mirror:lvcreate_mirror_or_raid1;lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool<lvcreate_raid_any=lvcreate_striped>lvcreate_thin_snapshot?lvcreate_thin_snapshot_of_external@lvcreate_thin_volAlvcreate_thin_vol_and_thinpoolBlvcreate_thin_vol_with_thinpool_or_sparse_snapshotClvcreate_thinpoolDlvcreate_vdo_volElvcreate_zero_volFlvdisplay_generalGlvextend_policyHlvextend_pool_metadataIlvextend_pvJlvextend_sizeKlvmchange_generalLlvmconfig_generalMlvmdevices_checkNlvmdevices_editOlvmdevices_listPlvmdevices_updateQlvmdiskscan_generalRlvmsadc_generalSlvmsar_generalTlvpoll_generalUlvreduce_sizeVlvremove_generalWlvrename_lv_lvXlvrename_vg_lv_lvYlvresize_pool_metadataZlvresize_pv[lvresize_size\lvs_general]lvscan_general^pvchange_properties_all_pvchange_properties_some`pvck_dumpapvck_generalbpvck_repaircpvck_repair_typedpvcreate_generalepvdata_generalfpvdisplay_generalgpvmove_anyhpvmove_oneipvremove_generaljpvresize_generalkpvs_generallpvscan_cachempvscan_displaynsegtypes_generalosystemid_generalptags_generalqversion_generalrvgcfgbackup_generalsvgcfgrestore_by_filetvgcfgrestore_by_vguvgcfgrestore_list_by_filevvgcfgrestore_list_by_vgwvgchange_activatexvgchange_lockstartyvgchange_lockstopzvgchange_locktype{vgchange_monitor|vgchange_poll}vgchange_properties~vgchange_refreshvgchange_systemidvgck_generalvgck_update_metadatavgconvert_generalvgcreate_generalvgdisplay_generalvgexport_allvgexport_somevgextend_generalvgimport_allvgimport_somevgimportclone_generalvgimportdevices_allvgimportdevices_rootvgimportdevices_somevgmerge_generalvgmknodes_generalvgreduce_allvgreduce_by_pvvgreduce_missingvgremove_generalvgrename_by_namevgrename_by_uuidvgs_generalvgscan_generalvgsplit_by_lvvgsplit_by_pvcount !*"NDgK#'Manual repair required. and withWITHOUT and metadata volumesMetadata LV %s not found.Unknown pool metadata LV %s.Can't convert locked LV %s.pool_metadata%d_tpool%dConverted %s to %s %s.replaceMerging of volume %s started.Logical volume %s not split.WARNING: %s not zeroed.LVM_VG_NAMEvg/lv string alloc failed.Cache pool %s not found.Thin pool %s not found.Cannot find cache %s.Invalid writecache settings.Failed to update VG.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.%s_cvolUse cache metadata format 2.Only inactive cache can be repaired.Cache repair command is not configured. Repair is disabled.Failed to build cache metadata path.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Failed to activate %s. Conversion cannot proceed.Aborting. Failed to deactivate new thin LV. Manual intervention required.Failed to sync local devices before conversion.Aborting. Failed to swap identifiers. Manual intervention required.Aborting. Failed to attach external origin. Manual intervention required.Converted %s to thin volume with external origin %s.Failed to deactivate thin LV %s.Failed to deactivate thin LV. Manual intervention required.Internal error: LV %s is already a pool.Can't use same LV for pool data and metadata LV %s.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is of an unsupported type.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).WARNING: Volume of "%s" segtype cannot store ANY real data!THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Do you really want to convert %s? [y/n]: Aborting. Failed to deactivate %s.Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Failed to set up spare metadata LV for pool.Aborting. Failed to deactivate logical volume %s.Volume %s is already VDO volume, skipping VDO conversion.Aborting. Failed to deactivate metadata lv. Manual intervention required.Failed to create internal lv names, %s name is too long.Cannot allocate lock for new pool LV.Failed to lock new pool LV %s.Failed to activate pool logical volume %s.Manual intervention may be required to handle reported errors.Failed to unlock pool data LV %s/%sFailed to free lock for pool data LV %s/%sFailed to unlock pool metadata LV %s/%sFailed to free lock for pool metadata LV %s/%sWARNING: Converting %s to fully provisioned thin volume.Pool metadata extents %u chunk_size %uWARNING: Converting %s to %s pool's data%s %s metadata wiping.Convert poll ID list allocation failed.Internal error: Invalid lvconvert pool commandLV %s could not be converted to a thin volume.Failed to get '--replace' argumentAttempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Volume %s is consistent. Nothing to repair.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.Conversion starts after activation.WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unsupported volume type for repair of volume %s.Internal error: Unknown pool conversion.Failed to initialize processing handle.Internal error: Cannot get origin from %s COW.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Merging of snapshot %s will occur on next activation of %s.Internal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Unable to combine split snapshots in VG with lock_type %sUnable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.Operation not permitted on LV %s type %s.LV %s with type %s cannot be converted to a cache pool.LV %s is already used as a cachevol.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.Redirecting operation to data sub LV %s.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.LV %s with type %s cannot be used as a metadata LV.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.New pool metadata LV %s cannot be locked.Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Internal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.Cannot find LV with cache from %s.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set writecache cleaner for %s.Failed to set cleaner cachesetting to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Logical volume %s is not cached and %s is removed.Logical volume %s is not cached and %s is unused.Internal error: Unknown cache split command.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.No cachedevice specified to create a cachevol.With tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.Erase all existing data on %s? [y/n]: Can't prepare new cachevol name for %s.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Failed to unlock fast LV %s/%sThere's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.%s and %s are synonyms. Please only supply one.Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Path name too long to get LV block size %sTest mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Failed to activate LV to check block size %sFailed to sync local dev names.Failed to deactivate LV after checking block size %sCannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Logical volume %s now has writecache.Failed to find mirrored LV for %s.Not collapsing %s: out-of-sync.Failed to release mirror imagesFailed to remove temporary sync layer.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.Mirror log type "%s" is unknown.%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%dIncompatible options selected.Options -c and -m are incompatible.Size may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Extents may not be relative/signed../configure --build=x86_64-redhat-linux-gnu --host=x86_64-redhat-linux-gnu --program-prefix= --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --bindir=/usr/bin --sbindir=/usr/sbin --sysconfdir=/etc --datadir=/usr/share --includedir=/usr/include --libdir=/usr/lib64 --libexecdir=/usr/libexec --localstatedir=/var --sharedstatedir=/var/lib --mandir=/usr/share/man --infodir=/usr/share/info --with-default-dm-run-dir=/run --with-default-run-dir=/run/lvm --with-default-pid-dir=/run --with-default-locking-dir=/run/lock/lvm --with-usrlibdir=/usr/lib64 --enable-fsadm --enable-write_install --with-user= --with-group= --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --enable-pkgconfig --enable-cmdlib --enable-dmeventd --enable-blkid_wiping --with-udevdir=/usr/lib/udev/rules.d --enable-udev_sync --with-thin=internal --with-cache=internal --enable-lvmpolld --enable-lvmlockd-dlm --enable-lvmlockd-dlmcontrol --enable-lvmlockd-sanlock --enable-dbus-service --enable-notify-dbus --enable-dmfilemapd --with-writecache=internal --with-vdo=internal --with-vdo-format=/usr/bin/vdoformat --with-integrity=internal --with-default-use-devices-file=1 --disable-silent-rules --enable-app-machineid --enable-editline --disable-readlineFailed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.Inconsistent volume group names given: "%s" and "%s"WARNING: Converting logical volume %s to VDO pool volume %s formatting.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Converted %s to VDO pool volume and created virtual %s VDO volume.Cannot add integrity while LV is missing PVs.Cannot add integrity to non raid type LV %s.Logical volume %s has added integrity.LV %s does not have integrity.Cannot remove integrity from non raid type LV %s.Logical volume %s has removed integrity.Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Option --minor may not be repeated.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Please either create VDO or snapshot.Maximal supported VDO virtual size is %s.Please express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Can't use %s size. Maximal supported VDO POOL volume size with slab size %s is %s.Using maximal supported VDO POOL volume size %s (with slab size %s).Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sNo space for sanlock lock, extend the internal lvmlock LV.Making thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.Removal of created spare volume failed. Manual intervention required.Ambiguous syntax, please create --type cache-pool %s separately.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.Selected cache metadata format %d is not supported.Command definition index %d enum %d id %sInternal error: Command %s not found. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE]... is start and end range (inclusive), PV[:PE+PE]... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.) Use --longhelp to show all options and advanced commands.Use 'lvm help ' for more informationArgument%s%c%s%s cannot be used in interactive mode.Option%s%c%s%s may not be repeated.Unable to allocate memory for command line arguments.--partial and --activationmode are mutually exclusive argumentsPARTIAL MODE. Incomplete logical volumes will be processed.Invalid activation mode given.WARNING: Ignoring unknown search_for_devnames setting, using %s.A --devices list cannot be used with --devicesfile.Failed to read --devices args.Failed to copy devices file name.Command profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.Filtering devices (no data) for pvid searchFiltering devices (with data) for pvid searchPVID %s not found on any devices.WARNING: PVID %s found on %s which is excluded: %sstub.hlvmcmdline.csystem ID: %sMemTotal:%*s%llu%*sInvalid cachevol LV.LV %s could not be zeroed._wcoriglvconvert_poll.c%s: %s: %s%%LV %s is not merged.lnyljsonpvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawlvcreate.cVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sIncompatible options selectedlvdisplay.cSize may not be negative.Size may not be positive.Region size may not be zero.Extents may not be negative.Extents may not be positive.LVM version: %s1.02.198-RHEL9 (2024-05-16)Library version: %sDriver version: %sConfiguration: %spmove_tmetaOption %s %s.skipped from activation inactive auto activated read-only origin %s%s%s%s%s%s%s, %ORIGINwith generated name as snapshot of toollib.cfind_free_lockFailed to remove new LV %s.Number may not be negative.%s - %s Common options for lvm: Common options for command:%s: no such command.Available lvm commands:%-16.16s%s -Option requires argument.Invalid argument for %s: %sUnrecognised option %d (%c).Invalid devices file name.Invalid units specificationlvmdevices.cFound PVID %s on %s.x}}|pY;Failed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profilemetadata profileGiving preference to command profile specified on command line over the one specified via environment variable.LVM_COMMAND_PROFILEFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: remove multipath componentAdding multipath device %s for multipath component %s.Missing multipath device %s for multipath component %s.PRODUCT_UUID=%s (old %s): updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: device not foundIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: no changeIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s (%s) IDNAME=%s (%s) DEVNAME=%s (%s) PVID=%s%s: device not foundIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: indeterminateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: old entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: new entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: deleteUpdated devices file to version %sNo update for devices file is needed.Updates needed for devices file.Hash update needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.WARNING: to remove a device by device id, include --deviceidtype.Device %s is used by an active LV, continue to remove? WARNING: to remove a device by name, do not include --deviceidtype.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%sNo devices file entry with device id %s %s.Multiple devices file entries for PVID %s (%s %s), remove by device name.PVID not found in devices file.WARNING: only considering LVM devices%d LVM physical volume whole disk%sPlease enter one or more logical volume paths or use --select for selection.WARNING: Ignoring lvscan --cache because lvmetad is no longer used.Existing logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageRenamed "%s%s" to "%s%s" in volume group "%s"Existing historical logical volume "%s" not found in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differInternal error: unknown lvresize typeOptions --fs and --resizefs cannot be used together.--resizefs is equivalent to --fs resize.The --fsmode option does not apply to resize_fsadm.Please specify either size or extents but not both.Ignoring type, stripes, stripesize and mirrors arguments when reducing.Mirrors argument may not be signed.Stripes argument may not be negative.Cannot use stripes with linear type.Stripesize may not be negative.Logical volume %s successfully resized.lvextend policy is supported only for snapshot, thin pool and vdo pool volumes.lvextend using policy requires the volume to be active.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set bellow minimal supported value 50%%.lvextend policy disabled by threshold 100Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.lvextend policy calculated percentages main %u meta %u from threshold %d percent %dRefreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s.VG changed during file system resize, LV not resized.ABORTING: Mirror percentage check failed.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Can't reread VG for %s error flags %x%s: No pvmove in progress - already finished or aborted.Can't find LV in %s for %s. Already finished or removed.%s: Interrupted: No longer active.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.--polloperation parameter is mandatoryArgument to --interval cannot be negativePoll ID list allocation failed.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.Resolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Metadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Cannot disable all metadata areas in volume group %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uSetting mda_copies to %u for VG %sFailed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to store physical volume "%s" in volume group "%s"Failed to store physical volume "%s"Failed to set pvid for devices file.Failed to update devices file.Marking metadata areas on physical volume "%s" as %s.Setting physical volume "%s" NOT allocatableSetting physical volume "%s" allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedArgument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldForking background process from command: %sWARNING: Failed to set SIGCHLD action.Failed to sync local devices before forking.Background process failed to setsid: %sCHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %lluCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uMetadata text %llu too large for mda_size %llu max %llulvresize.cDevices file not enabled.Devices file does not exist. PART=%dPRODUCT_UUID=%s: addPRODUCT_UUID=%s: removeHOSTNAME=%s (old %s): updateHOSTNAME=%s: addHOSTNAME=%s: removeNo device found for %s.Invalid PVID.Device not removed.Unknown device_id type.No devices file entry for %s.lvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"%-*s [%15s] %sLVM physical volume%d disk%s%d partition%s%d LVM physical volume%slvremove.clvscan.clvrename.cUnknown --fs value.Unknown --fsmode value.lvextend policy not needed.refresh_lvpath = %sLV refresh failed for LV %sACTIVE OriginalSnapshot%s%s '%s%s/%s' [%s] %spolldaemon.cCan't find LV in %s for %s.lvpoll.cProvide LV nameMovedUnknown polling operation %sMissing LV uuid within: %s/%spvchange.cChanging uuid of %s to %s.Updating physical volume "%s"Physical volume "%s" changedignoredin-useafterfork failed: %sredirectLVM_EXPECTED_EXIT_STATUS(lvm2)pvck.c?mda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %llu LVM2 x[5A%r0N*>Failed to create file %s0PPPPPPPPPPxPPP/dev/nullFailed to clone VG or LV name.Failed to parse UUID from pv_uuid setting.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.Specify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluFound bad header or metadata values.CHECK: mdas have different raw_locn[0].checksum valuesSet backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.WARNING: No LVM label found on %s. It may not be an LVM device.Failed to read label_header at %lluWriting label_header.crc 0x%08xFound label on %s, sector %llu, type=LVM2 001Could not find LVM label on %sFound text metadata area: offset=%llu, size=%lluPlease enter a physical volume pathWARNING: skipping global lock for force.--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %sDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPlease supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedOptions -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Option -c not allowed with option -mOption -c is not allowed with option -sInternal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segment--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to pvmove device used for raid with integrity.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Internal error: Unexpected LV index %s.Raid sublv for name %s too long.Removing PV %s from trim list.Skipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.Matched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uMoving %u extents of logical volume %s.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Incompatible layer boundary: %s:%u[%u] on %s:%u.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Unable to move device used for writecache cachevol %s.layer segment for %s:%u not found.Inserting layer %s for segments of %s on %sNo extents available for allocation.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / ABORTING: Removal of temporary mirror failedABORTING: Unable to deactivate temporary logical volume %s.ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveABORTING: Failed to write new data locations to disk.Internal error: Invalid resize params.Physical volume %s format does not support resizing.WARNING: %s: Overriding real size %s. You could lose data.%s: Requested size %s exceeds real size %s. Proceed? [y/n]: Physical Volume %s not resized.%s: Requested size %s is less than real size %s. Proceed? [y/n]: %s: Size is already %s (%lu sectors).WARNING: %s: Pretending size is %lu not %lu sectors.Resizing volume "%s" to %lu sectors.Size must exceed minimum of %lu sectors on PV %s.Size must exceed physical extent start of %lu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %lu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.Use pvcreate and vgcfgrestore to repair from archived metadata.PV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]pvscan[%d] %s: autoactivation failed.CHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerInternal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.Failed to write lookup entry %s %spvscan[%d] Failed to write lookup entry %s %sWrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device set up for online PV %d:%d %s PVID %spvscan[%d] No device set up for online PV %d:%d %s PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sset_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for online PV %d:%d %spvscan[%d] VG %s PV %s no device found for online PV %d:%d %sset_pv_devices_online vg %s pv %s is online %spvmove.cFailed to set up device %s.Cannot use %s: %s.Cannot access %s. %63[^=]=%63s %nInvalid setting at: %smetadata_offsetbackup_filemda_offsetmda_sizemda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %sCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %s# Generatedid = No mda location.zero metadata copiesUnknown dump value.Write LVM header to device? Skip writing in test mode.Write new LVM header to %s? Failed to write new headerUnknown repair value.pvremove.cpvcreate.cNEW (exported)(but full)pvdisplay.c--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %u--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREEpvresize.cof exported volume group(s)in no volume grouppvscan.cpvmove_poll.cFailed to find an LV name.Logical volume %s not found.pvmove%dCan't find sub LV %s.Can't find PVs for sub LV %s.Skipping locked LV %s.Inserting %s:%u-%u of %s/%sNo data to move for %s.Failed to activate %sanyLayer is not linear: %s:%uMissing error segtypelv_list alloc failedRemoving temporary pvmove LVLayer segment found: %s:%u%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*sPV %-*s VG %-*sPV %-*s %-*s %-10s %sPV %-*s VG %-*s %-10s %sPV %-*s %-*s %s [%s]pvscan autoactivating VG %s.%s: autoactivation failed.Failed to write new mda textFailed to allocate lvid.Failed to clone LV name.Remove pv online devno %d:%dUnlink pv online %sDid not create %s: %dwrite_lookup_file %s LVM2 x[5A%r0N*>Ignoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.pvscan_cache_all: label scan allpvscan_cache_all: create list of devicesIgnoring pvscan --cache because event_activation is disabled.Skip pvscan for unknown autoactivation value.pvscan[%d] Skip pvscan for unknown autoactivation value.Skip pvscan for event with event_activation=0.pvscan[%d] Skip pvscan for event with event_activation=0.pvscan[%d] Failed to set up devices.WARNING: Failed to parse major:minor from %s, skipping.WARNING: Invalid major:minor %d:%d, skipping.No device set up for arg %s %d:%dpvscan[%d] No device set up for arg %s %d:%dpvscan_cache_args: filter devs nodataFinding symlink names from DEVLINKS for filter regex.Finding symlink names from /dev for filter regex.pvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.%s excluded by devices file (checking PVID).pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devspvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.VG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.Merge is in progress, reporting merged LV %s. and also its SubLV(s) with option '-a'WARNING: RaidLV %s needs to be refreshed! See character 'r' at position 9 in the RaidLV's attributes%s.Internal error: _report_all_in_vg: incorrect report typeUnknonwn report specifier in report option list: %s.Internal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedWARNING: devtypes currently ignores command line arguments.Internal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.dm_report: Unrecognized field: %.*sFailed to compact given columns in report output.No physical volume label read from %s.Setting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.WARNING: Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.WARNING: Using unrecognized writecache setting: %s = %s.Internal error: _report_all_in_lv: incorrect report typeInternal error: _report_all_in_pv: missing pv.Internal error: _report_all_in_pv: incorrect report typeInternal error: report_for_selection: incorrect report typeInternal error: _report: unknown report type.Failed to create temporary mempool to process report options.Failed to set selection for log report.Failed to add main report section to report group.Failed to finalize main report section in report group.Supported report formats: %s, %s, %s.dm_report: dm_report_init_group: failed to allocate mem poolFailed to create report group.Failed to add log report to report group.Failed to set log report name for command context.dm_report: faile to allocate root report group itemdm_report: failed to allocate report group structureskip_dev_dir: Couldn't split up device name %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.WARNING: Skipping clustered VG %s.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %sCannot access clustered VG %s."%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %sSpawning background pvmove process for %s.Spawning background lvconvert process for %s.Failed to allocate poll identifier for lvconvert.Delaying merge for origin volume %s since snapshot volume %s is still active.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Negative stripesize is invalid.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Cache mode "writeback" is not compatible with cache policy "cleaner".Ignoring deprecated --vdosettings option "%s" and its value.Invalid argument for VDO setting "vdo_%s".Cannot change VDO setting "vdo_%s" in existing VDO pool.Invalid lvm.conf writecache setting value for %s.High watermark must be greater than low watermark.LVM_EVENT_ACTIVATION=0pvscan_recreate_hints_beginDEVLINKSDEVLINKS %spvscan[%d] %s excluded: %s.%s cannot read label.%s not an lvm device.No VGs to autoactivate.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slowreporter.c and its SubLV(s)successfailureInterrupted.Failed to find device "%s".dev_iter creation failed.use_report_optionsInvalid options string: %sUnknown --headings value.No log report stored.%s: unknown report format.report_groupFailed to create log report.unknown Skipping volume group %sAllocation of vg_name failed.Disabling%s pool zeroing.Setting pool discards to %s.may not be negativemay not be zeroUsing default stripesize %s.Invalid stripe size %s.Unknown VDO setting "%s".Show help.reportFailed to allocate filename.vgcfgbackup.cFailed to get tag.Failed to add tag %s to %s/%sProcessing each VGstrlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.No volume groups found.Processing VG %s %sSelection failed for VG %s.Running command for VG %s %sSelection failed for LV %s.Processing LV %s in VG %s.Processing each PVCannot use %s: %sProcessing PVs in VG %sSelection failed for PV %s.Skipping PV %s in VG %s.Processing PV %s in VG %s.Processing device %s.device_id_list alloc failed.No PV found on device %s.Can't get device size of %s.No devices to process.Failed to rescan devs exclCheck confirm arg %s no info.Cannot read orphans VG %s.alloc pvl failed.Using existing orphan PV %s.Creating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.strdup failed.Checking %s to confirm %.32s.Failed to find PV %srunning_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmlock_type %s is invalidSetting lock_type to %sCan't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.Volume group "%s" successfully backed up.No backup taken: specify filename with -f to backup with unknown segments.Logical volume %s/%s does not support tagsFailed to add tag %s to physical volume %s.Failed to duplicate tag %s from %s/%sPlease use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleMultiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Use VG uuid in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sObtaining the complete list of VGs to processRepeat lock and read for local to shared vgIgnoring virtual origin logical volume %s.Adding %s to the list of LVs to be processed.invalidating devs for any pvs on lvsInternal error: Command %d:%s arg position %d does not permit an LV (%llx)WARNING: Command on LV %s does not accept LV type %s.WARNING: Command on LV %s does not accept LV type unknown (%d).Command not permitted on LV %s.WARNING: Command on LV %s has invalid use of option %s.WARNING: Command on LV %s requires option %s.WARNING: Command on LV %s uses options invalid with LV type %s.WARNING: Command on LV %s with invalid LV type %s.WARNING: Command on LV %s uses options that require LV types %s.WARNING: Command on LV %s does not accept LV type %s. Required LV types are %s.WARNING: Command on LV %s uses options that are invalid with LV properties: %s.WARNING: Command on LV %s is invalid on LV with properties: %s.WARNING: Command on LV %s uses options that require LV properties: %s.WARNING: Command on LV %s requires LV with properties: %s.Processing historical LV %s in VG %s.Failed to find logical volume "%s/%s"Failed to allocate final LV list item.Processing lockd_sanlock_lv %s/%s.Tags cannot be used with this command.Cannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.device_list element allocation failedProcessing duplicate device %s.Internal error: No info for pvidFailed to find physical volume "%s".Processing devices that are not PVslabelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openCheck confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Wiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.Set up physical volume for "%s" with %lu available sectors.Format-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sFailed to setup physical volume "%s".Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped.delete dev from initial duplicates %sdelete dev from unused duplicates %sChecking %s for pvremove %.32s.Checking %s for pvcreate %.32s.pv_list allocation in pv_create failedPhysical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.WARNING: VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Failed to get result from lvmlockdFailed to find a running lock manager.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Physical extent size may not be negative.Volume group allocation policy is already %svgchange_metadata_copies new %u vg_mda_copies %u D %uWARNING: Number of metadata copies for VG %s is already unmanaged.WARNING: Number of metadata copies for VG %s is already %u.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.Volume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group autoactivation is already %s.WARNING: Physical extent size cannot be larger than %s.WARNING: Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.Volume group has active logical volumes.Failed to generate new random UUID for VG %s.Changing configuration profile for VG %s: %s -> %s.Ignoring invalid string in lock_start list.Ignoring empty string in config file.Please supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.Please supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.Need one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinit.Only -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negative.Physical extent size may not be negative.Change clustered property of all volumes groups? [y/n]: Skip vgchange for unknown autoactivation value.Skip vgchange for event and event_activation=0.Failed early VG locking for autoactivation.Finding online devices to scanNo device found for quick mapping of online PV %d:%d %s PVID %sRepeat dev cache scan to translate devnos.No device found for %d:%d PVID %slabel_scan_vg_online: read and filter devsMatch device_id %s %s to %s: matching PVIDIncomplete PV list from online files %d metadata %d.PVs online error%s%s, using all devices.PVs online not found for VG %s, using all devices.PVs online incomplete for VG %s, using all devicess.WARNING: New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sCannot change to unknown lock type %sVolume group "%s" successfully changed.Forcibly change VG lock type to %s? [y/n]: Using lock type requires lvmlockd.Not starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvUsing lock start and lock stop requires lvmlockd.No global lock for lock start.Starting locking. Waiting for sanlock may take 20 sec to 3 min...Starting locking. Waiting until locks are ready...Starting locking. VG can only be read until locks are ready.Cannot change system ID without the majority of PVs (found %d of %d).Volume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Starting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"Internal error: lvmcache_get_bad_mdas no vginfo %sWARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.The volume group is missing %d physical volumes.Volume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedPlease enter volume group name and physical volume(s)Please provide volume group name and physical volumesThe clustered option is deprecated, see --shared.Cannot create VG with lock_type %s without lvmlockd.Global lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Global lock failed: lockspace is starting.VG create failed: lock manager %s is not supported by lvmlockd.A volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.Failed to allocate memory for system_id in vg_set_system_id.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]VG Access %s%s%s%sVG Status %s%sresizableOption -A is not allowed with volume group namesVolume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedWARNING: PV %s not found in VG %sWARNING: PV %s was not missing in VG %sVolume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedNot importing devices for VG %s with missing PV %s.Failed to write device ids in VG metadata.Devices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Temporary vg name %s1 is too long.Internal error: Old vg name %s is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Failed to update VG on devices being imported.Root VG auto import is not enabled.Failed to set up devices file.Failed to create devices file.Failed to write the devices file.Added %u devices to devices file for root VG %s.Added %u devices to devices file.Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%sctivated %d logical volumes in volume group %s.Failed to sync local devices for VG %s.%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredChecking for volume group "%s"vgmerge not allowed for lock_type %svgchange.cvgcfgrestore.cNo archives found in %s.Restore aborted.Restore failed.Restored volume group %s.(no profile)%s/devices/auto-import-rootvgFound root dm_uuid %svgexport.cvgimport.c for VG No volume groups changed.Skipping device_id filteringFailed to deativate %s.VG lock type not changed.lockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dautonowaitUnable to set system ID.Failed to write VG.vgck.cFailed to commit VG.Volume group %s not changedvgextend.c with system ID vgcreate.clockd global lock_type %sEnabling sanlock global lockFailed to get tagFailed to start lockingr/wexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %s--- Physical volumes ---vgdisplay.cNo PV has been restored.vgimportdevices.cvgimportclone.cFailed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sVG is missing a device.Failed to unlink %s/run/lvm/lvm-devices-importFailed to find root VG.No devices to add.DeaVG %s is incomplete.Found %s creating %sfailed to create %sRefreshing volume group "%s"vgmerge.cWARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.Please enter 2 or more volume groups to mergeDuplicate volume group name "%s"Removing pool metadata spare %s.Marking PV %s as moved to VG %sFailed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedFailed to clear metadata from physical volume "%s" after removal from "%s"Removed "%s" from volume group "%s"Removing "%s" from volume group "%s"Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease enter one or more volume group paths or use --select for selection.Please give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.WARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Volume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)New VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sLVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvRenaming path is too long %s/%s %s/%slockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Volume group "%s" successfully renamed to "%s"Failed to restart VG %s lockspace.Old and new volume group names need specifyingNew volume group path exceeds maximum length of %d!Old and new volume group names must differFound %svolume group "%s" using metadata type %sCannot notify dbus: notify_dbus is disabled in lvm config.WARNING: Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume GroupsExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.Can't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Can't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groups%s volume group "%s" successfully split from "%s"Can't split Logical Volume %s between two Volume GroupsToo many arguments. Limit is %d.Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dError during parsing of command line.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).MESSAGE_ID=3ca432788c374e4ba684b834188eca36Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sUpdated config file invalid. Aborting.DEGRADED MODE. Incomplete RAID LVs will be processed.--ignoremonitoring or --sysinit option not allowed with --monitor option.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.LVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.Path for locking_dir %s is invalid.File locking initialisation failed.WARNING: Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dIgnore lvmlockd for pvscan cache.WARNING: skipping LV lock in lvmlockd.WARNING: skipping VG lock in lvmlockd.WARNING: skipping global lock in lvmlockd.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.Run `%s --help' for more information.Failed to strdup command basename.Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit formInternal error: Daemon send: socket fd cannot be negative %dInternal error: Daemon send: no memory availableInternal error: Bad format string '%s'%s: Wrong device number: (%u, %u) instead of (%u, %u)vgreduce.cChanged LVID for %s to %svgmknodes.cNo device found for PV.vgreduce_single VG %s PV %svgremove.cVolume group "%s" not removedvgrename.cCan't get lock for %srename_vg_beforeRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedrename_vg_finalexported vgscan.cvgsplit.cExistingNewInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.Physical Volume %s not found/run/lvm/lvmlockd.socketHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandTZ:/etc/localtimeCouldn't copy command line.Version: %sParsing: %sCorrect command syntax is:Command requires options: %sMESSAGE=lvm command %sCODE_LINE=913PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sIgnore opt %dProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedskiplvskipvgskipglLVM_LVMLOCKD_SOCKETCompleted: %s/run/lvmlockd.pidconfig-util.c%.*s= %ld %.*s= "%s" %b%.*s%s ## daemon-client.crequestFailed to duplicate node key.%u %255s %s: No entry for %s found%s: Wrong inode type/proc/devicesC9/%Ulog_command\x5cx#+-.:=@_%2x%128sDM_DEBUG_WITH_LINE_NUMBERS%s:%d Failed to duplicate token.Failed to clone config value.%f0%lo%s}[%s,%sFailed to read int token.Failed to read float token.Failed to allocate type valuedtree link allocation failedcontrol/proc/miscCreating device %s (%u, %u)mknodDM_DEFAULT_NAME_MANGLING_MODEFailed to build sysfs_path.%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %u [trust_udev] [verify_udev]%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sProcessingFailed to build size in kB.BLKRASETSkipping_control_fd\x%02xName "%s" too long.Couldn't create path for %sDevice %s not found%s/../%s) UUID DM_DEVICE_RESUMEDM_DEVICE_REMOVEDM_DEVICE_RENAMEkey setenablechecks ima_measurement securedata deferredremove retryremove skiplockfs readonly noflush noopencount reload %u:%u diff type %s %sreload params1 %sreload params2 %sget_timestampclock_gettime(unknown version) SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRYsemid %d: semctl failed: %s%*u %*u %u:%u %4096s %4096s%sfs%sfs/%s/%s%sdev/block/%u:%u/holdersconfig_outputFailed to allocate valuetruefalseFailed to clone config node.Failed to create config node.dtree hash creation failedFailed to allocate dtree.The %s "%s" seems to be mangled more than once. This is not allowed in auto mode.The %s "%s" should be mangled but it contains blacklisted characters._do_dm_ioctl_unmangle_string: failed to unmangle %s "%s"Hex encoding mismatch detected in %s "%s" while trying to unmangle it.Device %s (%u:%u) appears to be mounted on %s.Parse error at byte %td (line %d): expected a string token.Failed to clone config string value.dm_pool_grow_object failed for config linevsnprintf failed for config linedm_vasprintf failed for config line_write_value: Unknown value type: %ddm_pool_begin_object failed for config lineWARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueTarget type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedCould not determine kernel version used.Failed to set up list of device-mapper major numbersFailure to communicate with kernel device-mapper driver.Check that device-mapper is available in the kernel.dm_task_set_message: strdup failedAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %d%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGET%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%s%s: retaining kernel read ahead of %u (requested %u)%s (%d:%d): Setting read ahead to %uKernel not configured for semaphores (System V IPC). Not using udev synchronization code.Udev is not running. Not using udev synchronization code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notificaton semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %ssemid %d: sem_ctl GETVAL failed for cookie 0x%x: %ssemid %d: semop failed for cookie 0x%x: incorrect semaphore statesemid %d: semop failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Failed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %sFailed to mangle device uuid "%s".Device uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedInternal error: unknown device-mapper task %dFailed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.device (%u:%u) is %s for compatibility with old kernelUnable to find name for device (%u:%u)No flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.WARNING: Setting UUID unsupported by kernel. Aborting operation.WARNING: IMA measurement unsupported by kernel. Aborting operation.Ran out of memory building ioctl parameterCouldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronization interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device_mapper/libdm-timestamp.cdevice-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.WARNING: libdevmapper buffer too small for dataFailed to get device-mapper versionIncompatible libdevmapper %s%s and kernel driver %s.dm_task_create: malloc(%zu) failedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdUdev cookie 0x%x (semid %d) incremented to %dCould not set notification semaphore identified by cookie value %u (0x%x)Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Attempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)Failed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u).WARNING: sysfs_path dm_snprintf failed.Failed to allocate config pool.Failed to allocate config tree.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sCannot clone NULL config node.Failed to clone config node key.Failed to create config node's key.dtree uuid hash creation failedrXH8(eXKdF>E>>g>>>UF>EEE>> FXYY}YYYYYY)Y5YAYMYYYYYeYqYY/proc/self/mountinfocreate8reload 8remove8remove_all8suspend8resume8info8deps 8rename8version8status 8table 8waitevent8names8clear 8mknodes8versions 8message8setgeometry8armpoll8$target-version8)Specialstring listunselectable %s Fields%*.*s %sall%-*s - %sAll fields in this section. %-*s - %s%s%s%s%stype-specificfield-specificname pool_strdup failedRemoving %s (%u:%u)device_mapper/libdm-file.cResuming %s (%u:%u). with device flushSuspending %s (%u:%u)%s%s with filesystem syncno targetNode %s is missing a segment.Dropping callback for %s.Reverting %s.Unable to deactivate %s.Node %s has segment type %s.Unsupported message type %d.Couldn't find area uuid %s. in failed state which needs check first with read only metadataUUID "%s" does not match.create_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapUnable to suspend %s (%u:%u)is used by another deviceconstains a filesystem in useDevice %s (%u:%u) %s.Creating directory "%s"Unrecognised field: %.*sUnsupported selection type=~All fields must match&&Selection operandsReserved values %-*s - %s [%s]Selection operators------------------- Comparison operators: %6s - %s %4s - %sExpecting field nameMissing value after operatorSpecified month out of range.Specified day out of range.Incorrect date format.Specified hours out of range.Incorrect time format.special_||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset end!~!=>=<=sinceuntil-------------------------------------------------------------------------------Internal error: Field type undefined._create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion failedInternal error: %s reserved value handler for field %s has missing implementation of DM_REPORT_RESERVED_PARSE_FUZZY_NAME actionError occured while processing %s reserved value handler for field %sDeactivation dm_task creation failed for %s_add_item_to_string_list: memory allocation failed for string list itemExisting path %s is not a directory.Matched uuid %s %s in deptree.Matched uuid %s %s (missing suffix -%s) in deptree.Matched uuid %s %s (missing prefix) in deptree.Not matched uuid %s in deptree.Cannot add device without name and uuid._node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %s_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Suspend dm_task creation failed for %sSuspended device counter increased to %dExpected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.Failed to process message "%s".Node %s must have only one segment.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Failed to allocate thin message.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id is %lu and does not match expected %lu.Sent messages to thin-pool %s and skipping suspend of its children.Unable to deactivate open %s (%u:%u).Node %s %d:%d has open_count %dUnable to deactivate %s (%u:%u).Failed to duplicate directory name.%s failed to allocate sort value structure%s failed to allocate report string structure%s failed to allocate temporary array for processing%s failed to allocate array of items inside sort value structuredm_report_field_percent: dm_pool_alloc failed for sort_value.dm_report_field_percent: dm_pool_alloc failed for percent report string.dm_report_field_percent: percentage too large.dm_report: field not match: %sdm_report: struct field_properties allocation failed_compare_selection_field: field without value :%dInternal error: _cmp_field_int: unsupported number comparison type for field %sInternal error: _cmp_field_double: unsupported number comparison type for selection field %sInternal error: _cmp_field_string: unsupported string comparison type for selection field %sInternal error: _cmp_field_string_list: unknown list typeInternal error: _cmp_field_string_list: unsupported string list type found, expecting either AND or OR list for selection field %sInternal error: _cmp_field_time: unsupported time comparison type for field %sInternal error: _compare_selection_field: unknown field type for field %sInternal error: _do_report_object: dm_report handler is NULL.Internal error: _do_report_object: output not requested and selected output variable is NULL too._do_report_object: no data assigned to field %s_do_report_object: report function failed for field %s_do_report_object: struct dm_report_field allocation failed_do_report_object: row sort value structure allocation failed_do_report_object: struct row allocation faileddm_report_enable_compact_output: dm report handler is NULL.Matching regular expression. [regex] field - Reporting field. number - Non-negative integer value. size - Floating point value with units, 'm' unit used by default if not specified. percent - Non-negative integer with or without %% suffix. string - Characters quoted by ' or " or unquoted. string list - Strings enclosed by [ ] or { } and elements delimited by either "all items must match" or "at least one item must match" operator. regular expression - Characters quoted by ' or " or unquoted._display_selection_help: dm_pool_begin_object failed Logical and grouping operators:dm_report: struct selection_node allocation failedUnrecognised selection field: %sSelection field is uncomparable: %s.Unrecognised comparison operator: %sFailed to parse regex value for selection field %s.Operator can be used only with number, size, time or percent fields: %sOperator can be used only with time fields: %sFailed to parse string value for selection field %s._tok_value_string_list: memory allocation failed for selection listInvalid operator in selection list.List ended with incorrect character, expecting '%s'.Only one type of logical operator allowed in selection list at a time.Internal error: _tok_value_string_list: list has no items_tok_value_string_list: memory allocation failed for sort arrayFailed to parse string list value for selection field %s.Failed to parse numeric value for selection field %s.Found percent value but %s value expected for selection field %s.Found size unit specifier but %s value expected for selection field %s.Specified minutes out of range.Specified seconds out of range.Full date specification needed.Failed to parse time value for selection field %s.Internal error: Forbidden NULL custom detected.Unable to create selection with field '%s' which is not included in current report.dm_report: incompatible comparison type for selection field %sInternal error: %s reserved value handler for field %s has missingimplementation of DM_REPORT_RESERVED_GET_DYNAMIC_VALUE actiondm_report: could not get reserved value while processing selection field %sdm_report: malloc failed to store regex value for selection field %sdm_report: failed to create regex matcher for selection field %sString value %s found in selection is reserved.Numeric value %lu found in selection is reserved.Size value %f found in selection is reserved.Percent value %s found in selection is reserved.String list value found in selection is reserved.Time value found in selection is reserved.Internal error: _create_field_selection: unknown type of selection field %sdm_report: struct field_selection_value allocation failed for selection field %sInternal error: Forbiden NULL custom detected.dm_report: dm_pool_strndup for value of selection field %sdm_report: struct field_selection allocation failed for selection field %sRegular expression expected for selection field %s_tok_value_time: dm_pool_strndup failedtok_value_time: dm_pool_strndup failedMissing list end for selection field %sNot matching regular expression. [regex]Equal to. [number, size, percent, string, string list, time]Not equal to. [number, size, percent, string, string_list, time]Greater than or equal to. [number, size, percent, time]Greater than. [number, size, percent, time]Less than or equal to. [number, size, percent, time]Less than. [number, size, percent, time]Since specified time (same as '>='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]P0Ј|YFailed to parse string list value for selection field %s.Field selection value %s out of supported range for field %s.Use 'help' for selection to get more help.Selection syntax error at '%s'.Syntax error: right parenthesis expected at '%s'Syntax error: left parenthesis expected at '%s'_display_selection_help: dm_pool_grow_object failed_report_field_string_list: <`?Y@.AWARNING: Unknown mirror health status char: %cOut of memory. Requested %zu bytes.(rx->type != OR) || (rx->left && rx->right)dm_report: Missing sort field namedm_report: Ignoring duplicate sort field: %s.dm_report: Unrecognised field: %.*sFailed to parse invalid thin params.Failed to parse thin pool params: %s.Couldn't create memory pool %s (size %zu)build_dm_name: Allocation failed for %zu for %s %s %s.no memory for size display bufferInternal error: Inconsistent units: %c and %c.device_mapper/regex/parse_rx.cInternal error: pool_free asked to free pointer not in poolFailed to allocate report selection structure.dm_report: dm_report_group_pop: group has no itemsFailed to parse invalid snapshot params.Failed to parse snapshot params: %s.Failed to allocate snapshot status structure. <#devices> and and Failed to parse %sraid params: %s %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to allocate thin_pool status structure.Failed to parse thin params: %s.Failed to allocate thin status structure.Internal error: More then 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.Failed to alloc mem pool to parse mirror status.missing ')' in regular expressiondm_report: Failed to copy field namedm_report: Unable to extend output linedm_report: Could not allocate memory for output line buffer.dm_report: left-aligned snprintf() faileddm_report: right-aligned snprintf() faileddm_report: unable to add more than one report to current report groupdm_report: can't use unnamed object at top level of JSON outputdm_report: failed to duplicate json item namedm_report: dm_report_group_push: group item allocation faileddm_report: dm_report_output: interleaved reports detected for JSON outputdm_report: dm_report_output: unfinished JSON output detecteddm_report: sort array allocation faileddm_report: Unable to allocate output linedm_report: Failed to extend row for field namedm_report: Failed to extend row with separatordm_report: Failed to terminate rowdm_report: dm_pool_begin_object failed for headingsdm_report: Could not allocate memory for heading buffer.dm_report: snprintf heading faileddm_report: Failed to generate report headings for printingdm_report: Unable to terminate output lineRegex charset allocation failedInternal error: Unknown calc node typedevice_mapper/vdo/vdo_reader.cFailed to open VDO backend %s.Found mismatching VDO magic header in %s.Expected geometry VDO block instead of block %u.Unsupported VDO version %u.%u.File/Device is shorter and can't provide requested VDO volume region at %lu > %lu.Unknown VDO component version %u.VDO metadata has mismatching VDO nonces %lu != %lu.VDO minimum io size %u is unsupported [512, 4096].device_mapper/vdo/vdo_target.cVDO block map cache size %u MiB is out of range [%u..%u].VDO block map era length %u is out of range [%u..%u].VDO index memory size %u MiB is out of range [%u..%u].VDO slab size %u MiB is out of range [%u..%u].VDO max discard %u is out of range [%u..%u].VDO ack threads %u is out of range [0..%u].VDO bio threads %u is out of range [%u..%u].VDO bio rotation %u is out of range [%u..%u].VDO cpu threads %u is out of range [%u..%u].VDO hash zone threads %u is out of range [0..%u].VDO logical threads %u is out of range [0..%u].VDO physical threads %u is out of range [0..%u].Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is larger than limit %lu TiB by %lu KiB.Failed to allocate memory for hash.Failed to allocate slots for hash.Internal error: dm_report_init: definition of report types given contains reserved identifierdm_report_init: allocation of memory pool failed_canonicalize_field_ids: dm_pool_alloc failedInternal error: _check_reserved_values_supported: global reserved value for type 0x%x not supportedInternal error: _check_reserved_values_supported: field-specific reserved value of type 0x%x for field %s not supportedInternal error: dm_report_init_with_selection: trying to register unsupported reserved value type, skipping report selection_canonicalize_field_dup: dm_pool_alloc failed.Set if item passes selection criteria.device_mapper/mm/pool-fast.ccouldn't get token for '%s'couldn't parse '%s'device_mapper/regex/matcher.cErrorFail%lu %lu/%lu %lu/%lu%nout_of_data_spacero Failed to duplicate lvm name.device_mapper/libdm-string.cMissing lvm name for split.0%s%s%.*f%s Exabyte EB Petabyte PB Terabyte TB Gigabyte GB Megabyte MB Kilobyte Byte B Exbibyte EiB Pebibyte PiB Tebibyte TiB Gibibyte GiB Mebibyte MiB Kibibyte KiB kB B Units Un Sectors Sereport selectionExpecting logical operator%lu/%lu %luInvalidMerge failedOverflow<#devs> %lu/%luwritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s ro needs_checkAllocation of devs failed.%u:%u %nAllocation of logs failed.userspaceBadly formed 'or' expression%-*.*s\": [(.*(%s)%c)Parse error in regexCouldn't parse regexdevice_mapper/regex/ttree.cRegex optimisation errorout of memoryoperating modeindex statecompression stateused blockstotal blockstoo many tokenscouldn't get token for deviceioctlfstatbase/data-struct/hash.cdm_report_init: malloc failedbbb,bbbbbtb,bbbbbbbbbbbbbbb b,bbbbbb,^]D`T_]he@e@ehe@eedmvdo001errorclosedopeningclosingofflineonlineunknownonlineofflinerecoveringread-onlynormal_fill_tableC||}0}@}}}|XȆhpp` px pHkmgtpebs_degrade_to_n48_degrade_to_n16_degrade_to_n4dm_list_spliceignore lookup file line %shead1->nn4 != NULLn16 != NULLn48 != NULLsetlocale failedsetvbuf/etc/lvmLVM_RUN_BY_DMEVENTDpending_deleteNo devices found.online_devs %s %signore %s with no lvm info.pvscan[%d] PV %s not used.PV %s has no VG metadata.PV %s not found in VG %s.PV %s missing device size.ignore md component %s.PV %s ignore shared VG.PV %s ignore foreign VG.PV %s ignore exported VG.pvscan[%d] PV %s online.VG %s complete after recheck.PV %s online, VG unknown.VG unknownVG %s finishedLVM_VG_NAME_COMPLETE='%s' VG %s completeLVM_VG_NAME_INCOMPLETE='%s' VG %s incompleteFailed to find LVs using %s.LV %s completeFailed to check partial lvs.LV %s incompletelabel_header at %llulabel_header.idlabel_header.id %slabel_header.sector %llulabel_header.crc 0x%xlabel_header.offset %ulabel_header.typelabel_header.type %sLABELONELVM2 001pv_header at %llupv_header.pv_uuidpv_header.pv_uuid %spv_header.device_size %llupv_header_extension at %llupv_header_extension.flags %uNo lvm label found on device.No mda1 offset found.No mda2 offset found.Invalid metadata file.Filtering devices to scanReading labels for pvidFile already exists.CHECK: second mda not foundmda_header.magicCHECK: no mem for printing %s wrappedprecommitPVSFFRSpecified %%%s is unknown.Size is too big (>=16EiB).Can't parse size argument.is only available with poolsis unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.Setting chunksize to %s.WARNING: Path %s/%s is too long.checking all pvid files using lookup file for %sWARNING: Failed to strdup vgname../base/data-struct/radix-tree-adaptive.cFailed to allocate command contextFailed to allocate line buffer.LVM_SYSTEM_DIR environment variable is too long.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failedInternal error: Failed to parse command definitions.Volume group %s has active volume: %s.pvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.pvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.Ignore PV %s with VG system id %s with our system id %sCHECK: failed to read label_header at %lluCHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdapv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header_extension offset calculationMetadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.WARNING: Cannot get device size.Skipping mda2 (wrong mda_header.version)Skipping mda2 (no matching VG UUID in metadata area)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluWARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.WARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.WARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Scanning failed to get devices.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %llumda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizePercentage is too big (>=%d%%).Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sSize is not a multiple of 512. Try using %lu or %lu.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambigous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease specify either size or extents (not both).Please specify either size or extents.Dropping VDO pool header size to 0 to support maximal size %s.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.0000000000000000`Crequest = %sNo conversion is requested.%s device number not changed.Cannot deactivate %s.%s: reactivation failed.OO_ALL:DESC:AUTOTYPE:FLAGS:SECONDARY_SYNTAXPREVIOUS_SYNTAXRULE:lv_is_Cannot find command %s.Failed to duplicate name %s.Filler to duplicate line %s.OO_ALLlockd VG %s mode %slock_vgRetrying %s lock on VG %sVG %s lock failed: removedVG %s lock skipped: error %dVG %s lock failed: error %dpositionLvmlockd is not in use.Lvmlockd is not connected.busy_vg%s: field name too long.Missing end quote.Failed to create path %s%s/%s%s/%u/fd/%ufputsfflushFailed to add sublv %s.raid5_nimagesrebuildExtracting %u %s from %s.Failed to extract %s from %s.Shifting images in %s.Shifting %s and %s by %u.Post callout function failed.lvs list alloc failed.Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.%s_imetacrc32cLV update and reload failedFailed to add integrity.pipePiping:%s/dev/nullpipe[0]STDOUTpipe[1]WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.%sLogical Volume "%s" already exists in volume group "%s".Unable to split mirror %s that is not in-sync.Minor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.Parsing command defs: too many rules for cmd, increate CMD_MAX_RULES.Parsing command defs: too many cmd_rule options for cmd, increase MAX_RULE_OPTS.Parsing command defs: unknown lv property %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: can't process input line %s.VG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: held by other host.VG %s lock failed: held by other host.Duplicate sanlock global lock in VG %sOne LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsCreating lvmlock LV for sanlock with size %um %ub %u extentsFailed to create sanlock lv %s in vg %s%s: lock type %s lvmlockd result %ddm_tree_node_add_null_area() called on an unsupported segment typeTest mode: Skipping creation of provisioned thin pool metadata.Cannot create temporary file to prepare metadata. Preparing thin-pool metadata with thin volume mapping: %sLV %s has to be of type raid4 or raid5_n to allow for this conversion.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sInternal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to shift and rename image components.Unable to extract enough images to satisfy request.Internal error: Bad type provided to %s.Extracting image component %s from %s.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.pv->vg_name allocation failed for '%s'Rounding size to boundary between physical extents: %s.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremention size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Integrity can only be added to top level raid LV.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to create metadata LV name.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVIntegrity metadata uses more than one segment.Failed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroIntegrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Cannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Adding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Failed to generate unique name for unused logical volume.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume._extract_image_component_error_seg_busy_vgOO_ALL: --commandprofile String, --config String, --debug,--driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet,--verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal StringOO_REPORT: --aligned, --all, --binary, --configreport ConfigReport, --foreign,--headings HeadingsType --ignorelockingfailure, --logonly,--nameprefixes, --noheadings, --nosuffix,--options String, --readonly, --reportformat ReportFmt, --rows,--select String, --separator String, --shared, --sort String,--unbuffered, --units Units, --unquotedOO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced,--ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String,--sinceversion String, --showdeprecated, --showunsupported, --validate, --valuesonly,--withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces,--unconfigured, --withversionsOO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select StringOO_LVCHANGE_META: --addtag Tag, --deltag Tag,--alloc Alloc, --contiguous Bool,--compression Bool, --deduplication Bool,--detachprofile, --metadataprofile String, --profile String,--permission Permission, --readahead Readahead, --setactivationskip Bool,--setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool,--cachemode CacheMode, --cachepolicy String, --cachesettings String,--minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--vdosettings String,--writebehind Number, --writemostly WriteMostlyPV, --persistent nlvchange OO_LVCHANGE_META VG|LV|Tag|Select ...OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_propertiesDESC: Change a general LV attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_imageRULE: all and lv_is_vg_writableRULE: --contiguous not --allocRULE: --profile not --detachprofileRULE: --metadataprofile not --detachprofileRULE: --minrecoveryrate --maxrecoveryrate and LV_raidRULE: --writebehind --writemostly and LV_raid1RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecacheRULE: --errorwhenfull --discards --zero and LV_thinpoolRULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpoolRULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_originRULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partiallvchange --resync VG|LV_raid_mirror|Tag|Select ...OO: --activate Active, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_resyncDESC: Resyncronize a mirror or raid LV.DESC: Use to reset 'R' attribute on a not initially synchronized LV.RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrityRULE: all not LV_raid0lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_syncactionDESC: Resynchronize or check a raid LV.RULE: all not LV_raid0lvchange --rebuild PV VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_rebuildDESC: Reconstruct data on specific PVs of a raid LV.RULE: all not LV_raid0lvchange --activate Active VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool,--ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_activateDESC: Activate or deactivate an LV.lvchange --refresh VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_refreshDESC: Reactivate an LV using the latest metadata.lvchange --monitor Bool VG|LV|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_monitorDESC: Start or stop monitoring an LV from dmeventd.RULE: all not lv_is_pvmovelvchange --poll Bool VG|LV|Tag|Select ...OO: --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_pollDESC: Start or stop processing an LV conversion.lvchange --persistent y --minor Number LVOO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_persistentDESC: Make the minor device number persistent for an LV.RULE: all not LV_thinpool LV_cachepool LV_vdopoolOO_LVCONVERT_POOL: --chunksize SizeKB, --poolmetadata LV,--poolmetadatasize SizeMB, --poolmetadataspare Bool, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat,--cachemode CacheMode, --cachepolicy String,--cachesettings String, --zero BoolOO_LVCONVERT_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCONVERT_VDO_POOL: OO_LVCONVERT_VDO, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool,OO_LVCONVERT_VDO, OO_LVCONVERT_POOLOO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsynclvconvert --type linear LVOO: OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to linear.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type striped LVOO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to striped.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type mirror LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to type mirror (also see type raid1),RULE: all not lv_is_locked lv_is_pvmovelvconvert --type raid LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid or change raid layoutDESC: (a specific raid level must be used, e.g. raid1).RULE: all not lv_is_locked lv_is_pvmoveRULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --intervallvconvert --mirrors SNumber LVOO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid1 or mirror, or change number of mirror images.RULE: all not lv_is_locked lv_is_pvmovelvconvert --stripes_long Number LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKBOP: PV ...ID: lvconvert_raid_typesDESC: Convert raid LV to change number of stripe images.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --stripesize SizeKB LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSizeID: lvconvert_raid_typesDESC: Convert raid LV to change the stripe size.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --regionsize RegionSize LV_raidOO: OO_LVCONVERTID: lvconvert_change_region_sizeDESC: Change the region size of an LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0FLAGS: SECONDARY_SYNTAXlvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 or mirror LV and use them to create a new LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --splitmirrors Number --trackchanges LV_raid1_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 LV and track changes to origin for later merge.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --mergemirrors LV_linear_raid|VG|Tag ...OO: OO_LVCONVERTID: lvconvert_merge_mirror_imagesDESC: Merge LV images that were split from a raid1 LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integritylvconvert --mirrorlog MirrorLog LV_mirrorOO: OO_LVCONVERTOP: PV ...ID: lvconvert_change_mirrorlogDESC: Change the type of mirror log used by a mirror LV.RULE: all not lv_is_locked lv_is_pvmoveFLAGS: SECONDARY_SYNTAXlvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --thin, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata_thin_error_zeroOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV, converts the LV to type cache.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata_thin_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longFLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_to_writecacheDESC: Attach a writecache to an LV, converts the LV to type writecache.RULE: all and lv_is_visiblelvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpoolOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visiblelvconvert --cache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXlvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings StringID: lvconvert_to_writecache_with_deviceDESC: Add a writecache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKBID: lvconvert_to_cache_with_deviceDESC: Add a cache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpoolDESC: Convert LV to type thin-pool.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thinpool LV_linear_striped_raid_cache_writecache_vdo_error_zero_thinpoolOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpool_or_swap_metadataDESC: Convert LV to type thin-pool (variant, use --type thin-pool).DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longAUTOTYPE: thin-poollvconvert --type cache-pool LV_linear_striped_raid_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepoolDESC: Convert LV to type cache-pool.RULE: --poolmetadata not --readahead --stripesize --stripes_longRULE: all not lv_is_raid_with_integritylvconvert --cachepool LV_linear_striped_raid_cachepool_error_zeroOO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepool_or_swap_metadataDESC: Convert LV to type cache-pool (variant, use --type cache-pool).DESC: Swap metadata LV in a cache pool (variant, use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type vdo-pool LV_linear_striped_raid_cacheOO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO_POOL, OO_LVCONVERTID: lvconvert_to_vdopoolDESC: Convert LV to type vdopool.RULE: all and lv_is_visible lv_is_writableRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integritylvconvert --vdopool LV_linear_striped_raid_cacheOO: OO_LVCONVERT_VDO_POOL, OO_LVCONVERT, --name LV_new, --virtualsize SizeMB,ID: lvconvert_to_vdopool_paramDESC: Convert LV to type vdopool.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrityFLAGS: SECONDARY_SYNTAXAUTOTYPE: vdo-poollvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_keep_cacheDESC: Detach a cache from an LV.lvconvert --uncache LV_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_remove_cacheDESC: Detach and delete a cache from an LV.FLAGS: SECONDARY_SYNTAXlvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepoolOO: --chunksize SizeKB, OO_LVCONVERTID: lvconvert_swap_pool_metadataDESC: Swap metadata LV in a thin pool or cache pool (for repair only).FLAGS: SECONDARY_SYNTAXlvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_mergeDESC: Merge LV that was split from a mirror (variant, use --mergemirrors).DESC: Merge thin LV into its origin LV (variant, use --mergethin).DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot).RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --mergethin LV_thin ...OO: OO_LVCONVERTID: lvconvert_merge_thinDESC: Merge thin LV into its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --mergesnapshot LV_snapshot ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_merge_snapshotDESC: Merge COW snapshot LV into its origin.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --splitsnapshot LV_snapshotOO: OO_LVCONVERTID: lvconvert_split_cow_snapshotDESC: Separate a COW snapshot from its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --type snapshot LV LV_linear_stripedOO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visiblelvconvert --snapshot LV LV_linear_stripedOO: --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXAUTOTYPE: snapshotlvconvert --repair LV_cache_cachepool_mirror_raid_thinpoolOO: --usepolicies, --interval Number, --setactivationskip Bool, --poolmetadataspare Bool, OO_LVCONVERTOP: PV ...ID: lvconvert_repairDESC: Replace failed PVs in a raid or mirror LV.DESC: Repair a thin pool.DESC: Repair a cache pool.RULE: all not lv_is_locked lv_is_pvmoveRULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpoolRULE: --setactivationskip and LV_cache LV_cachepool LV_thinpoollvconvert --replace PV LV_raidOO: OO_LVCONVERTOP: PV ...ID: lvconvert_replace_pvDESC: Replace specific PV(s) in a raid LV with another PV.RULE: all not lv_is_locked lv_is_pvmovelvconvert --startpoll LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_start_pollDESC: Poll LV to continue conversion.RULE: all and lv_is_convertinglvconvert LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_plainDESC: Poll LV to continue conversion (also see --startpoll)DESC: or waits till conversion/mirror syncing is finishedFLAGS: SECONDARY_SYNTAXlvconvert --raidintegrity Bool LV_raidOO: --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCONVERTOP: PV ...ID: lvconvert_integrityDESC: Add or remove data integrity checksums to raid images.OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active,--contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number,--metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync,--noudevsync, --permission Permission, --persistent Bool, --readahead Readahead,--reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool,--zero Bool, --setautoactivation BoolOO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String,--chunksize SizeKB, --cachemetadataformat CacheMetadataFormatOO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKBOO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool, OO_LVCREATE_VDO, OO_LVCREATE_POOLOO_LVCREATE_RAID: --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Numberlvcreate --type error --size SizeMB VGOO: OO_LVCREATEID: lvcreate_error_volDESC: Create an LV that returns errors when used.FLAGS: SECONDARY_SYNTAXlvcreate --type zero --size SizeMB VGOO: OO_LVCREATEID: lvcreate_zero_volDESC: Create an LV that returns zeros when read.FLAGS: SECONDARY_SYNTAXlvcreate --type linear --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.FLAGS: SECONDARY_SYNTAXlvcreate --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.AUTOTYPE: linearlvcreate --type striped --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV (also see lvcreate --stripes).FLAGS: SECONDARY_SYNTAXlvcreate --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV.AUTOTYPE: stripedlvcreate --type mirror --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATEOP: PV ...ID: lvcreate_mirrorDESC: Create a mirror LV (also see --type raid1).FLAGS: SECONDARY_SYNTAXlvcreate --mirrors PNumber --size SizeMB VGOO: --stripesize SizeKB, --mirrorlog MirrorLog, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...IO: --stripes 1ID: lvcreate_mirror_or_raid1DESC: Create a raid1 or mirror LV.AUTOTYPE: raid1AUTOTYPE: mirrorlvcreate --type raid --size SizeMB VGOO: --mirrors PNumber, --stripes Number, --stripesize SizeKB,OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid LV (a specific raid level must be used, e.g. raid1).lvcreate --mirrors PNumber --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid10 LV.AUTOTYPE: raid10lvcreate --type snapshot --size SizeMB LVOO: --snapshot, --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --snapshot --size SizeMB LVOO: --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LV.AUTOTYPE: snapshotlvcreate --type snapshot --size SizeMB --virtualsize SizeMB VGOO: --snapshot, --chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshot_with_virtual_originDESC: Create a sparse COW snapshot LV of a virtual origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --type thin-pool --size SizeMB VGOO: --thinpool LV_new, --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.lvcreate --thin --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool named in --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --type cache-pool --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool.lvcreate --type cache-pool --size SizeMB --cachepool LV_new VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool named by the --cachepool argDESC: (variant, uses --cachepool in place of --name).FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool named in the first argDESC: (variant, also see --thinpool for naming pool).FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.AUTOTYPE: thinlvcreate --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in the thin pool named in the first argDESC: (also see --thinpool for naming pool.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin LV_thinOO: --thin, --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXlvcreate --thin LV_thinOO: --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --snapshot LV_thinOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.AUTOTYPE: thinlvcreate --type thin --thinpool LV_thinpool LVOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.lvcreate --snapshot --thinpool LV_thinpool LVOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a LV that returns VDO when used.lvcreate --vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --vdopool LV_new --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by the --thinpool arg.FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXlvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --size SizeMB --virtualsize SizeMB VGOO: --stripes Number, --stripesize SizeKB, --snapshot, --thin,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshotDESC: Create a thin LV, first creating a thin pool for it.DESC: Create a sparse snapshot of a virtual origin LVDESC: Chooses type thin or snapshot according toDESC: config setting sparse_segtype_default.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinAUTOTYPE: snapshotlvcreate --type cache --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepoolDESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.lvcreate --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v2DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB LV_cachepoolOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v3DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.DESC: (variant, also use --cachepool).FLAGS: SECONDARY_SYNTAXlvcreate --cache --size SizeMB LVOO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE,--stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoolDESC: When the LV arg is a cachepool, then create a new LV andDESC: attach the cachepool arg to it.DESC: (variant, use --type cache and --cachepool.)DESC: When the LV arg is not a cachepool, then create a new cachepoolDESC: and attach it to the LV arg (alternative, use lvconvert.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB --cachevol LV VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachevol_for_cacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type cache.lvcreate --type cache --size SizeMB --cachedevice PV VGOO: --stripes Number, --stripesize SizeKB,--cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachedevice_for_cacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type cache.lvcreate --type writecache --size SizeMB --cachevol LV VGOO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachevol_for_writecacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type writecache.lvcreate --type writecache --size SizeMB --cachedevice PV VGOO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachedevice_for_writecacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type writecache.lvdisplayOO: --aligned, --all, --binary, --colon, --columns,--configreport ConfigReport, --foreign, --history, --ignorelockingfailure,--logonly, --maps, --noheadings,--nosuffix, --options String, --sort String, --readonly,--segments, --select String, --separator String,--shared, --unbuffered, --units UnitsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedcluster, --reportformat ReportFmtID: lvdisplay_generallvextend --size PSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_sizeDESC: Extend an LV by a specified size.lvextend LV PV ...OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvextend_pvDESC: Extend an LV by specified PV extents.lvextend --poolmetadatasize PSizeMB LV_thinpool_linearOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvextend_pool_metadataDESC: Extend a pool metadata SubLV by a specified size.lvextend --usepolicies LV_snapshot_thinpool_vdopoolOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_policyDESC: Extend an LV according to a predefined policy.lvmconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generallvmdevicesID: lvmdevices_listDESC: Print devices in the devices file.lvmdevices --checkID: lvmdevices_checkOO: --refreshDESC: Check the devices file and report incorrect values.lvmdevices --updateOO: --delnotfound, --refreshID: lvmdevices_updateDESC: Update the devices file to fix incorrect values.lvmdevices --adddev PVOO: --deviceidtype StringID: lvmdevices_editDESC: Add a device to the devices file.lvmdevices --deldev PV|StringOO: --deviceidtype StringID: lvmdevices_editDESC: Remove a device from the devices file.lvmdevices --addpvid StringOO: --deviceidtype StringID: lvmdevices_editDESC: Find the device with the given PVID and add it to the devices file.lvmdevices --delpvid StringID: lvmdevices_editDESC: Remove the devices file entry for the given PVID.lvreduce --size NSizeMB LVOO: --autobackup Bool, --force, --nofsck, --noudevsync,--reportformat ReportFmt, --resizefs, --fs String, --fsmode StringID: lvreduce_sizelvremove VG|LV|Tag|Select ...OO: --autobackup Bool, --force, --nohistory, --noudevsync,--reportformat ReportFmt, --select StringID: lvremove_generallvrename VG LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_vg_lv_lvlvrename LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_lv_lvlvresize --size SSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvresize_sizeDESC: Resize an LV by a specified size.lvresize LV PV ...OO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvresize_pvDESC: Resize an LV by specified PV extents.lvresize --poolmetadatasize PSizeMB LV_thinpoolOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvresize_pool_metadataDESC: Resize a pool metadata SubLV by a specified size.lvsOO: --history, --segments, OO_REPORTOP: VG|LV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: lvs_generalRULE: --noheadings not --headingslvscanOO: --all, --blockdevice, --ignorelockingfailure,--readonly, --reportformat ReportFmtIO: --partial, --cache_longID: lvscan_generalOO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmt, --uuidOO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag,--uuid, --metadataignore Boolpvchange --all OO_PVCHANGE_METAOO: OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_allDESC: Change properties of all PVs.pvchange OO_PVCHANGE_META PV|Select ...OO: --select String, OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_someDESC: Change properties of specified PVs.pvresize PV ...OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmtID: pvresize_generalpvck PV ...OO: --labelsector NumberID: pvck_generalDESC: Check for metadata on a devicepvck --dump DumpType PVOO: --settings String, --file String,--pvmetadatacopies MetadataCopiesPV, --labelsector NumberID: pvck_dumpDESC: Check and print LVM headers and metadata on a devicepvck --repairtype RepairType PVOO: --settings String, --file String, --labelsector NumberID: pvck_repair_typeDESC: Repair LVM headers or metadata on a devicepvck --repair --file String PVOO: --settings String, --labelsector NumberID: pvck_repairDESC: Repair LVM headers and metadata on a devicepvcreate PV ...OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB,--force, --labelsector Number, --metadatatype MetadataType,--pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB,--metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB,--reportformat ReportFmt, --restorefile String, --uuidstr String, --zero BoolID: pvcreate_generalRULE: --norestorefile not --restorefileRULE: --bootloaderareasize not --restorefilepvdisplayOO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport,--foreign, --ignorelockingfailure,--logonly, --maps, --noheadings, --nosuffix, --options String,--readonly, --reportformat ReportFmt, --select String, --separator String, --shared,--short, --sort String, --unbuffered, --units UnitsOP: PV|Tag ...IO: --ignoreskippedclusterID: pvdisplay_generalpvmove PVOO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background,--interval Number, --name LV, --noudevsync, --reportformat ReportFmtOP: PV ...ID: pvmove_oneDESC: Move PV extents.pvmoveOO: --abort, --background, --interval NumberID: pvmove_anyDESC: Continue or abort existing pvmove operations.pvremove PV ...OO: --force, --reportformat ReportFmtID: pvremove_generalpvsOO: --segments, --allpvs, OO_REPORTOP: PV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: pvs_generalRULE: --noheadings not --headingspvscanOO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup,--short, --uuid, --allpvsID: pvscan_displayDESC: Display PV information.pvscan --cache_longOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsyncOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online or offline.pvscan --cache_long --activate ayOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsync, --autoactivation StringOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online and autoactivate the VG if complete.pvscan --cache_long --listvg PVOO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput,--autoactivation StringID: pvscan_cacheDESC: Record that a PV is online and list the VG using the PV.pvscan --cache_long --listlvs PVOO: --ignorelockingfailure, --checkcomplete, --vgonlineID: pvscan_cacheDESC: Record that a PV is online and list LVs using the PV.pvscan --listlvs PVID: pvscan_cacheDESC: List LVs using the PV.pvscan --listvg PVID: pvscan_cacheDESC: List the VG using the PV.vgcfgbackupOO: --file String, --foreign, --ignorelockingfailure, --readonly,--reportformat ReportFmtOP: VG ...IO: --partialID: vgcfgbackup_generalOO_VGCFGRESTORE: --force_long, --metadatatype MetadataTypevgcfgrestore VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_vgDESC: Restore VG metadata from last backup.vgcfgrestore --file String VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_fileDESC: Restore VG metadata from specified file.vgcfgrestore --list VGOO: OO_VGCFGRESTOREID: vgcfgrestore_list_by_vgDESC: List all VG metadata backups.vgcfgrestore --list --file StringOO: OO_VGCFGRESTOREOP: VGID: vgcfgrestore_list_by_fileDESC: List one VG metadata backup file.OO_VGCHANGE: --autobackup Bool, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select String, --forceOO_VGCHANGE_META: --addtag Tag, --deltag Tag,--logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid,--pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--physicalextentsize SizeMB, --resizeable Bool,--profile String, --detachprofile, --metadataprofile String,--setautoactivation Boolvgchange OO_VGCHANGE_METAOO: --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_propertiesDESC: Change a general VG attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.vgchange --monitor BoolOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_monitorDESC: Start or stop monitoring LVs from dmeventd.vgchange --poll BoolOO: --ignorelockingfailure, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_pollDESC: Start or stop processing LV conversions.vgchange --activate ActiveOO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit,--readonly, --ignorelockingfailure, --monitor Bool, --poll Bool,--autoactivation String, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_activateDESC: Activate or deactivate LVs.vgchange --refreshOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_refreshDESC: Reactivate LVs using the latest metadata.vgchange --systemid String VG|Tag|SelectOO: --select String, --majoritypvsID: vgchange_systemidDESC: Change the system ID of a VG.vgchange --lockstartOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstartDESC: Start the lockspace of a shared VG in lvmlockd.vgchange --lockstopOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstopDESC: Stop the lockspace of a shared VG in lvmlockd.vgchange --locktype LockType VGID: vgchange_locktypeDESC: Change the lock type for a shared VG.vgckOO: --reportformat ReportFmtOP: VG|Tag ...ID: vgck_generalDESC: Read and display information about a VG.vgck --updatemetadata VGID: vgck_update_metadataDESC: Rewrite VG metadata to correct problems.vgcreate VG_new PV ...OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32,--maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType,--physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--shared, --systemid String, --locktype LockType, --setautoactivation BoolID: vgcreate_generalvgdisplayOO: --activevolumegroups, --aligned, --binary, --colon, --columns,--configreport ConfigReport, --foreign, --ignorelockingfailure,--logonly, --noheadings, --nosuffix,--options String, --readonly, --select String,--shared, --short, --separator String, --sort String, --unbuffered, --units UnitsOP: VG|Tag ...IO: --partial, --ignoreskippedcluster, --reportformat ReportFmtID: vgdisplay_generalOO_VGEXPORT: --reportformat ReportFmtvgexport VG|Tag|Select ...OO: --select String, OO_VGEXPORTID: vgexport_someDESC: Export specified VGs.vgexport --allOO: OO_VGEXPORTID: vgexport_allDESC: Export all VGs.vgextend VG PV ...OO: --autobackup Bool,--force, --zero Bool, --labelsector Number, --metadatatype MetadataType,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV,--metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--reportformat ReportFmt, --restoremissingID: vgextend_generalOO_VGIMPORT: --force, --reportformat ReportFmtvgimport VG|Tag|Select ...OO: --select String, OO_VGIMPORTID: vgimport_someDESC: Import specified VGs.vgimport --allOO: OO_VGIMPORTID: vgimport_allDESC: Import all VGs.vgimportclone PV ...OO: --basevgname VG, --import, --importdevicesID: vgimportclone_generalvgimportdevices VG|Tag|Select ...OO: --select String, --foreign, --reportformat ReportFmtID: vgimportdevices_someDESC: Add devices from specific VGs to the devices file.vgimportdevices --allOO: --foreign, --reportformat ReportFmtID: vgimportdevices_allDESC: Add devices from all accessible VGs to the devices file.vgimportdevices --rootvgOO: --auto, --reportformat ReportFmtID: vgimportdevices_rootDESC: Add devices from root VG to the devices file.vgmerge VG VGOO: --autobackup Bool, --list, --poolmetadataspare BoolID: vgmerge_generalvgmknodesOO: --ignorelockingfailure, --refresh, --reportformat ReportFmtOP: VG|LV|Tag ...ID: vgmknodes_generalOO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmtvgreduce VG PV ...OO: OO_VGREDUCEID: vgreduce_by_pvDESC: Remove a PV from a VG.vgreduce --all VGOO: OO_VGREDUCEID: vgreduce_allDESC: Remove all unused PVs from a VG.vgreduce --removemissing VGOO: --mirrorsonly, OO_VGREDUCEID: vgreduce_missingDESC: Remove all missing PVs from a VG.vgremove VG|Tag|Select ...OO: --force, --noudevsync, --reportformat ReportFmt, --select StringID: vgremove_generalvgrename VG VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_nameDESC: Rename a VG.vgrename String VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_uuidDESC: Rename a VG by specifying the VG UUID.vgsOO: OO_REPORTOP: VG|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: vgs_generalRULE: --noheadings not --headingsvgscanOO: --ignorelockingfailure, --mknodes, --notifydbus,--reportformat ReportFmtIO: --partial, --cache_longID: vgscan_generalOO_VGSPLIT: --autobackup Bool, --poolmetadataspare BoolOO_VGSPLIT_NEW: --alloc Alloc,--maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32,--metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVGvgsplit VG VG PV ...OO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_pvDESC: Split a VG by specified PVs.vgsplit --name LV VG VGOO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_lvDESC: Split a VG by PVs in a specified LV.configOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldumpconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldevtypesOO: --aligned, --binary, --nameprefixes, --noheadings,--nosuffix, --options String, --reportformat ReportFmt, --rows,--select String, --separator String, --sort String, --unbuffered, --unquotedID: devtypes_generalfullreportOO: OO_REPORTOP: VG ...IO: --partial, --ignoreskippedcluster, --trustcacheID: fullreport_generalRULE: --noheadings not --headingslastlogOO: --reportformat ReportFmt, --select StringID: lastlog_generallvpoll --polloperation PollOp LV ...OO: --abort, --autobackup Bool, --handlemissingpvs, --interval NumberID: lvpoll_generalformatsID: formats_generalhelpOP: String ...ID: help_generalversionID: version_generalpvdataID: pvdata_generalsegtypesID: segtypes_generalsystemidID: systemid_generaltagsID: tags_generallvmchangeID: lvmchange_generallvmdiskscanOO: --lvmpartition, --readonlyID: lvmdiskscan_generallvmsadcID: lvmsadc_generallvmsarOO: --full, --stdinID: lvmsar_generalvgconvert VG ...OO: --force, --labelsector Number, --bootloaderareasize SizeMB,--metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV,--metadatasize SizeMB, --reportformat ReportFmtID: vgconvert_generallv_is_lockedlv_is_partiallv_is_virtuallv_is_merginglv_is_merging_originlv_is_convertinglv_is_external_originlv_is_virtual_originlv_is_not_synced lv_is_pending_delete lv_is_error_when_full lv_is_pvmove lv_is_removed lv_is_vg_writablelv_is_writablelv_is_thinpool_datalv_is_thinpool_metadatalv_is_cachepool_datalv_is_cachepool_metadatalv_is_mirror_imagelv_is_mirror_loglv_is_raid_imagelv_is_raid_metadatalv_is_originlv_is_thick_originlv_is_thick_snapshotlv_is_thin_originlv_is_thin_snapshotlv_is_errorlv_is_zerolv_is_cache_originlv_is_cow lv_is_merging_cow!lv_is_cow_covering_origin"lv_is_visible#lv_is_historical$lv_is_raid_with_tracking%lv_is_raid_with_integrity&dCreating directory %s.lockd query LV %s/%squery_lock_lvlv_lock_args = %s by historical LVCreating logical volume %ssnapshot%dCan't move snapshot segment.sigfillsetcmd = %smode = %slvmlockd %s %s result %d %xRetrying metadata scan.Couldn't find uuid.Invalid uuid.gethostnamenohostname%s/.lvm_%s_%d_%d# Hint only%s = %sFailed to open crypt path %s.cryptDevice %s: %s is %lu%s.missing deviceDevice not added.No devno %d:%d in dev cache.deviceiddeviceid filter initialised.Sysfs filter initialised.mpath filter initialised.md filter allocation failedsignature filter initialised.MD filter initialised.compositeComposite filter initialised.LVM type filter initialised.%s[%d]dev_iter allocation failedReading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %saccept hints found %dread_hint_file close errno %dFound PVID %s on %sAdding pvid to hash failed %sDestroy lvmcache contentLeaving section (%s).Skipping: Deactivating %s.deactivatingdeactivated (reverting) pool only thin onlySkipping: Resuming %s%s%s.Resuming LV %s%s%s%s. if activeresumed origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvsfailed suspendMonitoredUnmonitored%s %s for events%sdev/block/%u:%uFailed to generate new unique name for unused LV %sLock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.Couldn't allocate new %s segment.Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Internal error: Cache mode is not determined.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.lvmlockd %s %s vg %s lv %s result %d %xlvmlockd %s %s vg %s result %d %xlvmlockd %s %s failed no resultWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.Reading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.WARNING: bad metadata text on %s in mda%dFound metadata summary on %s at %llu size %llu for VG %sReading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %lluFailed to write mda header to %s.Not enough space to build temporary file string.Internal error: Metadata inconsistency: Not all flags successfully exported.Could not allocate memory for string list buffer.Failed to duplicate directory path %s.No file system info from blkid for %sCannot find active LUKS dm-crypt device using %s.Checking crypt device %s on LV %s.Failed to get crypt device size %s.No file system info from blkid for dm-crypt device %s on LV %s.Failed to get crypt data offset.fs_get_info %s is mounted "%s"WARNING: Device %s: %s is %lu and is unexpectedly less than sector.Ignoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %sThe specified --deviceidtype %s is unknown.WARNING: ignoring unknown device_id type %s.The specified --deviceidtype %s is not available for %s.WARNING: ignoring deviceidtype %s which is not available for device.Replacing device id %s old %s new %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s device_id %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.device_id_add %s pvid %s matches entry %p dev %sstr_list_to_str: string allocation failed.Internal error: connections must be initialized before filtersFailed to create global regex device filterFailed to create regex device filterLVM type filter allocation failedFailed to create lvm type filterdeviceid filter allocation failedFailed to create deviceid device filterNo proc filesystem found: skipping sysfs filterUsable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).Failed to create usabled device filterNo proc filesystem found: skipping multipath filtermpath filter allocation failedPartitioned filter allocation failedFailed to create partitioned device filterFailed to create signature device filterFirmware RAID filter allocation failedFirmware RAID filter initialised.Composite filters allocation failed.Allocation of persistent filter failed.Couldn't create hash table for persistent filter.Allocation of device filter for persistent filter failed.Persistent filter initialised.Failed to create persistent device filter.Partitioned filter initialised.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.WARNING: sysfs path for %s attribute is too long.%s: Symbolic link to directory%s: Different filesystem in directoryChecking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.ignore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uignore hints: no device matches devices file entry for %signore hints: devno %d:%d does not match %d:%d for %signore hints: no devices file entry for %s%d:%d: dm_snprintf failed for path to sysfs dm directory.Ignoring lvmcache info for dev %s because dev %s was requested for PVID %s.lvmcache_info allocation failedSaving initial duplicate device %s previously seen on %s with PVID %s.Initial duplicate already in list %sChanging pvid on dev %s from %s to %sChanging labeller on dev %s from %s to %sInternal error: vginfos list should be emptyLeaving critical section (%s).LV %s has open %d snapshot(s), not deactivating.Deactivated volume is still %s present.Not using origin only for suspend of %s.Internal error: LV %s missing from preload metadata.Internal error: LV %s (%s) missing from preload metadata.Checking VDO pool status for LV %s.WARNING: Failed to get uuid for dtree node %s._sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too small #L$tI/dev/dm-%uV2 %s %lu %u %lu %u %s %s %s read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroing%s %s %d %lu %d%s%s%s%s%s%s%s %luclustered-userspace %u %s clustered-%s%s %u nosync block_on_error 1 handle_errors%s %s %c %d%u %u %s%s%s%s%s %s %lu %s %d %u rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %d%s %d%s%s %s %s metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u metadata_only pause_writeback %u meta_device:%s recalculate journal_sectors:%u ineterleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%llu%s/block/bdiqueueuremovableslavetraceuevent%sblock/%s/%s/devPool %s is unlocked.Pool %s is locked.compression oncompression offindex-enableindex-disableParsing VDO status: %sCreating %sFailed to set uuid for %sLoading table for %s.Unable to resume %s. (Ignoring.)Renaming %s (%u:%u) to %sName "%s" too longFailed to suspend %s (%u:%u) boolean array with values of type:Failed to duplicate filename.config_tree allocation failedLoading config file: %sFailed to load config file %s%H:%M:%S.%06d some losing %s resilienceCan't convert %s LV %s to %s.Adding metadata LVs to %s._extractedCan't convert %s to %s.connectSending daemon %s: helloDaemon %s returned error %dprotocoldaemon_opensanlock lvmlock LV removedFailed to format %s device number for %s as dm target (%u,%u)Can create VDO data volume path for %s.Correcting VDO virtual volume size from %lu to %lu.V4 %s %lu %u %lu %u deduplication %s compression %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %uWARNING: Ignoring RAID1 stripe sizeFailed to get %s target versions%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sCouldn't create path for %s/%s.Couldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Using udev_flags 0x%x for activation of %s._deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %uInternal error: Pool %s is already unlocked.Internal error: Pool %s is already locked.Expected vdo target for %s and got %s.VDO needs message for compression %u(%u) and deduplication %u(%u).Failed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sCreate dm_task creation failed for %sFailed to set device name for %sInternal error: Unable to get DM task info for %s.Reload dm_task creation failed for %s.Insufficient space for target parameters.Insufficient space in params[%zu] for target parameters.Target parameter size too big. Aborting.Suppressed %s identical table reload.Resume of table of extended device %s delayed.Table size changed from %lu to %lu for %s.%sRename dm_task creation failed for %sFailed to set name for %s rename.Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedFailed to rename %s (%u:%u) to %sFailed to build dev path for "%s".build_dm_name: Allocation failed for %zu %s %s.Internal error: %s cfg tree element not declared as array.Failed to create default array node for %s.%s not found in config: defaulting to %dFailed to allocate config file.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.struct mda_list allocation failedInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Minimum of %u stripes needed for conversion from %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Reordering areas for raid0 -> raid10_near takeover.Updating VG metadata and reloading %s LV %s.%s: Opening daemon socket to %s for protocol %s version %d.%s: Daemon socket path too long.Daemon %s: requested protocol %s != %sDaemon %s: requested protocol version %d != %dFailed to remove sanlock LV %s/%sP`\XX`]W`WXXXYY[[x\TTTTTTTTTTTTTTTTTT4,_free_vgseqno = description = creation_time = -- Incomplete rangespecificationRemoved %sRenamed %s to %sSELinux context resetselabel_open failed: %ssetfscreatecon%s: mknod for %s failed: %schownCreated %sUnstackingStackingdaemon_close in VG sub %s lockd_result reply error %dlockd_result bad responselockd_result no op_resultresult_flagsNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSfree_lv_free_lv lvmlockd result %dvg_updatestart_waitLock start failedstratiscryptoCRYPT-TEMPCRYPT-SUBDEVstratis-blocked_mirrors%d:%d %d:%d%s: %s device %s not usable.invalid snapshotsfrozen raidunusable_thins%sblock/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtool_mlog_LV %s in not partial.%s has enough space for %s.%s_iorigraid5_lsraid6_zrraid5raid6raid10_near (same as %s%s)Failed to hash mda.Livelvfullname snprintf failedWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u unlink_newhints errno %d %sclose %s errno %dInterrupted initialization ofFailed to wipe signatures onFailed to initializeInterrupted initializationclose and reopen rw %s%s logical volume %s.BLKZEROOUTScan failed to open %d:%d %s.Scanning submitted %d readsScan failed to read %s.Scan failed to process %s%s: No lvm label detectedFailed to read vg %s from %sVG %s not found on %sFailed to parse %s '%s'.%sdev/block/%d:%d/slaves%sblock/%s/device/wwidscsi_debugpvids: devs: differdevice is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filteredskip invalid metadata with len %llu at %llumetadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.Failed to extract full metadata text at %llu, skipping.Badly quoted character at end of expressiondm_report_field_uint64: dm_pool_alloc faileddm_report_field_uint64: uint64 too big: %ludm_report_field_int32: dm_pool_alloc faileddm_report_field_int32: int32 too big: %ddm_report_field_uint32: dm_pool_alloc faileddm_report_field_uint32: uint32 too big: %udm_report_field_int: dm_pool_alloc faileddm_report_field_int: int too big: %dFailed to allocate target segment area.Node %s was not removed by udev. Falling back to direct node removal.A non-block device file at '%s' is already presentThe node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.Unable to unlink device node for '%s'The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'selabel_lookup failed for %s: %sPreparing SELinux context for %s to %s.Resetting SELinux context to default value.%s not set up by udev: Falling back to direct node creation.Insufficient memory to stack mknod operationCould not signal waiting process using notification semaphore identified by cookie value %u (0x%x)Closing daemon socket (fd %d).Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.lockd_result %d flags %s lm %slockd free LV %s/%s %s lock_args %slockd_free_lv: unknown lock_type.Missing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.lvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: Mirror device %s not usable.WARNING: Incorrect snapshot table found for %d:%d.WARNING: Incorrect snapshot-origin table found for %d:%d.%s: Invalid %s device %s not usable.%s: Frozen %s device %s not usable.WARNING: Cannot get thin-pool major:minor for thin device %d:%d.WARNING: %s: Thin's thin-pool needs inspection.%s: Error device %s not usable.WARNING: %s frozen raid device (%d:%d) needs inspection.%s: I/O blocked to mirror device._get_glv_str: dm_snprintf failedFailed to allocate string for new LV name.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %s.Not enough space on %s for %s.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.Internal error: %s logical volume %s is not a user of %s.Removing historical connection between %s and %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list WARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listNot using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.skip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dscan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedVolume %s is not active locally (volume_list activation filter?).Failed to sync local devices before wiping volume %s.Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Initializing %s of logical volume %s with value %d.%s logical volume %s at position %lu and size %lu.%s logical volume %s with value %d and size %s.Metadata logical volume %s not fully zeroed and may contain stale data.Scanning %d devices for VG infoProcessing data from device %s %d:%d di %dIgnoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sScanned devices: read errors %d process errors %d failed %dFound label at sector %llu on %sZero areas not allowed for segment %sMissing offset in areas array for segment %s.Bad offset in areas array for segment %s.WARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sFailed to generate backup filename (for removal).%sdev/block/%d:%d/loop/partscanSysfs path for partscan is too long.Sysfs path to check mpath components is too long.WARNING: Path %s is not a directory.Failed to create sysfs wwid path for %ssearched_devnames %s file pvids %d %u devs %d %u search pvids %d %u devs %d %udev_cache_index_devs: dm_snprintf failed._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberWARNING: Configuration setting %s is disabled. Using default value.device is rejected by filter configdevice is restricted internallydevice is a multipath componentdevice is too small (pv_min_size)device is not in a usable stateVG info not dropped before rescan of %sVG info not found after rescan of %sChecking transient status for LV %s.h0p 000000000000000000000000000000000000000000000000y0lT<, |l\L<, <,l\P@(`@0 p; JC DHl\ht `ͪ\4#-A<K U\ l v<Ph Ϋ,D!/#ެLBBCDEE |hlµD"̵\/h?4@dQW=LvGxQ|,@LʶӶhX$.\8[ld܈|JJ$KdKKL,L4LdMTxMNTNDdOO$hPPlQQ4 RTlRRD0SS$TTTD0U$xUTUHVDVVW\W4WWX4xXxYYdZLZ#ZD$$[$P[t%|[&[t' \$(H\*\+\,]d-8]$.T]0]1$^2P^Z@a4\adbebtfcfcf,cf@cfTcfhcf|cgc$gc4gcDgc4h(ditdteze$@f\fāxfdfg\gԆgdhTi4i$i@jt|j4jk(lXmmDmnotd>>4???$@$t@@@`AABCDxEDITIK$MM8PRT,V|X4ZdZZ[8[d\]$^^,daatcTDhdm$n4rhtu0vpx$y zH4ăl4D$PԉTLTD4ķdt4$h4DT@ThT|$ 4LT`T0T\d|Dt,XT $HTDT(%&,$/7 tCN4N0S4adhHijTjkdyz$z4z Ĉd\4dXĎxdԛl4 X$ xdTx4Tx<T4LtXT@d\440DT t 0T P d @ T!!"#|(D+T1$1D1t11,3$4$7D7|$9d:;$<=>(?xt@tBC0$FlHIf\giDjLDkl(4mToTq$ru4 uH Tw x tx x( yL ${ { tH   x $ d| ԛ \$p8l<Hd lD D p @"$4T'4+fPjptTu|}$ Ĉ!`!!#<$$48,,t-@-t--@.. . 4/ |/ / /4 0T0Tp0t00T1141TH223H3T 3!4" 4#X4#l4$4&44'5D)X5,5,50<61626<7T=8D>@8@|8B8B8CD9TF9F9DG:ct<Tz =4=,>T>D>$B8BT`B4BԸBdCdC$C$CtDD0E4EEE(FFFDFt\GpGTG4H4H4IIDJJDK$K(L`LL MT pMD8NN$,OdOOPLPTpP"P# Q%dQ&QD2R3RT40S$8Td:|T4;T;TVd?0V@hV@VB\WDEWFtXJYNYdPYRTZVZW8[WL[tXd[TY[` \Dcx\4e\f@]g]h]i]4j^j`^tm^oP_p_p_q0`qD`qX`ql`q`r`r`$r`4r`Dr`Tr`dr atr ar4arHar\arpararararasasa$sa4sbs8bs`b$tbttbtbucdu(cuPcvxcTvcvcvcDwdw0dwXdxdDxdxdxdy eDyHeypeyezeze{Hff44gĈgԉghThhh44iĚitj$jkdktnTodp\ppq4qrd@rlrrdrrslssss \tT ptd t t$ t uhuuulvvvDxd$x$x&x4&yd&y&(y'y'y'y(yt+z2@{5|{7{$8{<|@0}A}B}C~DDP~E~FtQ4SdS|XY@d[ephtiiTk|l$nTvhwĄxd|}t~t$dĒ@D|d8DD H$ĢЋ$D|Tt@4̍t8܎$p4Аd$TT\ĒT$8LTtdt Xt44Е p \tD4,xtșdDd$Ě$`dЛ4Tt,`tȜ8 D<DtȞܞ$P̟D@l%$T'T(ȡ*$+D+d,Ģ--0.|0$2,3p8D:$;h<=D??t@Ħ@$AADB4dCPCl$DtDDEF<FGԨIXTIlIIII$JЩdJ4K DK K4KH$L\dLpLLTMԪMMDN$NLOtTOO$PtPQQ\dRtSЬ4T$U@Ul$VTVVWW@DYd[Ԯ$\]D]^_4`Xapa4b$cİcܰtdee0$fHDgldhijkl@TndoppȲ$q$r$sH$t|$uDuijTuسdutuuu(u<uPudvx$v4vTvvдwTx0y`yzdz̵d{d|d|~$tDă \T(ĈLDԹD,@ďThD|ĐD̺đDĒDDlēDĔD ĕ4D\ttܼ4нt`Ħоħ  $4TH\pп$t|4Ddt(4TĭtTd4tt|TtDtT$ttdd4Ttdx$Thd  D$\t&d*(/(1230d7W]Dcoqrd|X4~ 4Lt$hTԕ d<LTdt0ĩH4T$D<tThtD4T`T\DttT T t$ddd4 !#d$&4(d)4,-`$.67$T9h:::;]]_8t_p____d``H$adTaaethdiTjTk\tlDmm dv||dD4TdT@TT8$T4448p 4(dTdT LTp4d $<TXDt$X $ & T-p d/ 0 8 T= TE I4 4JT D\$def4dhiTjpxdtD$d@ą\4$d8T|4Č@$`D`tԘ tXD|@hDdT(TPtdTt@Ժ$$PD|dĽDdľ$<$h4 8txd TtDtD( t Td""4#DT#x###T#$,$P$$|$$t(%%%T&&!'d)'t.4(.P(a+tb+Th,h,Di,Dlh-p-x8.y.D{.|/4/D0Ԉ040T 112H2$2d2<34T45tH54l5557d7488:T: ; x;<<P===d=T(>4@?DGT@4UA_C$``CbCdeDDTkDmHE4oE$r|FrF4xG|Hd|H|HD}ID\ITpIdItIII4KKD Lģ8LԤlLtLԥL4MHMMM4MMT,NNO4OD`PPPP4PTQTQdQQQQ(R@\] hDTlt0d|4x $ll$LdTt$$$ t T |  TdT#'*LT.t/d01\16H8M0OtexTgh8lr,wdx$tz`{~L$TDTTT`d<4hd(p44pıTLԽTDdl,TX$ T8PDth4 X|dLtT "tD#D'\d)t+Ut\^LDacTdtdhtjdv0DL<4ċTD@tDԳ@tL  4 d   \  $ 4| D T4 d  0DldT|Dd$d$\T,XT \| D<77T8T9X:;>?FltGHJ0TQRt[fg0h|4il$ l` o !qL!$r!r!t"y"y"tz#T~#l$4$$(%<%$%zRx $BFJ w?:*3$"DhPL\`pBBB B(A0A8G 8A0A(B BBBG HraQAA N ABD _FBAH EABHswFEB E(A0A8DP 8D0A(B BBBF |D8uFBE B(D0H8GpVxFdxApxHbxApF 8A0A(B BBBK  8F0A(B BBBE 0xnFIG N JGK eFBxX pyFNQ J(G0A8DPX\`EhKpKPL 8D0A(B BBBD hz"FBB B(A0A8G L@LC1 8A0A(B BBBH DCHCYCAC CICV WCTCMCACkCHC`H~FBE B(A0A8DPz 8D0A(B BBBD S 8J0D(B BBBG tX~[FEE E(D0D8G[GEBY[ 8D0A(B BBBB FKEN\[ @CEG@` AC GHHPJXB`I@{HHPGXB`I@ 49FBB B(A0A8D`ShJpHxBI`p 8D0A(B BBBA lhLpPxBI`uhGpHxBI`rhNpHxBI`NhJpJxBI`bhKpMxHI`HhJpExBI`EhJpHxBI`QhDpBxBM`chGpBxGN`|hMpExBI`VhJpJxBI`tD؅FBB B(D0A8DA 8D0A(B BBBE IHJBIKGBIh9FBB B(A0D8D@X 8D0A(B BBBF DHKPIXB`I@HKPLXB`O@(Y6@lHFIB B(D0C8G`D 8D0A(B BBBF DhJpGxBI`hKp@xAS`X`pFGB B(D0D8DGJBIL 8D0A(B BBBF NdATLFBA D(D@z (D ABBD DHKPIXB`I@LHjPHHA@XؐFBB B(A0A8GPC 8D0A(B BBBK DXK`IhBpIPH FBA D(D@C (D ABBC DHKPIXB`I@XLFBB B(A0A8GPC 8D0A(B BBBK DXK`IhBpIPd$DFAD | ABF D(K0I8B@I b(J0I8B@I W ABC ` ABE p sFBB B(D0D8DHIBI 8A0A(B BBBH MdAp ZFBB E(I0D8DGJBIL 8D0A(B BBBB NdA FGB E(A0D8DcHIBI~ 8D0A(B BBBI MbAWHJII KV 4 FDD n ABA ABH AFBB E(A0D8G@ 8D0A(B BBBJ D FBD D(D0S (D ABBH ~8M@]8D0LX (FBE I(C0 (D BBBE m(D BBB| FBB B(A0A8D_NARFdAT 8D0A(B BBBH DJHBNh( FFBB B(A0A8DpxFdxApT 8D0A(B BBBH DxKDBIp H X H D EDDPrXM`\XCPT AAG GXH`GhBpIP@ FAA D`dhHpJxII`T  DABA 4< AHD K AAF @AAHt fFEE E(A0D8G@n 8D0A(B BBBD 4 FAA G L!  AABI \ eFBB D(A0 (D BBBK e (D BBBA z(D BBBXaFFE B(D0A8G1RTAj 8A0A(B BBBE 1H[AMWBK[ASNA HZ jJGBI HJBIaMM ^ HS g HR XX$FIA A(D0 (D ABBE u (D ABBJ D(G DBBO 0 ̽EG0_ AD 4HFAG0l DBH _8M@Y8A0,0/ FBB B(D0G8GM\C^ 8A0A(B BBBD HJBINOHZN (FKG`a ABA (FKG`g ABA (0|FGJ`o DBA (\FGJ`u DBA `dWFMU A(I0z (F BBBH K (A BBBF h (C BBBG 8`FHA Q ABE P ABE D(dFFA D(D` (D ABBA AhNpF`8pFFB A(D` (D BBBA L FBD D(D0k (D ABBH a (D AEBC H@ A $H@ D |4oFBB B(D0D8DP 8A0A(B BBBK ? 8C0A(B BBBE D 8F0A(B BBBE L[FBB A(G0 (D BBBI D (A BBBE (FBA qBB0,'FSL J(A0A8GO 8D0A(B BBBA DFA|LcAPPBQIrDHCDNH]DLYA7_MAFLMDNjLTAzLcANSABNbA"LmA@SNEAJEFQmFFMFGT|MFOFGPeMFOLmMFOLmMFOQhMFOQN_AENjB&MVB\ PE L^BNSBJNsDFlAMVBhLYAl NL DClAqFlAH X <FBB A(A0 (A EBBD I8O@W8A0p (D BBBF |FFB B(D0D8G` 8D0A(B BBBD hMpAxABAc`hFpJhF`hOpShB`hMpUhA`~hKpWhA`hGpHxHFFK` hMpAxABAL ghSpHxFDAN`4`\FFD A(D0(A ABBHFAG { DBA G ABF D KBG DKBhd ` \4XHT\P6Hmtx t p TlBBB B(A0D8DPXC`hXHPG 8D0A(B BBBA HBBA D(J0n (G DBBH g(D ABB8T FHB B(H0I8GMYAX 8D0A(B BBBE _M]Bd ML @ PP _ ML O MT X PJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _M\Ad MJ ] FB D6FAK { ABH h ABE O AEC D6FAK  ABH h ABE M ABH  H0@ H <H0| D HXDFID D(D0i (G DBBE }(D ABBHFID D(D0i (G DBBE }(D ABBHFID D(D0i (G DBBE }(D ABBL<@$FBB A(A0# (C BBBH g (A BBBB l FLB B(A0A8DgIdBIcB 8A0A(B BBBA 4@& FHB I(H0G8GpMYAX 8D0A(B BBBE _M]Bd MT H PP _ ML _ MT _ MT _ MT _ MT j MJ _ MJ H MJ _ MJ _ MJ _ MJ _ MJ ` CE ` CE I FE ] FE X4/!AAG h AAE W(I0d(A f(H0^(A D AAH [(H0_(B ,|0BAD  ABC \<2FLA  BBI h BBD M(N0_(D A BBE e BBG 8 3FBA A(D` (D ABBD @\ 7EAD m(s0L(H  MMK P AAF  >   T9BHB B(H0G8G MO  MP M\A} 8D0A(B BBBC _MYAM MP O MT j MJ `!\=+FHB B(F0D8N ML `M\AX 8D0A(B BBBA  MQ ` MS X PP EPYAQ PP ,"A FHB B(H0I8G MM _MZEX 8D0A(B BBBH  MQ _ ML X PP   PP |MYAyPYAi MJ _ MJ E MJ _ MJ _ MJ x ME d DJ Z JE ^ JE S QE YJ8#JBBB B(D0D8DpZ 8D0A(B BBBE xK[xAp@xFHxApxFcxBpNxMYxBp#0N##LN1FBB B(A0A8G~ 8A0A(B BBBC H_aA^LBbKEFN^TUD MS %O\Aj LL HRCVT$[BBB E(A0A8D@ 8D0A(B BBBF HLP[HA@$\ZtQ K IL%0]BBH D(D0U (M HGIJ s (A ABBG l%`FBB B(D0I8JO]A^ 8D0A(B BBBG M]DlQVIoNgBbMRJMuBPH8$&(iFBA A(D0y (D ABBH X`&jFBB B(A0A8DpE 8D0A(B BBBA lxMMxAp&l FIB B(A0A8G 8A0A(B BBBC LCaAP]A.MMPK|D'uFIB B(A0D8D@ 8C0A(B BBBC [ 8A0A(B BBBK K 8F0A(B BBBF 4'wEKD M DAJ n CAF L'pxTFQB J(D0A8GB 8A0A(B BBBA L({FIA D(G0 (D ABBD k (D ABBD h (D ABBG S (G DBBF h (D ABBG 4(|FAG k DBA z DBH H)}FIA A(D0] (D ABBE D(G DBB4T)}aFHD } ABF l CBG 8)FBA D(D0u (D ABBA H)FFA A(D0U (D ABBH D(D DBBH*FBF A(A0` (D BBBF G(A EBB\`*,FIB B(A0H8G 8D0A(B BBBI EBAP*|FBA D(G?MTTK^ (D ABBF P+FBA  BBA Q BBK e BBG h BBD h+t~K V H+،2FBB A(D0 (A BBBE 8F@a8A0\+̒fFIB B(A0D8GHZAw 8D0A(B BBBI H0,ܕFPD B(H0L8DP 8D0A(B BBBJ |,@ ,< ,8 ,4 ,0 ,, ,( -$ - {GD E jT<-BBE B(A0A8D@` 8D0A(B BBBB aHMPTHA@H-BGD A(D0v (A ABBA ~ (F ABBA (-lFDD t ABK D . FON K ABG x ABE E CBF DT.8FOR K ABK t ABI d(a0O(C D.8FOR K ABK t ABI d(a0O(C D.8FOR K ABK t ABI d(a0O(C ,/(@/ BFG  DBF l/ 4/cFBE A(D0E(F ABB/4/\EZ A GH ]JA I G H K ,0HO I TC hAI A 80dHq G x H I\0ЦuH y G Hx04BEB G(D0y (D BBBI S(A EBL(0xEg L ~H bDA0FBB B(A0A8Dp* 8D0A(B BBBG xNSxApUxPWxDp\xCCBZp_xWDAABIpQxIMBUpP1sFOJ D(A0G 0A(A BBBA PHbC1 FEE B(D0C8G`hPpThA`N 8C0A(B BBBE hLp]hA` 8A0A(B BBBE s 8C0A(B BBBA r hPpN IhKpihB`F 8A0A(B BBBA AhOpfhD`PhWpDxBBAS`MhQpNxAS`NhMpLxAQ`t2ȯBBB B(A0A8G L@LC 8D0A(B BBBA WCTCOCACuCTCMCACHl3`BBE E(D0A8D@G 8D0A(B BBBE 83$*BBA A(J (D ABBG L3FBA A(D0Z (D ABBG ] (A ABBE tD4|FBB B(A0D8G 8D0A(B BBBF JEBIwGHFRx4qFEE B(A0A8DPXD`VXAPM 8A0A(B BBBF G 8C0A(B BBBE qXD`uXGPH85Ľ+FBB B(A0H8G 8D0A(B BBBH p5FBE B(D0A8JaHAm 8D0A(B BBBG HHDL\5gFBB B(A0D8G 8D0A(B BBBH cNdA`X6BBB D(D0 (A BBBD c (A BBBF p (A BBBI H6@QBEE E(A0D8GP 8D0A(B BBBC 7TFLL B(D0D8JP 8D0A(B BBBD RXT`NhOp[PRXK``XBPXO`AhIprPMXF`cXBPd XI`PhFpL 4XF`LXHPfXO`PhOp_PIXD`XXFPh XH`EhO @ XG`Q z XG`H xXG`H7 FEB E(H0D8S 8D0A(B BBBF T88FFB D(D0G`hMpUhA`x 0A(A BBBD [ hMpP L8LFBB B(A0A8FD 8F0A(B BBBI H8FHE E(D0C8K`n 8D0A(B BBBK P,9 FBB A(A0D@ 0D(A BBBD OHcPVHA@9nE` K X9FBA A(G0a (D ABBE  (D ABBH w8C@x8A089dfFAD J ABH y DBA L4:FBE I(D0A8R 8C0A(B BBBI l:HFBB B(A0D8GAXApCUAB 8A0A(B BBBA H:BED A(K0 (D ABBF p(D ABBD@;FRA  ABD M ABH t ABA H;$FBB E(D0H8R 8A0A(B BBBD L;hFBE I(D0A8R 8D0A(B BBBD $<L8<$jFBI E(D0A8R+ 8D0A(B BBBK P<D*FLD (P0R(H X ABD _ CBD t ABI D< PFHD } ABF H ABE E CBF \$=(FEB F(L0G8J  8D0A(B BBBF N\A(=X|FAM SAE C K\=FEB F(L0G8J  8D0A(B BBBF L\A>A4$>EAD C AAA e CAG X\>FBA A(D0~ (F ABBI D (J ABBM e(C ABB`>"FBB B(A0D8DP 8F0A(B BBBJ e8C0A(B BBBH?FBB B(G0D8D` 8D0A(B BBBD ,h?4EW D }l GAM E h? BBB E(A0C8D 8D0A(B BBBA N\A NJ @X+TVL@pFBD C(GPW (A ABBE Z (C ABBE Tl@FLE E(A0A8Dp\xN]xCpX 8A0A(B BBBB 8@X,FBA A(G0] (A ABBD @ALFBE A(I0G@^ 0D(A BBBA HDAFBB B(A0D8D` 8A0A(B BBBK 8A{FEA A(L@S (D ABBA @A`FBB A(A0D@q 0A(A BBBG 8BFHA C(G@e (D ABBA HLBFBB E(D0D8G` 8A0A(B BBBF 4BFBE E(M0(A ABBHB FEB B(A0H8K 8A0A(B BBBE xC FEJ E(A0A8GP 8G0D(E DBBF D 8C0A(B BBBH D 8F0A(B BBBE lC FEE D(A0X (D BBBI y8O@T8D0A (A BBBH c8T@O8A0p8O@D FBB B(A0A8G L@LBABMCZBBB 8D0A(B BBBG $BQC\BGBBNCOCFCKBBUCFCFCFCFCFCFCFCFCFCFCFCFC]BSBICZBABBMCFCPCKB4DFAA G L!  DABD 4E8FBB B(A0A8H Q D^ 8D0A(B BBBJ WTMAQZAQHHPw SQ 8E%FIB G(D0{(A BBBF%FEB B(D08F@CHAPN0b (E BBBK W8O@i8B08O@Z8F0n (E BBBE d8i@AHAPN0u8F@CHAPU0o8M@\8D0A (B BBBJ `F)\FBB B(A0A8G I " u!M A \ 8D0A(B BBBD P8G+FBB B(A0A8D@mHrPwHE@I8A0A(B BBBtG,?FSL B(A0A8G 8A0A(B BBBH H\Af 8A0A(B BBBE (H/UBDA JAB`0H 0oBIB B(A0A8DP 8C0A(B BBBI D 8F0A(B BBBE H1:EtH<1!BBB B(A0A8G L@LI1INIQIBIN 8A0A(B BBBE SICIQIPJIIcITIOIAI8IMIiIEImITIPIBI8`I6BEA C(G0 (D ABBA pI7^BBB B(A0A8G I!z!K!o!A! 8A0A(B BBBH _!T!O!A!HJl9BBH G(G0c (D BBBI D(D EBB(\J9BFH AB@Jt:BBA G L""E"j"b  ABBJ 8J;AAG I x O N F AAA 8Kt<AAG I x O N F AAA XDK=oFBB B(A0A8D@HMPXHD@ 8D0A(B BBBE |K,@FGB B(A0K8DP 8A0A(B BBBH c 8C0A(B BBBA h 8C0A(B BBBD  L|D(`4LD4FBB I(A0D8GCNMOQ 8A0A(B BBBA LtE0FBE H(A0D8J 8D0A(B BBBF KLSMKKQMAFOWKKjFKrHD4HMJFAD f ABD SAEXM\KLFBB B(A0A8DJ`As 8A0A(B BBBA dMPLFBB B(A0A8G L@LBw 8A0A(B BBBB B_BHBCBDNQ|FBB E(H0K8N 8D0A(B BBBG BOcAdKaFSeP]FP]HVN_DgN^HNN^I(OTFAK  ABD (4OXUpFFL n DBA (`OU^FAA RAB@OUFAA G I x O N R  DABA \O|VFBB B(A0A8G L1Y1V1F1A1o 8D0A(B BBBE d0P<[FIL K(D0D8J^oH 8A0A(B BBBD DNSAP\FBB B(A0A8H Q DH_Bv 8D0A(B BBBE LKbA HQ j`GBtbGBrK[AldQbBBB B(A0A8G I  8D0A(B BBBF  K S A [ K X @QdCFBE D(D0G@ 0A(A BBBC Rg,RgBBB B(A0A8G I W 8D0A(B BBBB 6 K!I!P!N  J!F!B!W  I!] A P  I!J i  I!H s  J!F!B!E RnNEHHSo^AA _DBKP D AEF OADPSlpFBB B(A0A8H Q G 8D0A(B BBBG tEGKDFRHLF` GKAL (TMATMAsTNBeTMATGHS]AEBHUAOLDNHVB OE bHOB HJ TPQD K s E d U܃FBB B(A0A8G L!!D"G"A"T! 8A0A(B BBBA U8UFBA H(D0Y (A ABBD HUtFAA G L!  DABE i!`!H!A!l$VȈFBB A(A0D@  0D(A BBBJ U 0D(A BBBH e 0D(A BBBH 4V8AD  AE g XI x DL VFBB B(A0A8D^ 8A0A(B BBBA LMDNlPHFSiMYAFNFKGHDO#LFCPsLFDKHSAeTAU]BjLFCPLFCLJKDUMMFOZLqAMNFRZHtBzI\B[GKAU NDAG Se{D GKAG DMfBX@FBE B(A0A8NFoBHcAHdACQB MQ VMZAC GN yMQAIKYAk 8A0A(B BBBB sCFBHYLhFBB B(A0D8G PLEECNs 8A0A(B BBBH DDAKKTAMZHeKAgM^BmI[B_EEPRPBeTPBMTAI MaAnME KROB[p FBB B(A0A8G L@L`Iaa[aMaAau 8A0A(B BBBD aTaSaAaaMa[aBa8[tFBE A(J (D BBBG ([AFAJ DBF \ >FPK E(A0I8K@HLPMXD`K@HLPMXD`P@sHGPKXC`S@HFPXHA@ 8A0A(B BBBC xHGPKXA`U@EHKPPHB@dHKPIXD`S@XHKPZHA@q HBPN X HHPP { HGPKXA`J F HGPKXA`G g HFPJ \ HGPKXA`G 4]@FAD G  DABG T]h]$(|]0 FAG U DBG ]+Ee@](BHG R ABJ r(O0^(A b DBH l^aBBB A(A0G@ 0A(A BBBI  INAD KINAWx^H Z F l^BIB B(A0A8G!F oE 8A0A(B BBBD KF sAp_XBBB B(A0A8G I b M ` D W 8A0A(B BBBA [ T O A tx_ BBB B(A0A8H Q GȃnЃPȃB^ 8D0A(B BBBH ȃSЃQ؃DIZȃPЃWȃAȃGЃH؃HKaȃeЃE؃DPEȃTЃMȃAȃBЃH؃HU|ȃGЃH؃AKiȃAЃH؃HiȃQЃV؃GIq ȃAЃH؃BE AȃFЃK؃Ml`BBJ E(D0D8G`hFpWhA`x 8D0A(B BBBG DhMpWhD`HhNp\hE`<`aFAA DpxgHxDpt  DABA aH| D k M daFBA H(G0K8R@T8A0D (D ABBI r8R@T8A0G (A ABBJ d,b@,FBG A(D0i8R@T8A0D (D ABBG `8R@T8A0G (A ABBD (bEq J J F  E bEi B  E bxFBB B(A0D8Gv 8D0A(B BBBE FHFNUJLBKMYAJN[AX|cFLA D(LPgXP`MhKpOPH (D ABBF zXM`NhApIPct6FBA A(GaTAZ (D ABBG T aK FoHDQHMK`H^ByCsAI FV PFdEHdFHL L(A0K8Jp 8A0A(B BBBK @dFEB A(D0G@ 0D(A BBBA t$eFBB D(C0Jp] 0A(A BBBH xMcxAp xNL j xNP xNdxAp(e6FPD@ ABF De FAA G I   DABA W T!O A f, ^FBB B(A0A8G L!!Z!R!B! 8A0A(B BBBC +!H!U!A! !H!J !G!H!F!P!` !H!J k!K!M!K!P!DfFBB A(A0G L!R 0D(A BBBD HgaFAA G L!  DABG s!T!O!A! \gENK DF g|=FBB A(A0G L@IA 0D(A BBBG >ATAOAAAANA\AAAQAJAHAAAKAfAPAVABAh(FBB B(A0A8G L"o"H"s"A" 8C0A(B BBBG ~"N"O"F"K" "N"O"F"K"T"O"W"A"\hlFBB B(A0D8JMYAd 8D0A(B BBBD i!H0r F X,i"FBE E(D0A8Gpy 8D0A(B BBBD TxK[xApPi$7FBE A(A0GP.XM`UhLpKP^ 0D(A BBBJ Li'FBB G(A0D8DR^AHY\ 8D0A(B BBBK DaAHIH]HHILWAWCVAc LR u LO IPNDDStKHB]NSBMPQBB LS D PL t PL DOWAq PE ,k.qFBB B(A0A8G I!w 8D0A(B BBBF !T!O!A!j!M!\!A!d!T!O!B!t!O!U!B!v !O!E Hkp1FNA J  DBBH NOJNl3AFBB A(A0G I  M ] B P 0A(A BBBD g M U G  R O A N K _ C ^ P O A l5=HT `|l5FFE G(D0A8JPTOBh 8A0A(B BBBB L[APfJAPm8FBB B(A0A8G L""Q#]"B""O#Q"B"p"K#Y"F"^ 8A0A(B BBBF "R#O"A"Pm<&FAA G I   AABA \ P O A H M [ x8n<FBA A(G I  (D ABBB O M a I L a B T _ H A f P O A |nX> FBB B(A0A8G L((M(O(E(P(m(K(X(E(g(O([(A(` 8A0A(B BBBE G(M(\(D(l(K(E(E(_(x (E(G (P(V(C(g(O(R(G(i(`(E(A(P(a(N(J(A(P(S (O(N (M(J(B(B(E(E(H(S([ (U(R _(Q(I(B(E(E(P(Y(X(R(A(t (N(L(A(E D4pETFAA G L!  AABD l!K![!C!|pGFBB B(A0A8G L@LCCWDQCBCjCHDbCACb 8D0A(B BBBG `COD]CBCmCTDMCACCTDMCACnCOD]CACP8qK&FAA G I   AABA \ P O A H M [ 4qLFNA | ABD OAEq(MNH8qMFAA { ABJ p(a0O(A r  8rTNFBB B(A0A8H Q G0RbAQK^BG 8D0A(B BBBE O\AxrRYFBB B(A0A8G L@LBBPBwBTBUBMBFBFBAB^ 8D0A(B BBBE xLsVFBB B(A0A8G L@LBwBhBaBTBZBMBEBFBAB^ 8D0A(B BBBA 0s$ZFAC g ABD sZtZ $tZ8tZCLtZ=`t[ <tt[FAG E DBG T(R0T(A NABt[tOMt\MEQ J h8tL\jFBB A(A0V(A BBB,u\FEB B(A0A8JDjDQHJBIFUANYASSHO{VME>MYA} 8D0A(B BBBD  FV K[AeV[IaMaHB]nC{[[I[NBPFCO9FUBGJBImLTF|HoAcRIERGIIpAwN4(wdyEFD  AAE J CAA 8`wLzFBB A(DPE (D BBBB Hw {FID D(D0i (G DBBE }(D ABBwt{ wp{EP(xt{FDD ~ DBN Dx{MEP K hdx|MEP K hx8|MEP K hxh|MEP K hx|MEP K hx|MEP K hy|NEY J  y,}MEP K h@y\}MEP K h`y}F^ A \y}EFPD E(A0A8NP 8F0A(B BBBA c8C0A(B BBBy~`y~FEE E(A0A8G@ 8D0A(B BBBA ~HRP^HA@kHRPTHA@LXztFBA A(D0A (A ABBK u (A ABBA z\FBB E(D0A8DPQX@`IXBPD 8D0A(B BBBK V 8A0A(B BBBH nXP`_XAPXF`OXAP(4{vFAG m DBO H`{< FBB B(A0A8D@ 8A0A(B BBBE ,{KEAG L! AAK 8{ BEG A(G0P (D ABBA X|RAG Y AAK pP i(C0n(B `(R0b(A o(P0R(A Ht|xNAG W AAA LFAEH (R0T(A H|FBG D(J@@ (D ABBJ HOPDXC`U@L }SAA ABEH H(R0T(A G ABG 4\}@FAG@ DBE HRP[HA@$}AG I  AC }P&}l HW,}tBOP F ABA (~ԒFAG n DBF @D~8 FEE D(D0D@ 0A(A BBBG (~FIG@t DBH ~ZFf D i4~(FAD O DBH p(g0H(A | FHB A(G0W8G@G8B0U (D BBBB I8E@i8A0 (A BBBH T 8H@L T8L@h8C05K` IԗFDD D(L0f (A ABBF D8M@c8B0g8F@P8A0D (A ABBB D (M FGKG X 8M@c8F0]8F@O L4FBB B(A0A8G 8A0A(B BBBB HFBJ B(D0A8Np 8D0A(B BBBD $ЀlEG L!v AA LFBB B(A0D8J 8D0A(B BBBD |HĦbFBB A(A0G I!!N!B!B!B!B!B!B!I! 0A(A BBBC D!C!e!A!Dȁ>FBB A(A0G I o 0A(A BBBE <FBB A(G L! (D BBBI HP|FEE E(D0D8D@f 8D0A(B BBBD LP FBE D(D0e (D BBBD X (A BBBI 8QFED A(Dp (D ABBD T(47FBB B(D0A8G`hMpchA`` 8D0A(B BBBJ <FBB A(G I p (A BBBF PFNI B(A0D8Dw` 8D0A(B BBBE 4H>BBA G I   DBBG @LPfBAD  DBA z DBH k DBG |gEJ A D L <ȶFBA D(JB (A ABBA 8(FBD D(J (A ABBA 80̸BBA A(D@T (D ABBI 0l`FAD J  AABA  ,QAC DKF C DHBBB B(A0G I  0D(B BBBH H,oBBB A(A0G I  0D(A BBBF TxHBBB B(A0A8G L@I@ 8D0A(B BBBK PІ BBB B(A0A8G L1 8D0A(B BBBI L$XFLB B(A0A8GJ 8D0A(B BBBJ tE^ E S(FHGpx ABH BBB B(A0A8G L@L`Lb&bOb`bBbO bNbYbAbwbGbO R 8D0A(B BBBA NbIbHbFb[bibTbObAbrbTbObBbbGbHbAbKb@ bGbHbFbL wbCbPbAbbIbLbLbKbD̈pBAA ([0U(F W ABF p ABE 08FAG s DBI KDBDHFAA G I >  AABF H k J h\FLB B(A0D8GFWAX 8D0A(B BBBD f FE d FBI B(A0D8F`  8C0A(B BBBJ 8A0A(B BBBdx(x  |BBL B(A0A8D` hOpMxJMD\`mhFpHxFFIP` 8D0A(B BBBE  4HN8\FGD A(G@ (D ABBE dFBB B(A0A8G L@I@@N@g@E@S@C@p@A@\ 8D0A(B BBBA @G@H@AAK@G@B@H@FAK@y@A@H@BAS@a@Q@K@A@I@M@F@KAO@o@G@H@AAxHFHA W(M0c(B [ ABJ D(P0Y(F0m(A a(P0K(D A ABK `(J0H8F@K DAB(vFAL s DBD ,|@FBB B(A0A8G I | 8D0A(B BBBI O I g a N J D X L a A Ll_EGP AC uGHFWB GHFB (|FAA ABl<FIB B(D0D8GDMHRBA 8D0A(B BBBG 4 vUAA uABAP t FPJ B(H0A8JgHAEL]AbKcAJO_BLOCIRPC^ 8A0A(B BBBI ]MVBMVBLXA}]dBSKBN`BhNVB} fmFDMH NYAJYAF[ND\P4YVxt(E^t&FBB B(D0D8Gp 8D0A(B BBBK xMYxDpXxbPxApZxN[xAp @ FEE B(A0C8JT NN HTDNPYD^ 8D0A(B BBBJ .IaB^PWDqP^B$ 'H@c E fHPPYHC@L'FEB B(A0D8G- 8D0A(B BBBK X8)`FBB L(A0A8LPz 8D0A(B BBBE 4XK`YXAP0/FNA G`  DABG \Ȓ41BFB G(G0D8D 8D0A(B BBBH eMJBP@(t2BHL A(D0Gp 0D(A BBBF Hl3FBE B(D0D8N` 8A0A(B BBBG Ld4 FJB E(D0A8D 8A0A(B BBBG \$8FJB B(D0A8G 8D0A(B BBBA tLcAhhd<FBB E(A0D8NPMGABIm 8D0A(B BBBC Ԕ?FJE I(A0A8G 8D0A(B BBBE MeAPMeBhIlA NN K MV K MV DUHK\@ MV D UHKJ \EBBB A(A0 (D BBBG G (A EBBG b(D BBBl FdFEB E(D0A8G 8D0A(B BBBD  TjAMYA|NFGE B(A0D8GMZA 8D0A(B BBBD CHeB>MZAV FBB B(A0A8G 8D0A(B BBBF DDiB KY I`AuKBBBADABBXkHAE  ؗta FBB E(A0A8GTRaAEQKABASaQKABASJQKABASJQKABASJQKABAS 8D0A(B BBBJ PR`BFgBFdAjjFNB B(A0A8GKADDAGDDABGALGGBBGBNGBBAAGGGBLn 8A0A(B BBBF ܙo` FIB B(A0A8GzDGAwZGBr 8A0A(B BBBH kPYBHK\AK\A8|oFBA I(DP (D ABBA hFEB E(D0D8G@HePEXF`I@IHEPEXD`X@ 8D0A(B BBBB (DIBJH A(F0GPVXF`BhBpBxBBBIPkXK`^XAPX 0D(A BBBE SXI`aXAPFXM`\XBP4JFDG ^ ABF GDBH4FED D(D0 (D ABBH (D ABBLD FEB B(A0A8JfFDIHPiDDDAKHSNGFKPOIAPrYIDPcJbAOy 8D0A(B BBBG gPLBDAXQQHK]QKCXTVLAXWiGGBIlVDDDAKJSPJIK`wLMADFFVRANDUl NGBDHE QQEDHPp QAAJ Z^XAOgM_A_NcEBIH_,bFHH zAIĞ( ؞$ t BBB B(A0A8G L* 8A0A(B BBBE a*E*N*B**V*W*B**T*M*A*t* EG AB 8FBA C(G`m (A ABBJ DhFBB B(A0A8D@8A0A(B BBB(<HPr F IXH`DhBpIP(hEAD0 AAH DXFBB B(A0A8DP8A0A(B BBBXܠSFJB A(A0G 0D(A BBBK z 0A(A BBBF 8YEy B X0XDFAG \ FBF XFBK A (DeFFL b DBA ԡVFBB B(A0A8GFV\KlyID^ 8A0A(B BBBI gFHD}OSD MODM'POAH,FBB B(A0A8DP} 8A0A(B BBBG lܢЮFBB B(A0A8DFUEL 8D0A(B BBBE FFA4LFAA G I   DABD d8NFBB A(A0D` 0D(A BBBD ThRpWhN` hRpK hOpWhA`H fEDG0h 8O@I W8M@V8F0j AAD P8O@T8A08D~FBB A(A0GHeA 0D(A BBBF DN\BM AJ LaC,@eFAA  AWM hQFEE A(D0Gp 0D(A BBBE xOWxApQxRWxNpd xRJ Xtt@ D tFBB B(A0A8J 8A0A(B BBBD XKUCYNUBLWA8DBGQJ DBF DJYA 4EN E C X$Fo K f A L|FHN ` DBF I(H0^(A G ABA U(M0M(A (̦RET G IH ^AA\4FLH D(D@ (D ABBC IHIP^HA@PHIP^HA@HHNPYHB@XWk F gTxDODE m ABH k FIF U(H0^(C A ABF I(H0ЧFSI J(A0A8GJDGN 8D0A(B BBBE ~HPNIKUAIKYAIMXAIN\_IVZZu|PBW IXUJ LqB4FL[ I ABG D MLK QFBB B(A0A8G L@I@ 8D0A(B BBBG t@MA\@B@@DAQ@A@@DAQ@G@B@AAU@A@Y@_AI@A@R@MA]@B@ ԩXZTzH0HI G r F h H j F g4,uFIA S BBI c EBF d(FBE B(A0A8G@zHQPYHA@T 8F0A(B BBBH h 8C0A(B BBBD oHKPRXH`W@F 8A0A(B BBBE qHNPOXF`K@CHNPOXF`K@@HNPOXF`K@~HGPHXD`8%FBG E(H0D8G 8A0A(B BBBD WOTCl PQaRK WTOABBB B(A0C8GPpXb`UXAPIXm``XAPNXG`XAPGX\`UXDPI 8A0A(B BBBF HXl`RXAPIXk`LXAPBXB`kXEPiXm`yXBPF8A0A(B BBB P,g~ExDجFAH K ALI O ABF B ALI  fF_@<EDQ Y AAK ^ FAK ^ FAK @FAG ` DBD A DBA sDBHĭHEDD _ AAB p CAD i(M0\(A FAALFAG (N0\(A D DBK s DBG f DBD `  x%l0FJA C(G0V (A ABBI D8`@8A0B8B@h8D0N8`@u8A0F(A ABBLFBB B(D0D8G  8D0A(B BBBF L԰tlFBB I(A0D8GpxKWxApxCIxBpYxLVxAp 8D0A(B BBBI `FBB B(A0D8DHJJI 8D0A(B BBBD Hh4ab E (&FHG0 DBF LwFBB B(D0D8GM 8D0A(B BBBK pdFEE G(A0C8G` 8D0A(B BBBB hmpPhA`LhppLhA`BhBpfhB`tخ`\ ?FBA u(L0I(A o BBI V BBF c BBI s(H0^(A u |D A K F0^XDHFNE B(D0D8J 8A0A(B BBBB LM^A\FBB B(A0A8D5 8D0A(B BBBD G^D} \ <FBB B(A0A8D 8D0A(B BBBD GaA 8FBD D(G (D ABBG ܳ^LFBB B(A0A8J  8D0A(B BBBA @Q 8`"FAD f ABD Y JBC "Ĵ"tgܴܫH|#FIB B(A0A8DP 8A0A(B BBBI <P\\$FBB B(D0A8L 8D0A(B BBBF CRAT(FBE D(A0Dp 0A(A BBBH xHGBIpʪ pP4*PHA H ABD (e0Z(A G(J0\(F `  80D0̶P0((l0WBGG M DBE p 0FIB B(A0D8DPXJ`JXAP@ 8F0A(B BBBG x 8C0A(B BBBA <21HV D(B0L\2BEE E(D0D8DPqXM`PhBpAxFFITPa 8A0A(B BBBF V 8C0A(B BBBF 4$4FDG h DBA W DBC X\`53BBB B(A0A8DPXK`DhBpIPs 8D0A(B BBBB <D61FAD GPXk`LXAPT  AABJ lD7NBKB B(A0C8DP 8F0A(B BBBJ jXK`^XAPF 8A0A(B BBBA h$8oTZT|8c]BA { BBI D EBE Q BED `C ع  x9L9lFBD A(D0 (D ABBE \ (D ABBK (X;FAG0 DBG H;FBB B(D0D8G@f 8D0A(B BBBB <к|=sFBA A(G I  (A ABBD 8>0FBB D(G0u (D BBBD ,L@FDK  ABB |  DB YX,CFBB E(I0D8G`N 8A0A(B BBBE  h]pHhH` `@<``FUB A(GXr`KXAP} (D BBBF L`nFEB A(A0 (A BBBB p (F BBBD Xмb,FBB D(H0r (A BBBA Z8K@_8K0J (I GBBC p,bFIA D(D0p8L@^8A0F (A ABBA R (F ABBC W8I@l8F0D(A ABBd|c3FBA A(D0t (A ABBH g8M@\8A0F (A ABBC \8M@LHNPI0(TdFDG  DBJ <4dFAA G0  DABI X8`@O8A0<txf5PAA G0S  DABE |8G@h8A0xhHȾ4iFBB B(A0A8D` 8D0A(B BBBH xld(lFBB E(D0G8FP\XK`MhOpIPT 8D0A(B BBBC xXU`HXAP,mFEG C ABH ,n\ԿO dnpFl F w ngT E bA\,@oFBB A(G0[ (D BBBI  (D BBBG s(D BBB ppwX]KPftp FBB B(A0A8DpjxdPxBpx_RxBp 8D0A(B BBBD xM`xBpL($zFIA D(D0X (D ABBG e (D ABBB 4xzFDN U LBE g CBD {FBB B(A0A8D 8D0A(B BBBG P`BMYAMZBK[EIPFA8XFGE B(A0t (E BBBD h>BEE E(D0A8GOJVABHPAD 8D0A(B BBBG q[OB\SB\SB<\mpԝ (.FBB B(A0A8J&CNBViLBLTIBaLHBI 8D0A(B BBBA IrHHAFAPLTESjNGsPBBIMHA[KJA[kWFAwUFA^MAcZHEBBIiM\AJJF`PEEMP[IFAIDQM\ALMdAw MR PMbAXAFBE B(A0K8DPh 8D0A(B BBBD QXL``XAP(ܼFBE J(D0D8GO[AxGHDBBNRKANRBKQI 8J0A(B BBBG uKJBBBBGBEQV 8D0A(B BBBD DKPBUBAP(INA2 <`^lPPBB B(A0A8DP{XO`^XAPX 8D0A(B BBBF XN`]XAP` XI`W TBFA D(D`S (D ABBC GhHpJxBI`ahppEhC`LBBB B(A0A8G L" 8A0A(B BBBA phBBB B(A0A8G I  8D0A(B BBBC  q [ A l A M S P BBA D(G@uHMP\HA@X (D ABBH  HKPP 0(@L ;BBB B(D0D8D`mhmpdhL`ohHpGxHN`hhUpQhA`chMpDxAI`J 8D0A(B BBBJ DhEpJhD`JhIpchH`BhBpGxAM`o `(AK F AE m AJ H,  (`ABAD0 DBG 8 FDD n ABA I JBK \BKB B(A0D8K6 8D0A(B BBBD CMAH(4FBB B(A0A8DP 8D0A(B BBBF t@FPI A(D0T8D@R8B0f (A BBBC 8N@KHNPK0F (A BBBF  (C BBBA 8j@}8G0H|/FME E(D0A8Dp 8D0A(B BBBA LL`:EDL w FAE i FAH h FAA p CAA   l8,FBB E(H0A8DPrXK`AhBpBxBIPXM`aXAPD 8D0A(B BBBF ($WEM F Mb MAA(P,WEM F Mb MAA|`FIB B(A0A8I 8D0A(B BBBF [TDCiE\PTD FBE E(D0D8DH 8D0A(B BBBE K^AHqDHGBIH :BBE E(D0H8FPq 8D0A(B BBBB h MFBB D(A0FppxWYxEpmxI\xAp 0D(A BBBE Ix^RxDpX FEB E(A0D8F 8D0A(B BBBF RInAޑ  \;FBB B(A0A8H Q GХ:إ[KإAХaإIaإAХإeإBХq 8D0A(B BBBE IإqMإHХإM\إDХ"إYMإBХإQ\إAХإRYإBХ8إmxإAХDإZFإAХإKGHPХإELإAХإN\إAХRإYMإAХAإJLإAХإKGHPХ`إHXإBХإLWإHХ/إNVإAХإU`إBХ 0Х0,('DAAG0~ AAG ('FFC BEB( (aCN(e0MCA(L(uAA SAFx(~g(6((،/EAG   AAE (e=  `(ĎFEA A(D0 (D ABBH b (G DBBG  (D ABBG 4L)FAD F DBI w DBC 4)XFGG H DBF k DBG )lvd),FBB B(A0A8G@OHMP\HA@D 8D0A(B BBBA  HGPeHA@<*`P*ܖ0d*ؖDp D BR TAF I BN 8*4$FBK D(D@v (D ABBF (*(ADJ AAA D+FPM D(D0 (M FGDI H8i@`8C0DH+DFBB H(A08C@]8A0I(D DIN(+EJN`g DAG +BFHE B(H0I8G@ 8D0A(B BBBF | MO _M\AnMYAi MT f MJ @L,pFMG y GIM c CBH { CBH H,KFEB B(A0D8G` 8D0A(B BBBK ,KFNB I(D0I8G" 8C0A(B BBBG DJBBNZ^SBFZMA_WAgHGBIZ^WAoFNAWKMDPT PJ -{8 -8FIE B(A0D8J DZARIBb 8D0A(B BBBE _MYD: DH p.̫"HV@.cFBB A(A0DN 0A(A BBBJ .".,!.H$X/dFEA D(D0h (G DBBE } (D ABBJ e(D ABBd/EP/EP(/ FFL x DBA ,/AH WP A $/TBBB B(A0A8DZ 8D0A(B BBBK ?UFFUPFFMFJFU TB WOWAaRLBb TE tK]BGHABIHFSE SJ A SJ A SJ p IHFE 8 1̶FBD  BBK n DBD 8\10LEDDP AAC wXH`JhBpIP81DFAA } ABH { ABB 1(qFBH B(A0A8Gp|xINPNp` 8D0A(B BBBG kxXMHGBQpyxHfxAprxIfxApwxKexBptx2FBB B(D0A8D`hgp]hA`DhBpPxGI`O 8F0A(B BBBB hdpQhA`2Y3 `d3,FBB A(D0d (A EBBC ]8h@V8A0T8N@LHMPI0D(A BBB8x3TFDL H ABG H NBH ,3PK` nCMGHeH3xFEE A(E0^ (D BBBB u(D BBB@04EDQ Y AAK ^ FAK ^ FAK lt4xFJA C(G0V (A ABBI D8`@8A0B8B@h8D0N8`@u8A0F(A ABB4 FEE E(A0A8GDJ[AaSqEU]kCh 8D0A(B BBBI OhH[SH]PcDfSgEUOhD[TTBIIT ^v D5d]AA  AEI S(I0c(A D ABI 06#0 D6o\\6pFEB B(G0D8J 8A0A(B BBBG N\C6/ @6EDQ Y AAK ^ FAK C FAF L 7<FHB D(D0 (A EHBC e(D BBBp7] FBB B(A0A8G L()(E(o(A(m 8D0A(B BBBG (E(r(A(M(g(x(B(O(p((B(](j((B(V(g((A(R(K(Y(A(d(M(M(M(}(HP8LFBE A(A08D@F8A0A (D BBBE (8ERC JA[ H Q8QJe A Vp8wFBB E(A0D8D@u 8A0A(B BBBI EHFPlHH@F 8C0A(B BBBA 4\9EAG b AAG c CAA d9HERD  DAA W(g0L(G f GAA h GAH H(g0u(D P(g0[(A H9/FBB B(A0A8G` 8D0A(B BBBA XH:gFBB D(A0m (A BBBE {8L@^8C0t (C BBBC (:Hg A ]R YCv G :FBB B(A0A8G L@I@D 8D0A(B BBBE C@GA^@B@[@HAY@A@|@MAPAPAI@t@MAU@A@R@FAKAFAN@@;EG W AD P(M0T8T@K X(M0T8P@I 4;EFG w AAE D FAE |;PBGJ G(D0A8GxB!vvA`edCr 8D0A(B BBBE d|<FBE B(A0K8G`hmpvhD`X 8D0A(B BBBF hypWhG`<) `\=HFGB B(A0D8J 8D0A(B BBBH \P NApd=yFAG DBN cGHFW| GHFH zNOFKn OBE D= FDD O ABH y(N0O8F@K FABT >| qFNQ RU  AABH mROA`POAxx> FBI B(H0D8DPXP`OXAPaXR`OXAPL 8C0A(B BBBH D8F0A(B BBBd> FBB A(A0G 0A(A BBBC TROAqNKA(\?de G PM T(T0K?FFB B(A0A8G% 8A0A(B BBBH TOAdTPBhRPByTOA@$FLB E(I0C8QlGQBTOA 8A0A(B BBBC TOAwNOFK}NOFM(@\EDJ DAA 8@0NAD u AAF d FAA NL(AFGA D(N0 (F ABBG k (C ABBE 4xAFMD l AEG AFB4AVFDG0\ DBE [ DBG pAFBB E(D0D8G`hbp_hH`P 8I0G(B BBBL [ 8C0A(B BBBA (\BEAJ DAA <BFKG B ABC i CBB DCB(B |EAD k AAA (BX FAD T DBK CL!FDK A(I0z (D ABBF W8M@PHTPK0r (D ABBJ S8M@THTPK0G (A ABBH e(D ABBhC`"1LNT L(G0G8G@Q V BBF { LNK }(T0O(A ` LPO ALNpD4$FAA { ABJ [(T0O(B A ABD T(O0Y(A A ABG L(F0`(A AAB,D$LDA Q HBD (D%E{ P PF `AKdD&{FPR G0\8G@GHGPR0k  AABG 58L@V8A0\8T@P8B0I8M@X8A0hPE,( FBB I(A0A8Dp 8D0A(B BBBA xK_xBpfxHJBIpE "pE,AFBA A(Dpg (A ABBE xROxApuxKO[PpxPOxAp_xPWxBpQxP]xBpdFx0HZ F F0TuFt1TuF1\u0Ft2EDG v FAC ]DA4F3FAD g UBG IDBH4Gx3FBB H(A0D8JP 8D0A(B BBBG xG4(FNB J(I0H8J` 8D0A(B BBBK DhJpGxBI`OhfpMhB`hJpGxBI`<G7FSA A(G (D ABBF dBEA D(G0 (A ABBH 8I@^8A0I (A ABBE h (C ABBH ܃p0(?AADM AAK H$@4BEE E(D0C8GPk 8A0A(E BBBI p P\A FBB B(A0A8JAHHgJ 8D0A(B BBBE PVEGHASJ[HBADQI\AV BHFOpKHAI [HBADQzPEPKFAH ЅIBBB G(A0H8JLGFIv 8D0A(B BBBD KeDbMDT tLSBEL H(A0A8QK\Is 8D0A(B BBBK  JOAK+TPAqTOBbMQBlNHAK OE d<RbBMH H(Og (D ABBB rQHHKNHAK`TBBB E(D0D8GR 8D0A(B BBBG /GHAO4XBBE L(D0A8JsDOOAFDDRqKKDIULKDITDDFFFSMaAFLNDIANdAT 8D0A(B BBBH tODDIXT\FEE E(G0D8GPXM`MhDpIPW 8D0A(B BBBA ld]0FBB D(D0z (A BBBE D8M@OHGPI0^ (A BBBC D (C BBBC 8ԉ^BGD } FBF b CBA pL_BEB B(D0D8J>THWXxJ\A 8D0A(B BBBG bF BBE J(A0D8GsLcA 8D0A(B BBBJ KABNPUATN]BFP\AP\AN\AHIBXsHIBXPJFV NM dBBB B(A0A8G L" "I"G"A"N"k 8D0A(B BBBC ["T"O"A""["M"G"[""c"K"A""J"H"A"K"|"M"n"B"BEB B(D0D8JxCGI|GEDI_\PB` 8D0A(B BBBH DKGFINNKPsIXJNheMALx BBE E(D0A8D 8D0A(B BBBG ȍ-FBB E(D0D8DpUxKBBIpC 8A0A(B BBBK MxHBGSpWxTBGSp<l@FJE A(A0e (D BBBJ  FBB E(A0A8G 8D0A(B BBBG zLGFNJEBNgeMAD8FBD D(D` (D ABBC rhRpZhA`|pFBE E(D0D8Dp 8A0A(B BBBH W 8A0A(B BBBO  8C0A(B BBBD (|Epe FAA F dD,?FSF H(G@yHXPhHD@c (A ABBD tة FEB E(D0G8Dv\XA 8D0A(B BBBJ YKBoFAcGBrVGBmNGB((H(ED0t AB  YG tt}FBA B(G0o(D N BBI j(M0Y(D q DBE D(M0Y(E N BBO (M0Y(D , FBB B(A0A8GhCfEIIMDInKKDIeDDFFFX[PAKKDI]IcA3 8D0A(B BBBG 2[QAVMdA[QA[PAMcB FBB D(D0GQDDIZDDFFFMY 0D(A BBBE DODDIrHDDIl0FMB B(A0A8DPXK`hXAPP 8A0A(B BBBA a 8O0A(B BBBE ,^FBB B(A0A8G L"M"v"D"A"n""D"M"I""M"X"A"j 8D0A(B BBBJ D"Y"b"E"L"M"Y"B"ԔX T PL2Dm4(teFBA E(D0G(F ABB`EP|BBE B(A0D8JlMHIN 8D0A(B BBBE R[An RN  RR !HU!HU48H$BHG D(GpT (D ABBG @ FHI D(D0Ip 0D(A BBBF DܖFAA g ABF e ABH k ABJ l$hFEB D(A0 (A EBBA b (D BBBD b (D BBBD e(D BBB 0XFII H(D0R8u@e8C0N8b@R8H08J@8D0b8h@T8D0]8U@F8D0b8h@g8C0S (D IDNF d@FHB B(H0G8I 8D0A(B BBBB  8D0A(B BBBE D7FAK  ABH h ABE - ABH |FBB B(D0D8J 8D0A(B BBBF LHJKNJGBN^OuAf MO  rFBB B(A0A8Dpj 8D0A(B BBBG x[WxBp xOVxAp^x[[xBpdxTOxBpYx_CFKpH<FID D(D0i (G DBBE }(D ABB" '<$0ĚXBKA G  AABA XBBA A(D0v (G CBBJ e (D ABBJ D(G DBB`TFBB B(A0A8J 8D0A(B BBBE &GHDK ̛ FBB B(G0D8G 8D0A(B BBBH  8G0A(B BBBI rAMRHIAHNTNKGoN[A\OA( FFB H(A0A8GK]FROKAMHIAHAIAF[ 8D0A(B BBBJ TOKAFHIAHAMFF`FQASFaAR KJ  PT l PT [\PB̝FBB B(A0A8Gh 8D0A(B BBBF IKQHHAKADSNbAM LI `d(FBB E(A0A8G` 8D0A(B BBBC hJpHxEABI`HȞ FEJ B(A0D8GRUB 8D0A(B BBBG vOWGPZRdAaQRDDDNScALQPDDDNLS\A NaBK BN g SL D SL Y SL M nE P\RA}SWH% 4"SHU K jT8#FBB B(A0A8GPXB`OXAPl 8D0A(B BBBI TXT`ZXBP XO ZXC`iXBP XI _ XH`Y DXJ`eXAP`XH`&\X'.FBB B(H0A8DP 8D0A(B BBBK LXT``XAP[XT`d((FBE A(D0Fp 0D(A BBBD X 0D(A BBBM xAMRAINpex`OxApX+(FIB B(A0A8DRcCX 8A0A(B BBBJ HDx-FED H(I0z (A ABBH q(C ABBH-4BIB B(A0A8G 8D0A(B BBBB dܢ.BEB H(A0D8Gq 8A0A(B BBBH  8J0H(G IBBE D0D EL`1FBH B(A0D8G 8A0A(B BBBD @2FLB A(A0G 0A(A BBBA L3FEE D(I0_ (A ]BBB  (A BBBG 8D5TFFD A(G` (A ABBH X<6FBB B(A0A8D`r 8A0A(B BBBB ^hRpJxGR`dܤ7ZFHE B(A0A8J 8D0A(B BBBE N 8A0A(B BBBH LD8FBB B(A0A8D 8A0A(B BBBA D:mFSI B(H0A8 0A(B BBBA `ܥ0>l$NFHB B(A0D8GdOAw 8A0A(B BBBF G[AhPtUFDD J ABE  ABI k ABB m ABH 4VFBD k BBE RGBTXWFLB A(A0GvcRD| 0D(A BBBE @lXTFIA JrcIAe  DBBJ 0YEKG y AAF eFApHZFEE B(H0A8GZDiAJY_D 8A0A(B BBBA Xt`cFBB B(D0D8G 8A0A(B BBBH Y\ADTL^DEPHWA)PtBPeGSdPAO[VGZeF|[xA H lq q qRHy P rSEMPrSEMrSEMrSEM sSEM0<`shD B `` OCA A sptHH4tFBD k BBE RGBFFB B(D0D8DpxWKBSpo 8A0A(B BBBE \ xNN xO[xFp@ xOM HCBBB B(D0A8GP 8D0A(B BBBH DJFHA D(G|_Hh (D ABBB 8`,KFDD  ABG  FBA L<FBB B(D0D8D 8A0A(B BBBG LHJIIDAJNNOGSM\A<hp\TFHB A(D0GSMQAX 0D(A BBBG dMHHAHU 8A0A(B BBBE D 8I0H(G IBBO p$!FFB E(D0D8F 8A0A(B BBBF BFDGFD&JFBB B(A0A8G L!I"J!I!A!S"G!B!s!R"O!A!G 8A0A(B BBBH W!T"O!A!|(T(FBB B(A0A8G I k Q c B ` Q H D z 8A0A(B BBBH W T O A d)FBB B(A0A8G I!!N![!B!A 8A0A(B BBBD G!J!\!A!_!K!_!D!K!K!^!C!W!`!I!D!a!P!O!A!@\+FFB H(A0D` 0A(A BBBA ,PFBB B(A0A8G L$$K$Y$E$[$z$r$B$X 8D0A(B BBBA I$K$D$A$a$J $L$D$A$K v$S$`$A$` $S$G$A$E A$I$T$A$I$N$P$N$N$A$A$I$|0FBB B(A0A8G L##D#d#B##O#d#A#z#M#_#E#e 8A0A(B BBBB D#M#m#A#^#G#L#G#F#A#I#[#N#M#K#K#G #M#R dx3RHy P43eFBA H(D0D(F ABB43eFBA H(D0D(F ABBH,4BIB B(A0D8D 8D0A(B BBBK <5P5d5x5H5SBLB B(A0A8DP 8D0A(B BBBA 6I!FBB E(D0D8G 8D0A(B BBBJ GUAGTA6WNAAMNEIMVAXN_AbYJGIELBKIBOEQB;GTAGTAFILBGUAIPGiNLBMSBOK\A|ESAM LJ JKA(xVvETJ IAR A u(VHWK LFI K z(0W{DQJ NFI D z0W BAD G0p  DABK 0L`XQDJ J(H0^(A DAA4XWFED g BBF MGB4XWFED g BBF MGB4YWFED g BBF MGB4(DYWFED g BBF MGB`lYtxY<YGF K \ L OI IAD A m D N J @[]JAG f AAF  DAA ZF   \BBB B(A0D8D@} 8F0A(B BBBC ` 8F0A(B BBBA k 8C0A(B BBBI | 8C0A(B BBBH H8F0A(B BBB4]BBB E(D0A8JUiGHEEEEM 8D0A(B BBBE TVHLFBjLQBQJBMHLEI@ I <l|FEE A(D0D (D BBBE lK^B TM ]TBMSHPZE$p(AG I n AH (t"FFE E(A0D8G, 8D0A(B BBBE `qBBIAOWAaPOA )0 FBB B(A0A8G L"( 8A0A(B BBBE "S"["B""F"T"A""G"t"B"^"I"L"B"]"P"\"A"H"M"^"D"X) }FEE B(A0A8DP< 8A0A(B BBBB XI`KXAPP8* FNQ F(G0D@YHZPKHA@ 0D(A BBBA `*wBEE B(A0D8DP 8A0A(B BBBA D 8F0A(B BBBE l*  BIB B(A0D8D~FlARFdAx 8D0A(B BBBE `+ FBB B(A0A8G 8A0A(B BBBB MrB\HA<RRAD+8FAG`f ABI nhGpJxBI`ohkpFhA`,,? `TD, FED D(D0Y8\@F8A0D (A ABBC n(F ABB,!iFBB B(A0A8DPXXM`gXAPkXF`aXDPXF`JXBPP 8A0A(B BBBI k 8F0A(B BBBF DXF`eXAPtXF`dXAPXF`dXFP` XI`V DXF`cXBPd-%FBB B(A0A8D` 8A0A(B BBBG  8F0A(B BBBC L 8F0A(B BBBA PhKp]hC`-/> `D.*FED B(m0B8B@I A BBH p GBG lX.+FBB B(D0D8Fp-xMMEMp 8D0A(B BBBH  xPFxBpl.$/FFE E(A0D8DKKAd 8D0A(B BBBI >L^A8/3 FBB B(A0A8G L@LB1BRCQCICACICNBB\COBBB 8D0A(B BBBG BQC`BABrBbCQBABBRCOCMCCCICNBBCCJBABBCCJCPCQBABOCVBABBeCIBBBXD0=FFB A(A0DZGBI 0D(A BBBB $0 BfEAC MDKx0TBGFBE D(G0x (D BBBF u (D BBBA D8M@KHEPI0w (A BEBE l(D BBBTD1(CwBBB E(A0D8DP 8D0A(B BBBG hXM`\XAP1PD"FBB B(I0D8NUQBM]KAv 8D0A(B BBBJ  GSAyHBoMXAqIbB DH GhAEbB FO G FO 29O82eBBD A(J0b (A ABBA 2Df9ES H P3df4,3f@3f T3fcHZl3f 3fN4FBB B(D0A8Gh 8D0A(B BBBC !IHDK%ICEIKXGHRAOeBBSPOLHIAKHdBh4DH|4@FBI I(A0D8GP 8A0A(B BBBH 4K A 44FAG r DBJ f DBD L5 FBB B(A0A8G 8A0A(B BBBA (l5FED r SBJ H5DFEB B(A0A8Dp 8D0A(B BBBH ,5KTGGIW A 06mECP A DAB DGAH6Ԧ`\6 FBL B(A0A8GN_C^ 8A0A(B BBBH HGHFHtGHFH|MMDJ\6tFDD I  AABE xJ`CRVNOFJ,X7Ԫ@dG  BA @ EK 7eE@ K Q70lP7>NDB B(A0A8D8A0A(B BBBA48xBEA A(D0(A ABB|L8BBE B(D0D8GJ 8D0A(B BBBG YM_DpSKDYNSA<8@oDEE A(D0 (A BBBC  9l30,9PK A H9K A @d9x)FBA A(G L@LD (A ABBA H9dBAA G I \  DABI x N O F G `9BBB B(A0A8G I Z N N C S Z 8A0A(B BBBF 4X:mBAD n ABH iAB@:BAG w DBI G(\0U(A G ABE <:h6BBB A(D0T (D BBBG 8;hBFD B ABG Z AEH @P; !BBA A(G L"e (D ABBI ;AI Fq G ,;TAC M G `;DBBB B(A0D8D@ 8A0A(B BBBA  8A0A(B BBBA dL<hBFD (Q0i(A D ABH | (Q0K  (Q0Q K (Q0T s (Q0N K (Q0R 4<ADG y FAD g CAA <@Ev E  =L =ljFEH A(D0[ (D BBBC l (D BBBA Hp=|0gaBB A(A08F@a8A0w (K BBBA =@FG EA =<BBB A(A0G I l 0D(A BBBA Y M ] F  G H F H a G H F ` 8h>EAG R AAA p(N0O8F@M >4Hk$>0EW A q A K>j>T FBI E(A0A8Gu 8D0A(B BBBG v\TAmPLAXHB[nTMBJGHFTtPLBSJHDMp?@HFH F(F0\D F IH F(I0D8C@ZD C AM I(D0D8D@DHCPZD H AM H(A08@d>FIB B(H0A8DL_GXj 8A0A(B BBBF \GJEPN_ETMBnTMANOFNWTRAENOFN$AKR S zT LAP@A,4FBE K(A0G@f 0D(A BBBG _HNPOXF`H@@AFAA DP|  AABD   LFNF \AECI K(K0_(C D AAA J(F0Q(A F AAF D (N0N D(N0\8BSFNA H0Q8T@L8F0X  AABH c8G@Q8C0a 8O@J U 8G@B HBEGL M(K0_(A I AAE c(O0H(A FAA`BFBB B(D0A8D`OhKpghA`D 8D0A(B BBBH d hKpN dHCaFBE A(D0J 0A(A BBBA HMdChOyACFBB B(A0A8G L@LDb 8D0A(B BBBD DTDLDADDNDODFDHDHDTDLDAD\@DOFBA D(J (A ABBE \OyAMdCD&FBE B(A0A8N LEHDGGGGGGGGALGBBIABAGHGApMTTYDIEFDLBIDK$TSF  8D0A(B BBBJ DIEFGLBIDKKMaBBAFFAGHAA[\FMQAHQONAINBAEIiHKBABIkGKEABIACLFRKYwWRADLFTNVxRMBJCLFTNYLGHHHLGQFLILGACDTI LGACDB RKFALGBFA A(Gk (D ABBK HIAG4T_HG;BBB B(G0C8J` 8D0A(B BBBG (@H FFK  DBD lH[H_ I $HFBB B(D0D8FPiVE 8A0A(B BBBK |KBA}NdEERKRJGAlEBBBFDDDDDGBHFDFFCBV EQ BKYAySHBpI,YBBD A(Lp?xAFDHAGHIALpc (D ABBG xKbxAp$JnFBB B(A0A8H Q GMTTM6TLAnOQA 8D0A(B BBBE ~IGE`{ OK WMPTHbLMHIfPMBD0K|$$FAA G L!y!T!L!A!v  DABF 0xKd%FMD u DBF dDB@K&FJL D(D0G`g 0D(A BBBC XK&FFBB E(D0D8DPu 8D0A(B BBBC XJ`ZXAP|LL(BBB B(D0D8D@UHQPaHA@D 8D0A(B BBBC f HQPQ | HQPS T HQPS S HQPT @L,FEE D(I0Dp 0A(A BBBG 0Ml.FAA D`o  AABA 0DM.FIA G`e  AABH 8xMt/FJD G(L0\(A D ABE 0M/FKD D  AABK M0ESPi DK NP1ESPj DJ 0N1ESPW DE HTNH2FBB B(A0A8D@ 8D0A(B BBBH HN3FBA I(G0i (D ABBE a(D ABB4N`4FBA D(D0q(D ABBL$O4FMD  DBG q DBI l DBF s DBG 0tO86gEHG c AAG aDAOt6O6O6 O6BBB B(D0A8DpxKGxAplx]LHUp^xOKFEAJpc 8A0A(B BBBJ HlP:BEB J(D0D8G` 8D0A(B BBBE `Pt<BBE B(D0D8G`z 8D0A(B BBBG hKp\hA`_hRpUhA`Q=0Q=HDQ=BEB E(I0C8FP 8D0A(B BBBJ lQ?OBII E(D0A8FPZXF`JXFPsXI`NhGpAxBIPL 8D0A(B BBBF `R|@ BEE B(I0D8D@ 8A0A(B BBBF A 8C0A(B BBBA @dR(AAAJS DAD gNOFKRA(RAZBDD HEBLR$BFEA D(D0o (G ABBI w (F ABBF 8SBxEB I gxXSDCFBB B(A0D8JI]A^ 8D0A(B BBBC s IT tK\A<SxEOBB D(D0t(A BBBJΌTEFFB B(A0A8G 8D0A(B BBBA HOAkIJFPNBHNA\TM+FDE I(D0A8G 8D0A(B BBBB nDKBTUOFIE B(D0A8F`jhFpJhF`j 8D0A(B BBBH h\UQFIE E(K0A8FP\XM`PhFpOPx 8D0A(B BBBB IXM`PhMpOP4USFAH ^ ABH fAB`V|S{BBB B(A0D8G@WHNP]HA@L 8D0A(B BBBH yHIP^HG@LdVT)FJE D(A0b (D BBBJ f (D BBBH VxUUasVUHVVFBE B(D0H8H@ 8D0A(B BBBA (0W,XEDD0x DAE L\WXFJA D(G0 (A ABBH i (D ABBA LWPYFAD g ABK | ABA H(o0P(D A ABA WZSFEE D(H0 (L BBBA } (C BBBJ e (A BBBD  (C BBBF \8Q@`8H0g8Q@`8F0Y8H@i8D0[ 8H@B LX\FBE B(D0A8J 8D0A(B BBBE X _$FEB B(D0A8G 8D0A(B BBBF G 8G0A(B BBBE cNZBEFAiL_B~NNKFM\AlYe)FBB E(D0A8LZ 8A0A(B BBBD NLQA@HNAZ@j!FBB E(A0A8I 8A0A(B BBBD hHQA_PZAROBiIbEL`NJHkv EE  EE dZoFBA A(G{ (A ABBF lGHFPd GHFE PD[q FAA Q ABD P(T0L(D A ABA a(T0L(A L[r%FBB B(A0A8G 8D0A(B BBBE [ \dwP`\w.FBJ A(D0 (F BBBD q (C BBBF S (F BBBA H\lxFBE E(A0A8DP 8D0A(B BBBF p\@yFEE A(H0 (D BBBD R (A BBBG j (A BBBG f (D BBBA X@]zFBE B(D0A8D 8A0A(B BBBG zH^C8]~LFCD t ABD  ADJ H]$FBE E(A0A8Dn 8D0A(B BBBE d$^xFIB B(A0A8Dpc 8A0A(B BBBJ  8D0A(B BBBE ^k\^xFBE E(D0D8D@y 8A0A(B BBBG T8A0A(B BBBt_FMG B(A0H8OPXJ`YXAPlXM`VXAPI 8M0F(G DBBF XJ`QhHpRPH|_FEI E(A0D8GP 8D0A(B BBBD _D0BBE B(A0A8J{ 8D0A(B BBBA H[Ix HJ FdA MM WbGAeQfB NR E NR `8E`tdoH` BBB B(A0A8D8A0A(B BBBL aBBB B(A0A8D\ 8A0A(B BBBD `\a`BEB B(D0A8D`e 8A0A(B BBBE '8A0A(B BBBasa(aa0{4bcFAD B CBA CJBtHb[BB D(A0A (A DBEG ^ (A BBBC D (A DBEH \(A EBEG,bLBAD K ABK bG A H cpBBB B(D0A8D` 8D0A(B BBBG ,Xc$BAD Q ABE HcFBB B(A0A8D 8D0A(B BBBB Tc8BBB B(D0D8G`hIp^hC`X 8A0A(B BBBE ,dEJ AA HPd\8FBB E(D0A8Gp 8A0A(B BBBD dPK A ddp8dFED D(GP (A ABBJ 4eEED0\ AAD `8I@S8A08TexFAI  ABA L(I0U(A (e cFAD MDBePET G (eHFHA qEB`fFBE E(A0A8G@d 8F0A(B BBBB P8C0A(B BBB\lfFME D(D0 (A BBBE 8L@UHFPM0A (A BBBA lf0/FEJ E(K0A8JK\A^ 8D0A(B BBBD QaBLFHE E(D0D8GOFFRV 8A0A(B BBBE {LFFN\FDDBJW FDAF H}|FJB B(A0A8L@U 8D0A(B BBBA \}FBB B(G0D8GP}XM`QhOpIPFXO`PXBPBXB`bXBP^XD`GXAPYXI`]XAP 8F0A(B BBBH AXM`QhLpIPFXO`TXAPBXB`eXBPbXD`GXBPXXN`SXAPJXN`\XBPXXG`]XAPUXL`TXAPOXK`[XAP(X~]EAG0L AAE d~FBB E(A0A8L`hJp_hA`] 8D0A(B BBBD [h^pOhA`x~FBE E(A0A8G@F 8D0A(B BBBB HNPYHB@7HQPYHA@HGPkHA@]HOP@hFAA JTcGx  DABA T@FBB A(D0GSiAx 0D(A BBBA D*FBI E(A0C8GSRLEBBBEEEEEEBBEEBBBBEBBEEEEBBELoSRLEEEEEEBEEEEEEEBBEEBBBBEBBEEELQULEIsMULEEEEBEEBBEEEEEEEBBEEBBBBEBBEEELiSRLEEEBBBEEBBBEEBEEEEEEBBEEBBBBEBBEEELfSRLEEEEEBBBBEEEEEEEBBEEBBBBEBBEEEEBBELG 8D0A(B BBBE  POII]SZHMULEEEBIXSRLI4SRLEEBEEBBEEBBEEEEBBBBEEEEEEEBBEEBBBBEBBEEELMULEBBEEEEBBBEEEEEEBBEEBBBBEBBEEEL\IbBfMULEEEBBEEEEEBEEEEEEEBBEEBBBBEBBEEEL=UIBEEEEILRBULEEEILbA) OH KGaAl KJ  OH U BL B\ITHTALL@BOD D  DBBG IDDGGGN FIB H(D0D8DpxZsxSpxVQIIp 8D0A(B BBBF xNmxApxKBGIp,l pLp1FBB D(D0o (D BBBE f (A DIBJ V8S@H8C0b (A EBBH [ (D BBBC p (D BBBF DFBB B(D0A8DP8A0A(B BBBD,pFEE B(D0H8I@h8A0A(B BBB4tFDD h ABG YCB0PFBB B(A0A8G L* 8A0A(B BBBH (*R*M*D*Q**N*^*A**[*M*K*\**R*M*D*L*TFBB B(G0A8Dp!xMYxGpUxMVxBpDxDJJABIpp 8D0A(B BBBK xM[xAptxNZxApd xMJ DxNFGB B(A0A8J 8A0A(B BBBG JXAkLkBUI[BPUH5QsAX.FLO H(JDsH (A ABBK dFbC`x/FBA A(DpcxBMPHCNpd (D ABBJ JxTaxAp4h1FJ[GGUb EA @1FFB D(D0O 0A(A BBBG 3n\P4FBE A(A0d (A BBBF _ (C BBBH Z(A BBB\4Hl D t D @|p5FAG M DBG b DBH QDB6FFBB B(A0A8G L@LFFBFTFAFFGFHFAFXFcFTFMFAFJ 8D0A(B BBBD JFbFOFBF| FGFHFAFO 0p9 FBA L@j  DBBI H:FEB B(D0A8G@ 8D0A(B BBBH |<;FIB B(A0A8D`hNpchA` 8D0A(B BBBE hMp\hB`hKpWhA`A hKpI p2 `,? FEB B(A0A8GJOeB KtHH]AO]B[ 8D0A(B BBBA MZAM]HHcphJXFDB E(D0D8Dp 8A0A(B BBBE QxIhxAp 8A0A(B BBBI L܏MrFBB B(A0D8G 8D0A(B BBBG h,0PFIB B(H0D8DPXK`MhNpMPB 8C0A(B BBBA BXM`YXAP8SFEA I(D0 (D ABBA ԐxT <@UFAG w DBE H IBM eDBH<UFBB B(A0D8G` 8D0A(B BBBJ 4VFBB B(A0D8G`hYpFhB`D 8D0A(B BBBH [hWpUhB` hMpP DhFpMxTN`khFplhA` hWpS  hMpJ l(dZFBB B(D0A8GPXM`jXAP 8C0A(B BBBD T 8F0A(B BBBE T\FBE B(A0A8DhLbBTbEIIX 8D0A(B BBBA  hTTJSBkJWB{I\AhrB NH sQPUv~BikMGlNUAYWAI YB ~jeC]yzM XLo&FGE B(D0D8GM^Aj 8A0A(B BBBH l qFBB B(A0A8G L* *F*L*B**L*N*A*u 8A0A(B BBBE f*P*`*B**[*U*A**P*Z*A*s*d*K*A*2 *T*J 8**pXFSB B(A0A8D`ohEpJxBGEEDBEQ`a 8D0A(B BBBB H̕`FBB E(D0D8G 8D0A(B BBBG FJE B(A0A8D` 8D0A(B BBBH ehJpJxJGKQ`hSpLxBBBI`hMpahA`dFBB B(A0A8G L@I@ 8D0A(B BBBF P@MATAIAS@[@MATAHAE@P @MATABAB @FAHAHAS@m@RAHADAM@`@TAHADAI@q @HAHAHAE c@FAHAAAS@t@GATAAAS@[ @GATAHAE J @KAPAHAE a @FAKAFAE Z @HAHAHAE [@FAHAHA P~FBB B(A0A8DpxHBFBBAHBEVp 8D0A(B BBBA xHBBBBABBEVpL(VBNP G(OJHFKZ (D ABBD 88 FIA D(G (A ABBK @@ HFBB A(A0D@ 0A(A BBBG  FII B(D0D8LoXHhCOUFMHNAIABAIS 8D0A(B BBBG lM`Al,FBI B(A0D8Jd 8D0A(B BBBE VFiHSHFAFEB D(C08G@HHBPBXB`AhBpBxBI0 (A BBBC w (C BBBH u (C BBBJ b (C BBBA 4ȠFIB D(D0w8N@JHBPBXB`AhBpBxBI0` (D BBBH M8N@JHBPBXB`AhBpBxBI00 (D BBBK r (D BBBD ܛ 04 FDD N CBG LvZ4FEB E(D0C8KJTAPTrCh 8D0A(B BBBD nBVASB[AdIGEs[@EUcBI@0FMQ A(A0G 0A(A BBBH @YEs H Xt`ܩNFBB E(A0C8T  8D0A(B BBBG MTTJmMTTK@؝GFBB B(D0A8GaLHAHAKAMDNAHAIAKkWWLFDBIx 8A0A(B BBBF waAHAMDHAIAK[[LcArVHHAIAK\]REBW_ EDBB (& FEE B(A0A8DJhFIHTEAbNOJSj 8A0A(B BBBD RM_BM^CD 8A0A(B BBBF ` 8F0A(B BBBA OTALWEl OE MoBhMgA(HĸFAQ0N DBD th\FBB E(D0D8GPhXM`gXFPXM`XXBPy 8D0A(B BBBC eXO`QXGPmXL`WXAPnXK`\XFPLXM`YXDPD4NDH z ABI K LLE ~ CBE 8P FEA D(G0p (D ABBH FFH B(A0I8GJSALHFKn 8A0A(B BBBF xMRRI8xFBA A(J (A ABBA HP,LFBE B(A0C8D`! 8D0A(B BBBK H0FBB B(D0A8Dpw 8D0A(B BBBG @FBB D(A0G 0D(A BBBG H,FED G(G0k (C ABBH D(F ABBxdFBB B(A0A8H Q GDzAX 8D0A(B BBBC dHTAKGANGHAUgTNBM[BTMALl#FAD G0E8O@QHIPN0d  AABJ j8O@P8F0tFBB B(A0A8GZ 8C0A(B BBBE LZAZ 8A0A(B BBBF 84XFFE E(D0D8J 8D0A(B BBBF IuBMPJUTOIGNfOCAFGNWOIGNvKJINMTAMKANHIS~ JJ fL`AKJCN<pFCG X DBB M(t0H(A GABH<+FBB E(A0A8DP 8A0A(B BBBG L FBB B(A0A8D 8A0A(B BBBJ (LELF z AAE lxtFEE A(A0 (D BBBD x8e@M8D0A (A BBBB b (D BBBD EPP{ AG ( EnF PFF K gP8FAD I`  AABH TOCbTQ\pFMA A(H`khPpOxON`shAp\hA`\ (A ABBI Ih`pJ`(FAL  DBA m FBB B(A0A8G L@LCCYCECICXCZ 8D0A(B BBBE ZCNCLCECSCCICiCACdCSCBCEC^Cm CgCCCWCE jC[CXCBCHFBA A(G I n (A ABBB D K ` d0<FBB B(A0A8G L@LC 8A0A(B BBBA WCTCOCACDFFFA A(D` (A ABBB chOpWhA`FFBJ B(A0D8GeP]D]PWBMZAyPTA7 8D0A(B BBBG tH O H Fd FPG J(A0A8DPO 8A0A(B BBBA g 8A0A(B BBBA H FJB A(A0 (D BBBE A(A BBBH E G Lh HR F PFFB B(A0A8GX 8D0A(B BBBB dHJBIHJBIJEBNL[HHMBI|8FBE B(D0D8DpxQRHSp 8D0A(B BBBE rxH^xApvxHHBIp, FBB B(A0A8GK 8D0A(B BBBC uH^AXEKBIgKB<ʾ X\ PFBB A(A08J@Y8F0A (A BBBF | (C BBBK p!FBB B(D0D8DHLBI 8D0A(B BBBK  MdAt,$pFEB I(D0E8G@ 8C0A(B BBBB | 8F0A(B BBBA D8F0A(B BBB0%xFFD k DBG iDBد%Rd@&TFEE J(A0A8D@ 8D0A(B BBBF }HQPHXM`H@rHTPLHD@8T8(A]A TFG H G[ K(E0LA(BEB E(A0D8Jr 8D0A(B BBBD HHHGKK[pGGGGKHGKKBNZAp<+BBB B(D0D8G 8D0A(B BBBH BHDDHiHIH- BBF B(A0A8Dp 8D0A(B BBBA P/z*BBB E(D0D8GQWDBEVY 8D0A(B BBBF GAHZoHDCQVNDBEQXVDD_IEWD1cCGTXtFBB B(A0A8G L"o 8D0A(B BBBC !"T"L"B""T"M"A"G"Q"H"M"H"T"T"N"B"P"F"["B"c"T"L"A"p^(FBE B(A0F8DcHJJH 8D0A(B BBBJ JHJGIX,P`FHE E(D0A8GPt 8D0A(B BBBK XJ`vXAPbDFPE E(D0F8DPA 8A0A(B BBBG NXO`[XBPW 8A0A(B BBBE d 8C0A(B BBBH kXI`aXAPNXO`ZXAPQ XI`N 48dxFH B gTdyHD D htdxFBB B(A0D8JMOALON^A 8D0A(B BBBE MMOALhgZFBA A(FP (D ABBH tXN``XAPXM`]XEPnXO`KXDPwXO`IXBPhi FIB B(A0A8FfFAL8 8D0A(B BBBK JdAHPQI\FFS L ,u, FBB B(H0H8Iy 8A0A(B BBBA uAFV{MRMYLeGKIiFUA cJKIdFE xGApU]H4xEDO e FAD s CAA H,FBE D(C0b (C BBBA H(C BBBTxDFEG A(G0N8I@RHKPI0D (D ABBD i8L@b8A0HиFEJ E(E0L8P 8D0A(B BBBJ XFED A(DprxL\xDpT (A ABBD X (D ABBO xtOjG A(H0KH~FBB E(D0A8D@ 8D0A(B BBBK H$FAF Ln  DABB NOFK4hFBE B(D0A8J 8D0A(B BBBE NTANOJNOZAddhFBB B(A0D8DPT 8A0A(B BBBE E 8C0A(B BBBG 0 lFAA Ipf  AABE DT FBE B(D0A8D`8A0A(B BBBHБSFJE B(D0D8GP 8A0A(B BBBA 8FAA ] HIJ G ABF $X6 FBB B(A0A8D 8D0A(B BBBC  RJ  PCH! RI RXB KV e RI MYAؼ8#ĜFBB B(A0A8DYNHB 8D0A(B BBBK PWEKRTAz RG )N\C RG LOIB MM L\_AԽ_,(EGD AAA  FOI E(D0A8MVOHDVzMDDhMNZD 8D0A(B BBBA {MPTQRGHFMIcBXPVArIHFHWMbARIA`, >FBA A(DpD (A ABBH rxGODAHNpcxT^xAp(}Ep K K` OAAP(пlu FBB B(A0A8G8C_LALQE 8A0A(B BBBA KYA8I0H(G IGBpdXFBB A(A0g (D BBBC S (D BBBC p (D BBBF Y (D BBBE `FEE B(D0A8H@v 8A0A(B BBBA { 8E0H(G IGBF H<`!FEE E(A0G8G@g 8A0A(B BBBA tD"FAA  ABA v ABF H ABA o ABA  ABA o ABD HUX FJD D(D0} (A ABBA i (C ABBG l(C ABBX\ FJD D(D0{ (A ABBC i (C ABBG l(C ABBXd FJD D(D0z (A ABBD i (C ABBG l(C ABBX FJD D(D0{ (A ABBC i (C ABBG l(C ABBHpFHA D(G0s (F ABBH i(C ABBP OEE D(C0O (F BBBE Q(C BBBA8lFDD O ABH f CBA LL`FAA G L!j  AABG !G!H!F!I!UFBB B(A0A8G L@LBs 8A0A(B BBBF BLC[BABBNC[BDBcBMCZBABBNCVBBBABNCOCFCHBX\FDA G0g8P@`8A0}8I@PHJPP0^  AABD 8G@[8A0MFBB B(A0A8G L!| 8A0A(B BBBI !G"H"F"P!d!O"R!C!J !G"H"F"E `DFBB B(A0D8Ip 8A0A(B BBBN 8M0F(G IBBT\SQA k,ED z AD [(N0Z(A @DFBD z EBK W(I0R8O@R ABBH<FHE B(A0A8Dp 8A0A(B BBBI ץpH4FEB E(D0A8D`J 8D0A(B BBBF <JrK J(F0Pk F PF lDB H @4HFAA M(J0u(A G CBG CBx HUFKB B(A0D8G 8A0A(B BBBG (tFKD x HIJ ( PrE_ L I G S ] A8FBB B(A0A8DMbB 8D0A(B BBBH pP_BNhAKaAcFBB E(D0D8JLQFjLHM[CIAIAHABS 8D0A(B BBBI D`|EAG`} AAD qhApMxQN`z DAE @4NFAA D`|  AABD   MFLE @FHI D(A0GpxMbxApxMbxAp{xNaxBpxxMaxDpDxN\xApxMbxEpxMbxEpN 0M(F DBBH <FGB B(A0A8J@FGEN{ 8D0A(B BBBK SRDIBKYNBKYIHAXBdSQBMVBLrTADBKYNGKEQ rE OdA^ SE  SJ XN[Ag SB lSWA1 NL  NL Z SE RIAP< hQg H g\pFBB B(A0A8G I! 8D0A(B BBBD S!T!O!B!M!T!Q!Y!T!O!A!Y!P!V!A!,FBG b BBK ,EC P  E L;: (lpFAD AB4FAA W ABF SAEd\FBA D(G0p8L@SHFPK0D (A ABBB x8N@[8A0D (A ABBD `8^FFB Q(E0 (A BBBA { (C BBBL a (H DGPE  ~eM Xp!FGB E(A0A8DP 8D0A(B BBBA IXa`IXBPeXc`HXGPNXf`HXDPDP8d8$FJPRXS`DhEpBxBIPf EJ $/FBB B(A0C8G 8D0A(B BBBE PNEFbSZA~ PJ v NEFJ Y PJ f SE <L+~FIR(B0A8B@I H DBC wDBL+<FBB D(A0 (D BBBF Y (A BBBH 0,IFLA G  AABF -MFBB B(A0A8G I!I 8A0A(B BBBG ![!M!A!!L!O!B!I!H!Z!A!44\EI B v Z \L WAI G 5FBB B(A0A8G I  8D0A(B BBBF  o!L B B B!i B  V!O B k C!G B  T!O A b  B!A!B!H M h!R A E A!B!B!V  o!M K B D![ A |=^ FBB B(A0A8G L""|"h"B"&"P"F"F"["B"M"["B""K"W"A"z"M"R"A"["M"U"B"u"E"P"A"w 8A0A(B BBBJ b"L"Y"B"u"M"U"A"LGFBJ I(D`x (D BBBO o (A BBBA HHFED D(D0[ (J DDBJ D(M OBBH\IFED D(D0K (J DDBJ D(M OBBXdIFIB E(A0A8G` 8D0A(B BBBD hNpahA`8KFEE A(I0n (D BBBF @LL1FEE E(A0D8LpxL`xApgxFJHNDDCQprxKUGMpj 8D0A(B BBBG DxKRGMpkxN[xAp<N FAG I i DBJ \ T O A H,OFBB B(A0A8Dp 8A0A(B BBBC $xPEG I Z AH TPFAA G I!  AABJ D!M!e!A!`!T!O!A!tR"FBB B(A0A8G L@L`I` 8D0A(B BBBK `HaY`A` `HaJ HplVFBE E(A0A8D@l 8A0A(B BBBB (VQoT OAA K `dWFBB B(A0A8G I ] 8D0A(B BBBH  T!E!B!A!D!C!F!K  T!E!B!A!D!C!F!K t T!O A a T!O A t T!O B c T!P B hZZFBB B(A0A8G L@IA\ 8A0A(B BBBH AOATAAA5 AOAI rANAOAFAKA L@^{EH0F AD 0p^FAA D`q  AABG `8_FBB B(A0A8N`{hKpQhA`\ 8A0A(B BBBF dhDp[hA`_H`)FBE E(G0D8Dp[ 8A0A(B BBBJ xhbFBB E(A0A8DHIBI; 8A0A(B BBBJ X 8L0F(G IBBJ `p%uF$cDxt uuMDP w u   H=  u H L$p N u uDwcDФvcD@v pcD(H 9v v 1vF0G"7v p>v"H$FHvUDev {tDHHn >CF@v"B$ȫv Fvv v Fv2Fv >C FvF w"%wF">w  Fw">wbD8!Q \ _$"Tw $F#^w u$F$pw F%w*D &w X'wD (wYD)w w F*w +w ˄F, xpD-%x0D(.8xKDx/Ox3D@0@x-D102DP2hx$`3xhD4xKDF5xID@6xUD7xUDP8D9xF8:x"@MD;yUD<yiD.y=iD>@UDh?IyD@jDAay r!qDDHvyByDCy r!D8Dy pDpEyD(FEyDGypjDHypD(IYDJy FHKzcDL#z ǥ!cDM6z RzeDNZz FOhz0pcDPP}zpDQzFRzFSzFTzFHUzFV{?FW{FFX2{FHYG{FxZ`{F[q{F\{FP]{@Fp^{F_{F`{Fa{Fpb{ ˄Fc|FdR Fe|D f%| 6|D gB|  D hS| 8 D` i Hji|bDkp| Hl @ pmw|" Fn| `o| p| Hq| xriw Lv s t| H u|"cDpv|"Fw|"F xw y|  zY H{| 0 || }} (~}d X!}? '} ,} Ծ! p2}6DF}  PM} FO WU F^}"@ Fo}"@ F} } }}} }uD}X} F}2D}*DF~*DF~ '~ 5~H~4D_~ @ (k~ {~ F~9D` `DD~KDH ~ ~WD~!~F% &cD-&F lpD]X)(,YDP,vF-]DFDFD.|D.}D/|D 0 u F1 2^DG3X mdD85 dD5Ѐ F6"7`D7%"9dD8<"9F09Q"BcDh9h"BD: lD; ՁlDP= lD*== VFn>"7lD?"9lDh@"9F@ ׂF@"9FPA"B FA$ 5DEBR {uDBc @uDFwVDXGrxD(HDJ FK3D8M9DOƃVDP݃YDQ  QYDpS@ 8T' T7 HUX"B UH"BaDXd"BYD^z cDa@bcDbsDxc ˄ e ʄYDeτ @Z9Di $Hp  i $9Dp8q%dKDxqCKD`stdYDt_YDv|dF8xF z"D>D`{Å>D~Ѕ?D~ۅ?D8cD lD`#"B|Dh"B|D؅ 3DX ID \D w  EDP @  ED Q@ "D F  FɆ Fӆ F L FQ H F  DH sDh  uDЕ  @  h (  ; u X 1 !lD E$D N'D U 0 elD ~ {DX  eD  eD ‡ eD8 ؇    0    ذ   P    % h Ȳ 6 ? @ G   P H  } a      8   { "   "   "X   ɈD  Ј ވDh  D  DX  %D 5 D` C ?D Q D` _ pD a Dx D D8 ‰ $ؾ щ WD މ $H  XYDx  Dx  $F  F K BIDU  e !  X"!n"B # x uD$ "BuDP% |D&] P Щ @ P Z P P 0 ` Ћ `   0 @ p 0 ` s%thin-pool@@s%thin PJ fKPJfK@  0 P 0 p p  0 P P p p  PJX`JLjdeJpJ^J@rgd@fK metadata2 policy_smqcache-smqpolicy_smqcache-smqpolicy_mqcache-mq}|sdPide@%Pmd.PloopJPramdiskVPdevice-mapper_PmdpmPdasdxgdac960~PnbdPidaPccissPubdgataraidPdrbdgrbdgemcpowerPpower2Pi2o_blockPiseries/vdPgnbdPaoeQxvdQvdiskhps3disk/QvirtblkKQmmcWQblkexthQfioQmtip32xxQvtmsQskdQscm8hbcacheQnvme@QzvolQVxDMPQunonepffudevfgǎӎ܎܎@ӎ  '  .@: @BL Th̏܏@@ @ @ @@ `!0P'0127 B@EOд0@MM00 P0@BAMл0&%p!N pS pS U U U pS U pS pS pS N pS Y 0Z Y V pS pS pS N U U x V pS U pS pS V Z V N l 0V X X `W pS pS @V Z PV m N `V W PX W pS pS pV V V V T X pS V pS pS V [ V `[ [ [ ] @Y pS pS pS pS \ pS `\ \ pS \ pS pS pS pS V ] W `] ] U pS pS pS pS pS pS pS pS pS pS pS pS pS pS pS pS K $0<DLYbq +8EO\ p p p @  ago today( yesterday4 SundayL SunL MondayX MonX Tuesdayd Tued Wednesdayp Wedp Thursday| Thu| Friday Fri Saturday Sat noon midnight second sec s minute min m hour$ hr$ h$ AM< PMH dayT week` monthl yearx yrx January Jan February Feb March Mar April Apr May June Jun July Jul August Aug September Sep October Oct November, Nov, December8 Dec8 uuuXuuWuuuuu; : uu==˄( 3(4 C3Ծ!x C)?C) O  O0  O  O0  O  O0  O  O0 yOY yOY0 O O0 O O0 VOG VOG0 JYOF JYOF0 bmOE bmOE0 !OD !OD0 O[ O[0 ~ OZ ~ OZ0 >6!EO >6!EO0 r6!yO r6!yO0 b6!iO b6!iO0 6!O 6!O0 sO sO0 aO aO 0 VO VO 0 ZO ZO 0 MSO MSO 0 CQO CQO0 !8 Ծ!x )?)FO FO0 O O0 ;O ;O0 EVO EVO0 0O 0O0 uO uO0  +> O~  +> O~0 UOv UOv0 EVOu EVOu0 COt COt0 ~ DpiEKDM Z 0Z P @ Q(  ! @Y М  Pz `|  Y | z p ` 0 8 @%- %%u%Ч%u%%u%p%u`%@%u0%%u%%u%%u%`%uP%0%u %%u%Х%u%%u%p%u`%@%u0%%u%%uФ%%u%%up%P%u@% %u%%u%%u%%u`%@%u %%u%%u%%up%P%u@% %u%%u%%u%%u`%@%u %%u%Р%u%%u%`%uP% %u%%uП%%u%`%uP% %u%%u%%u%`%u@% %u%%u%%u%%up%@%u0%%u%%u%%up%P%u@% %u%%u%%u%p%u`%@%u %%u%%u%%u%`%uP%0%u %%u%Й%u%%u%p%u`%@%u %%u%%u%%u%`%u@% %u%%u%OuЗ%Ou%%u%p%u`%@%u0%%u%%u&lv_uuidLV UUID lv_nameLV .lv_full_nameLV` P.lv_pathPath .lv_dm_pathDMPath@ .lv_parentParent . lv_layoutLayouth  lv_roleRolei  lv_initial_image_syncInitImgSyncG 8/ lv_image_syncedImgSynced`j x/ lv_mergingMerging0k / lv_convertingConvertingPH  lv_allocation_policyAllocPolc  lv_allocation_lockedAllocLockH / lv_fixed_minorFixMinpI 0 lv_skip_activationSkipAct@S 80 lv_autoactivationAutoActS `0lv_when_fullWhenFull 0 lv_activeActivel % lv_active_locallyActLocalm 0 lv_active_remotelyActRemoteg 0 lv_active_exclusivelyActExcl 1 tlv_majorMaj (1 xlv_minorMin `1@lv_read_aheadRahead, 1@lv_sizeLSize # =@lv_metadata_sizeMSize@ 1 seg_count#Seg01 ZoriginOrigin 2&origin_uuidOrigin UUID @2@origin_sizeOSize & 2 lv_ancestorsAncestors 2 lv_full_ancestorsFAncestors 3 lv_descendantsDescendants @3 lv_full_descendantsFDescendants  3 raid_mismatch_countMismatches` 3 raid_sync_actionSyncAction 4 raid_write_behindWBehind1 @4 raid_min_recovery_rateMinSync 2 4 raid_max_recovery_rateMaxSync2 4 raidintegritymodeIntegMode = t raidintegrityblocksizeIntegBlkSize@?  integritymismatchesIntegMismatches@ 5move_pvMove 85&move_pv_uuidMove UUID x5convert_lvConvert 5&convert_lv_uuidConvert UUID 6mirror_logLog @6&mirror_log_uuidLog UUID x6data_lvDatap 6&data_lv_uuidData UUID 7metadata_lvMeta P7&metadata_lv_uuidMeta UUID 7pool_lvPool 7&pool_lv_uuidPool UUIDp (8lv_tagsLV Tags0 lv_profileLProfile 8 lv_lockargsLLockArgs 8lv_timeCTimeA 8lv_time_removedRTimeB 9 lv_hostHostP (9lv_modulesModules P9 lv_historicalHistoricalpT  writecache_block_sizeWCacheBlkSize2  lv_kernel_majorKMaj 9 lv_kernel_minorKMinP 9@lv_kernel_read_aheadKRahead0- :lv_permissionsLPermsa  lv_suspendedSuspended@L  lv_live_tableLiveTable`M @: lv_inactive_tableInactiveTableN h: lv_device_openDevOpenO data_percentData%: :snap_percentSnap%0: :metadata_percentMeta%: ;copy_percentCpy%Syncp; p;sync_percentCpy%Syncp; p; cache_total_blocksCacheTotalBlocksr ' cache_used_blocksCacheUsedBlocks s ; cache_dirty_blocksCacheDirtyBlocks`s N cache_read_hitsCacheReadHitss b cache_read_missesCacheReadMissess s cache_write_hitsCacheWriteHits t  cache_write_missesCacheWriteMisses`t kernel_cache_settingsKCacheSettings` ;kernel_cache_policyKCachePolicyp  kernel_metadata_formatKMFmt <lv_health_statusHealth o  kernel_discardsKDiscards @< lv_check_neededCheckNeeded0R x< lv_merge_failedMergeFailedJ  lv_snapshot_invalidSnapInvalid K <vdo_operating_modeVDOOperatingMode@ <vdo_compression_stateVDOCompressionState = vdo_index_stateVDOIndexState3 @= vdo_used_sizeVDOUsedSize# x= vdo_saving_percentVDOSaving%4 = writecache_total_blocksWCacheTotalBlockst  writecache_free_blocksWCacheFreeBlockst  writecache_writeback_blocksWCacheWritebackBlocks u = writecache_errorWCacheErrors`u 0 lv_attrAttr =pv_fmtFmt` I&pv_uuidPV UUID@ @dev_sizeDevSize9 > pv_namePV [ pv_majorMaj a pv_minorMin v@ pv_mda_freePMdaFreeP( P>@ pv_mda_sizePMdaSize ) > pv_ext_vsnPExtVsn0 @@pe_start1st PE! >@@pv_sizePSize' @@pv_freePFree8 ?@@pv_usedUsed@' @?@pv_attrAttr =@ pv_allocatableAllocatable x?@ pv_exportedExported ?@ pv_missingMissing ?@ pv_pe_countPE`- ?@ pv_pe_alloc_countAlloc`- @@pv_tagsPV Tags0 @ pv_mda_count#PMda9 P@@ pv_mda_used_count#PMdaUse: @@@pv_ba_startBA Start! @@@pv_ba_sizeBA Size! A@ pv_in_usePInUse0 @ pv_duplicateDuplicateC 8A@pv_device_idDeviceID@^ @ pv_device_id_typeDeviceIDType@_ `Avg_fmtFmt` Ih&vg_uuidVG UUID` vg_nameVGP [vg_attrAttr0 = vg_permissionsVPerms@`  vg_extendableExtendable`D  vg_exportedExportedD  vg_autoactivationAutoActE A vg_partialPartialF 4 vg_allocation_policyAllocPol` J vg_clusteredClusteredG ` vg_sharedShared g x@vg_sizeVSizeP$ A@vg_freeVFree( Avg_sysidSYS ID B vg_systemidSystem ID Bvg_lock_typeLockType 8B vg_lock_argsVLockArgs `B@vg_extent_sizeExt+ B vg_extent_count#Ext`- ? vg_free_countFree`- B max_lvMaxLV`- B max_pvMaxPV`- C pv_count#PV`-  vg_missing_pv_count#PV Missing@0 XC lv_count#LV0  snap_count#SN`1  (vg_seqnoSeq`- Cvg_tagsVG Tags0 vg_profileVProfile` C vg_mda_count#VMda`/ C vg_mda_used_count#VMdaUse/ D@ vg_mda_freeVMdaFree* PD@ vg_mda_sizeVMdaSize) D vg_mda_copies#VMdaCps0 DsegtypeType`  stripes#Str- E data_stripes#DStr- (E@reshape_lenRSize4 XE reshape_len_leRSize5 E data_copies#Cpy.  data_offsetDOffP7 E new_data_offsetNOff@6 E parity_chunks#Par@. (F@8stripe_sizeStripe+ PF@region_sizeRegion+ F@chunk_sizeChunk`% F thin_count#Thins03 (GdiscardsDiscardsP hG cache_metadata_formatCMFmt G cache_modeCacheMode G zeroZeroP G transaction_idTransId H thin_idThId / pH@seg_startStart$ H seg_start_peStartp- H@seg_sizeSSize% (I@seg_size_peSSize/ PIseg_tagsSeg Tags0  seg_pe_rangesPE RangesP xI seg_le_rangesLE Ranges Iseg_metadata_le_rangesMetadata LE Ranges` @JdevicesDevicesP J metadata_devicesMetadata Devs Jseg_monitorMonitorP4 K cache_policyCachePolicyp @K cache_settingsCacheSettings pK vdo_compressionVDOCompressionU K vdo_deduplicationVDODeduplicationV K vdo_use_metadata_hintsVDOMetadataHintsW K vdo_minimum_io_sizeVDOMinimumIOSize\ L@vdo_block_map_cache_sizeVDOBlockMapCacheSizeZ HL vdo_block_map_era_lengthVDOBlockMapEraLengthu pL vdo_use_sparse_indexVDOSparseIndexX @vdo_index_memory_sizeVDOIndexMemorySizep[ L@ vdo_slab_sizeVDOSlabSize0\ L vdo_ack_threadsVDOAckThreads v L vdo_bio_threadsVDOBioThreadsv M vdo_bio_rotationVDOBioRotation w  vdo_cpu_threadsVDOCPUThreadsw 8M vdo_hash_zone_threadsVDOHashZoneThreads x pM vdo_logical_threadsVDOLogicalThreadsx M vdo_physical_threadsVDOPhysicalThreads y M vdo_max_discardVDOMaxDiscardy Mvdo_write_policyVDOWritePolicyd 0N@ vdo_header_sizeVDOHeaderSizep] XN pvseg_startStart`- N pvseg_sizeSSize`- "devtype_nameDevType N devtype_max_partitionsMaxParts N devtype_descriptionDescriptionP @ log_seq_numSeq`- \log_typeLogTypeP qlog_contextContextP {log_object_typeObjTypeP  log_object_nameObjNameP (log_object_idObjIDP 0log_object_groupObjGrpP 8log_object_group_idObjGrpIDP @log_messageMsgP  Hlog_errnoErrno  Llog_ret_codeRetCode ƒY , Y 0,0Y K,0Y PO,0Y @hx@Y |xPY `Y pY uuY uul!Y uu!0&F$8B upB u8B uB uu&uuBvB !t@N v`gt)v@P Av&` tKv@ ivHh sv8B (}vv PFvvgvv hvyt@j+(@0Lvv@ Ptw@PX&``w&L$w-w &`2w8h9wp*!@ICw0LwUw ow.!swzw"_"wwB@`#w@Bk$NB`%gsBp&wО&4'w(w @)w@$P*wp@i+&w, x&0/-x.x /&x0/x=xp91YxHT2ixqxl3xx{4x54x6xx7x&8xx& 9x:ARG_UNUSED---abort_ARG--abortPactivationmode_ARG--activationmodeaddtag_ARG--addtag adddev_ARG--adddev 8deldev_ARG--deldev`delnotfound_ARG--delnotfoundaddpvid_ARG--addpvid8delpvid_ARG--delpvidaligned_ARG --alignedalloc_ARG --alloc#atomic_ARG --atomic`atversion_ARG --atversionauto_ARG --autoautoactivation_ARG--autoactivation@setautoactivation_ARG--setautoactivation(binary_ARG--binarybootloaderareasize_ARG--bootloaderareasizecache_long_ARG--cachecachemetadataformat_ARG--cachemetadataformatHcachemode_ARG--cachemodecachepool_ARG--cachepool xcachevol_ARG--cachevol ycachedevice_ARG--cachedevice cachesize_ARG--cachesize6ycheck_ARG--checkHcommandprofile_ARG--commandprofilecompression_ARG--compression config_ARG--configconfigreport_ARG--configreport-Qyconfigtype_ARG--typeconfig.dataalignment_ARG--dataalignment dataalignmentoffset_ARG --dataalignmentoffsetPdeduplication_ARG!--deduplicationdeltag_ARG"--deltag detachprofile_ARG#--detachprofiledeviceidtype_ARG$--deviceidtypedevices_ARG%--devices devicesfile_ARG&--devicesfilediscards_ARG'--discardsdriverloaded_ARG(--driverloadedPdump_ARG)--dump0errorwhenfull_ARG*--errorwhenfullpforce_long_ARG+--force@foreign_ARG,--foreign(fs_ARG---fsfsmode_ARG.--fsmode8handlemissingpvs_ARG/--handlemissingpvsPheadings_ARG0--headings1ignoreadvanced_ARG1--ignoreadvancedhignorelocal_ARG2--ignorelocalignorelockingfailure_ARG3--ignorelockingfailurepignoremonitoring_ARG4--ignoremonitoringignoreskippedcluster_ARG5--ignoreskippedclusterjyignoreunsupported_ARG6--ignoreunsupportedPimportdevices_ARG7--importdevicesjournal_ARG8--journallabelsector_ARG9--labelsectorlistlvs_ARG:--listlvslistvg_ARG;--listvgcheckcomplete_ARG<--checkcomplete8lockopt_ARG=--lockoptPlockstart_ARG>--lockstartlockstop_ARG?--lockstop`locktype_ARG@--locktype$logonly_ARGA--logonlylonghelp_ARGB--longhelp{ymajoritypvs_ARGC--majoritypvs@maxrecoveryrate_ARGD--maxrecoveryratemerge_ARGE--mergemergemirrors_ARGF--mergemirrorsmergesnapshot_ARGG--mergesnapshot@mergethin_ARGH--mergethinmergedconfig_ARGI--mergedconfig0metadataignore_ARGJ--metadataignoremetadataprofile_ARGK--metadataprofilehmetadatasize_ARGL--metadatasizeminor_ARGM--minor@minrecoveryrate_ARGN--minrecoveryratemirrorlog_ARGO--mirrorlogmirrorsonly_ARGP--mirrorsonlymknodes_ARGQ--mknodesmonitor_ARGR--monitornameprefixes_ARGS--nameprefixes`noheadings_ARGT--noheadings(nohints_ARGU--nohintsnohistory_ARGV--nohistory`nolocking_ARGW--nolockingnorestorefile_ARGX--norestorefileHnosuffix_ARGY--nosuffixnosync_ARGZ--nosync8notifydbus_ARG[--notifydbusxnoudevsync_ARG\--noudevsync(originname_ARG]--originname (setphysicalvolumesize_ARG^--setphysicalvolumesizesettings_ARG_--settingsPpoll_ARG`--pollpolloperation_ARGa--polloperation)pooldatasize_ARGb--pooldatasizepooldatavdo_ARGc--pooldatavdopoolmetadata_ARGd--poolmetadata poolmetadatasize_ARGe--poolmetadatasize@poolmetadataspare_ARGf--poolmetadataspare(profile_ARGg--profilepvmetadatacopies_ARGh--pvmetadatacopies'(raidintegrity_ARGi--raidintegrityraidintegrityblocksize_ARGj--raidintegrityblocksizeraidintegritymode_ARGk--raidintegritymodeHreadonly_ARGl--readonlyHrefresh_ARGm--refreshremovemissing_ARGn--removemissingrebuild_ARGo--rebuild Hrepair_ARGp--repairrepairtype_ARGq--repairtype/h replace_ARGr--replace  reportformat_ARGs--reportformat, restorefile_ARGt--restorefilep restoremissing_ARGu--restoremissing resync_ARGv--resyncrootvg_ARGw--rootvg@rows_ARGx--rowsysegments_ARGy--segmentshseparator_ARGz--separatorXshared_ARG{--sharedsinceversion_ARG|--sinceversionsplitcache_ARG}--splitcachesplitmirrors_ARG~--splitmirrorssplitsnapshot_ARG--splitsnapshotshowdeprecated_ARG--showdeprecatedshowunsupported_ARG--showunsupported`startpoll_ARG--startpollstripes_long_ARG--stripesswapmetadata_ARG--swapmetadataXsyncaction_ARG--syncaction+sysinit_ARG--sysinitxsystemid_ARG--systemid!thinpool_ARG--thinpool ytrackchanges_ARG--trackchangesH$trustcache_ARG--trustcachejytype_ARG--type"P&udevoutput_ARG--udevoutput`)unbuffered_ARG--unbuffered)uncache_ARG--uncache)update_ARG--update*cachepolicy_ARG--cachepolicy*cachesettings_ARG--cachesettings+unconfigured_ARG--unconfigured,units_ARG--units!0-unquoted_ARG--unquotedh.usepolicies_ARG--usepolicies.validate_ARG--validate /valuesonly_ARG--valuesonly`0vdo_ARG--vdo0vdopool_ARG--vdopool 1vdosettings_ARG--vdosettingsp1version_ARG--versionyvgmetadatacopies_ARG--vgmetadatacopies&2vgonline_ARG--vgonline5withsummary_ARG--withsummary6withcomments_ARG--withcommentsP6withgeneralpreamble_ARG--withgeneralpreamble6withlocalpreamble_ARG--withlocalpreamble6withspaces_ARG--withspaces7withversions_ARG--withversions`7writebehind_ARG--writebehind8writemostly_ARG--writemostly*9corelog_ARG--corelogresizable_ARG--resizableallocation_ARG--allocationavailable_ARG--availableraidrebuild_ARG--raidrebuild raidsyncaction_ARG--raidsyncaction+raidwritemostly_ARG--raidwritemostly*raidminrecoveryrate_ARG--raidminrecoveryrateraidmaxrecoveryrate_ARG--raidmaxrecoveryrateraidwritebehind_ARG--raidwritebehindvirtualoriginsize_ARG--virtualoriginsizesplit_ARG--splitmetadatacopies_ARG--metadatacopies(activate_ARGa--activatex;all_ARGa--allDautobackup_ARGA--autobackupFactivevolumegroups_ARGA--activevolumegroups@Gallpvs_ARGA--allpvsGbackground_ARGb--backgroundHbasevgname_ARGn--basevgname(Iblockdevice_ARGb--blockdevicejychunksize_ARGc--chunksizeJclustered_ARGc--clusteredLcolon_ARGc--colon0Mcolumns_ARGC--columnsMcontiguous_ARGC--contiguousPNdebug_ARGd--debughOexported_ARGe--exportedOphysicalextent_ARGE--physicalextentfile_ARGf--file Pforce_ARGf--forceQfull_ARGf--fullhelp_ARGh--helpycache_ARGH--cacheQhistory_ARGH--historyRhelp2_ARG?--import_ARGi--import0Sinterval_ARGi--intervalSiop_version_ARGi--iop_versionstripes_ARGi--stripesSstripesize_ARGI--stripesizeVlogicalvolume_ARGl--logicalvolume0Wmaxlogicalvolumes_ARGl--maxlogicalvolumes0Wextents_ARGl--extentshWlist_ARGl--listx_lvmpartition_ARGl--lvmpartitionysize_ARGL--size`persistent_ARGM--persistent8cmajor_ARGj--majorpcsetactivationskip_ARGk--setactivationskipcignoreactivationskip_ARGK--ignoreactivationskip@emaps_ARGm--mapsemirrors_ARGm--mirrorsfmetadatatype_ARGM--metadatatype mname_ARGn--namemnofsck_ARGn--nofscknnovolumegroup_ARGn--novolumegroupooldpath_ARGn--oldpathoptions_ARGo--options0osort_ARGO--sortrmaxphysicalvolumes_ARGp--maxphysicalvolumesspermission_ARGp--permission`tpartial_ARGP--partialtphysicalvolume_ARGP--physicalvolumequiet_ARGq--quietureadahead_ARGr--readahead%vresizefs_ARGr--resizefsvreset_ARGR--resetregionsize_ARGR--regionsizewphysicalextentsize_ARGs--physicalextentsize@xsnapshot_ARGs--snapshot{short_ARGs--short(stdin_ARGs--stdinselect_ARGS--selecttest_ARGt--testЄthin_ARGT--thinupdatemetadata_ARG--updatemetadatauuid_ARGu--uuiduuidstr_ARGu--uuiduuidlist_ARGU--uuidlistverbose_ARGv--verbosepvolumegroup_ARGV--volumegroupvirtualsize_ARGV--virtualsizewipesignatures_ARGW--wipesignaturesxallocatable_ARGx--allocatableresizeable_ARGx--resizeableؑyes_ARGy--yes8zero_ARGZ--zeroARG_COUNT---none_VALNonezconststr_VALConstStringzconstnum_VALConstNumberzbool_VAL Boolznumber_VAL Numbersnumber_VALSNumberzpnumber_VAL0PNumber"zuint32_VALpUint32%zstring_VAL@gStringvg_VAL @gVGlv_VAL @gLVpv_VAL @gPVtag_VAL Tagselect_VAL Selectactivationmode_VAL@gActivationMode,zactivation_VALActiveFzcachemetadataformat_VALCacheMetadataFormatMzcachemode_VALCacheModexdiscards_VALDiscardsVzmirrorlog_VALMirrorLogqzsizekb_VAL@SizeKBzssizekb_VALSSizeKB{zsizemb_VALSizeMBzssizemb_VAL SSizeMBzpsizemb_VAL@PSizeMBznsizemb_VALNSizeMBzregionsizemb_VALRegionSizezextents_VALExtentszsextents_VAL`SExtentszpextents_VALpPExtentsznextents_VALNExtentszpermission_VALpPermissionzmetadatatype_VAL MetadataTypeWUunits_VAL!@gUnitssegtype_VAL"SegTypeЖalloc_VAL#`Alloc0locktype_VAL$LockTypezreadahead_VAL%Readahead{vgmetadatacopies_VAL&MetadataCopiesVG!{pvmetadatacopies_VAL'pMetadataCopiesPV{metadatacopies_VAL(unused?Kpolloperation_VAL)pPollOphwritemostly_VAL*PgWriteMostlyPV6{syncaction_VAL+SyncActionA{reportformat_VAL, ReportFmtN{configreport_VAL-ConfigReportb{configtype_VAL.@ConfigTyperepairtype_VAL/0RepairTypedumptype_VAL0DumpTypeheadings_VAL1PHeadingsTypey{VAL_COUNT2l`0P0P00l`l$p l$ helpHelp ?HelpsdPide@%Pmd.PloopJPramdiskVPdevice-mapper_PmdpmPdasdxgdac960~PnbdPidaPccissPubdgataraidPdrbdgrbdgemcpowerPpower2Pi2o_blockPiseries/vdPgnbdPaoeQxvdQvdiskhps3disk/QvirtblkKQmmcWQblkexthQfioQmtip32xxQvtmsQskdQscm8hbcacheQnvme@QzvolQVxDMPQuPpP" @ PKg#t M PL MD EI @D0E 0E0N{yzpp0``(@$@'&"o#o!p,0n-0n )0%0  @ @pJl@LlPq*@l+plo3.40/0npmdH\I`gZ`gJ`g[`gK`gV`g\`g( ; ? uu> > !> @ @ @ 3"@ t3@ )! D@ kuV@ gua@ Oj@  |@ > HQ @ @P^ @ ^ @ `^ @ _ m @_ @ p_  _ @ _ l` @ 8` / h` & selectedSelectedu helpHelp ?Help! < Q a o {    p o%%o8 @&PM`,  oH*ooo*ooP(o &0p@pPp`pppppppppppqq q0q@qPq`qpqqqqqqqqqrr r0r@rPr`rprrrrrrrrrss s0s@sPs`spssssssssstt t0t@tPt`tptttttttttuu u0u@uPu`upuuuuuuuuuvv v0v@vPv`vpvvvvvvvvvww w0w@wPw`wpwwwwwwwwwxx x0x@xPx`xpxxxxxxxxxyy y0y@yPy`ypyyyyyyyyyzz z0z@zPz`zpzzzzzzzzz{{ {0{@{P{`{p{{{{{{{{{|| |0|@|P|`|p|||||||||}} }0}@}P}`}p}}}}}}}}}~~ ~0~@~P~`~p~~~~/sys/u@&@&P&P&`&`& &&0 LVM-/dev/mappernone SIGINTSIGTERM & &0&0&&uu(&(&H&H&X&X&h&h&&&u&&&&&&и&и&&&u r&`& &&&0&0&u&&&&&&м&м&&&u@&@&Ev Kv uOv Xv I\v fv ʏjv tv xv v v v !v  v v v v v 'w v v Dv v 'v v Qv v $rv w o!v v k Ov Xv I\v fv ʏjv tv xv v v v !v w  v w v w w >&w %w :&uuh&h&&&&&&&liblvm2cmd.so.2.03-2.03.24-2.el9.x86_64.debugnG7zXZִF!t/ֿm]?Eh=ڊ2NM}sD3< ],LtL%3G㬧[z,MD4_X3z #C)G2hɫք_TQX\ C6=-ΤA޵ R*G jߙbOu.JY}ۋ4 .R_z׆d]݃#|x8HDbj4BR#OTA[F\?G/o2n)F8=gC/:^N pgvJkh̶g]Llk6Yrx-G֡aEP;cEWbf~u\}wq5k .omUo&Xӝ0O┊L*V g zdFIkVTi5̿ W4fL rSXϰ|]S^4 M5Y=MLҎ 4бV.ACikMW|l >\9ؿ$u VhT-tk[Aq"&R+fYVEHC/:2($eTz闟jTDPTwJX6P0T fC/ %N~)@&p ;gFh3gjDP+pA$Z"/w0NԈ,Kޮѐ u#s#E{OEwUD`fb[g+Cf}+ g:njhX":sdF1gcH'>G8+:Wc"̂٢ **g0x [̐<1[Ȣ;5qINhAhU^Ȏ rN#YLZ|ϋDAjXILkdUs 9ɨo2BK ];i)Ը9Dx+ $Z'n&RLatY]SOwqW8jZ C5~_j?p&YcAi뒈iKn1I|o+2Q*d٠{X:G[-5d+(Tj)-[_fvq{`gU'D\q>ذNM~S)$&)Gf7Lrhu9.U1 (eQD{)܊LLآU1Zj@Sphȇ0X: p>عdX"HՈBhiH*f RA%˺KˉJ}AVOwz4HqhHqZiõ)4_l#?/윫20. 'ޢ!++w"\-;ZnMol1x8A}~:&cbaB H~k:gXX> dV7 ּ*ȱڊ')P =QnA-ZW_I i0ޡw jyB C^F1pRk V\CnD*cHK@|?i[򶺳O痓Mф,̾6t0ߩi9ZVuA16zTwAB_x&/eE?Bz4;Nf{XYU_ouӐ:ӝ`'K&涊氅eL| C>XQ{+G?]DhQnL N"ДfEV~,FZ>|K9%0)lak0;?쒚0ړ U/ nU 9]V "+z{6qI+#V9ޱa?Y$)'e|I@ey?W hpMt1X7+3d1dcWⷐ[3RT}rR\MG0’1k`77_jv̊A5ڛ\Ҟc~xiTr5[N#SJ=Y+԰ي 'FlR0!7V0XbVע˜!BOuR/Ol|uM?+rj:2n@+<)( Oə'WtQa6&"<w&/m$rT2v^*V4? -+D$F lHb=r#fPt%aes߈^=^@]Pp gO|P-* 6N#%鬸P~0:[c̡݁H;%,H0u bEWOlxYYvbo3;}MmqR}^%7߂pC*<5-r%!g_l9r;~oQXzI `j 2r6zǧBV 3#*Ix"S(Vn> Kt?]Va|Q48;G$us`S!~C$V lH^{H1S )IsEL[#}k][NKD c|t>8Ԅ6Uuk!e^X;T!L ,UkZ;K.2eaKnæ %Gzhᐉhc*זQvVWjrx8dtZ9Cmg=fz0 깋62KaykzNrTR)1%h$*gb0TIb=v) 4*rh4%d6* e56 פ7ALKE I{F9u?F0! ttCh|e)*!1Mc90#2Ӡ/O[{a:u$QZֳhe= l G;9 ǚvI܅zLWu=<f ǯRZt-/)|iXozGxTץ,r9oOԖO1w/Q _.49qtJiUĽd0{> رy{Udӛ G* "w S?3kYXyߩnQ(][hA_EөN%g?:TG'[}ar`Oym=&WbopE՘QXRJSm4AV X(mʩ ȃԯiUgC?,pl$(, V%1y[)%;4&}X&u m艊cŢgeN )o M^-z8$JH'9WiQ](F 딌nI|gE}9xʿˣS]:I_)HF7pU)ZìA™ˌ '0O~b},Oe%;N嗖G&'puc*2CX#Sq{sƄ8 uphRjGaO\xD: r 8&#JxJpEZQؗ̕z&YqlYE?f"Q_ٗY׷ӓ& il {j$5$((Y7ёdsK 8'VԫnDKPe" WqXʫay=̽#tIj\U$QMX`M5*lTo uq:Fh7[ 5ill^JL` zlh0+873V(j~!tDwE`wY!>`t;_*L\08F~1Vcr*u1;.5x-%47it7\&L殫VGu`CĈi ?]fp?(U5nEŤw.ܰU+ilP5!os+i.[KoކaALH3& '淩u7ʹ| ʧ.OvdPŝ_~)8/Koa|m8HVo?)8W=AȐBY=]FU`KJyKp;GQi_?e۵Ql!eqv;ϕfQy97 ,Ms!ѿ{[ .m_?q$ֆq2,/fL͉׺=f|޾o1`q< Pˤnj ]֖ĩ\+d-\thJPK D#mf:DkJ wjSB@7Lj#+W/Q6OT>)r=1|npk{Z_wcdu,aҐ^I "eGɐ_zXң BF`bWv&twvy0T0=;+aޯgNjE~wm6%~;pqz( 2#]p :F9Mc!-73/Cpr&/Lt8D'Ƥ.xkcif'chx3-3/'7#BuhX2Ȉɜ^ÆeA5)pzLUfqJ}&k8ǔ$(HߝԬ^Ij@ X>ԾĄɱweRzd(Z`;-j V+.xbcgtkH~Hŏ1^d`$ZJUK~rԶWlOJ２tkI1,[ E-ڼMlW$gLw3(W8e冰A La{ڰ/kf- / cxǬFTaxػrCIuwneϢE r@!|Շ%(퇖ե2IbZ0ы%ZtAR4tSTȌvPz?6䈐F+S=lZ<:_-%OKM<wKN: uڃ}4ޖM?(Cz_ \u֋'K11P8UG_ 4KZ,K_fsn2GUp~jU ĕ-s/g!&-lG38bܢIcDAF7c.̀Tu#'3զbQ@ [)q)7zAe}ICANJfV?b$1I7LPHa؈\.ʲF5.e:³~˟8d=դe v B؀N(?T U3Q$$ݘy*\+@͔JhLow>ڻs'صw槇m)U_y+ |WK.iR+(" WYžp{/̄rf1 ˰X)@ $uy*SPHC |!>.f,>Lv%8 !xGmiEC=9#A]#r$u/roc)>n{׽t }]gpYY]J] h M_ Ԙfl0>4{[ ћ a3ROB"SQ"mn1rQrUbYzlmOsmBsHw# Qs⟩hllrY.o#;W_$)k=~n0PQmBk$ClEx Ph…YLTtg&$ x22 pf"Ԉ>1!=ܬl`QݫgUtqWlNѹ&"/ )EP@o.5MTo\l1bmH6g k&߇Ez!j!@zb\\YǾma/RMQɜō^ڂ/?-.V-})R JP[ji/mkbE[6et{loz. y(KNa@k+_v6!>p1d!!-VnUo8B1R/wsk01!ok(cx#H|{ݎfEG!s/Z9D?HRXQZ-_NY'G u> ȏQɥ0F,%UIߢ JgƆ##2Z'0KON"*fJ mlXi j(t*3A@Uxjcn;e(% 2Btk=b yA B_Y4[0^AOb;g1;ڿua=S}yk֑eoЖQ]TH^QXt@)"jP`{R!y FSc }TE,Js,a]NǜO:yF g:׈36L!-ƿVQFrF{a>{A4#?&_ `Y`SSkޯ>w =ЕEw\z ڗbW6AҪ+$|2<碛1¹?Xg?FV]u1LJ0\mN[{)n+ Ovydwu7e<1q2*J48r^f>KuMnש(x{@qp54HZWǶ.l{I6˔ؐCton j |<0R;)ԤSkr,FwO4huOvޤuӻ$ Vk{*%Wʌ{0בgk'[c{'0T-5lI?`HDYEժQ:@m%Ap3 Z떝ɒ ,}2pk/&"ٸ<(?}: (eB9?t[CJwQ1Y5yU U{l/s1(!@,qBp`KmN8IA-v]"Mo6rB}*\5Jd xNna7!cl_WIa|/E$x67#qsҺy-5$rƜ_iYD-r8Oo+n%T_Y LsS$e4&~kQ™Dcָ\W8k  ԓ먁P hQX2-{H<>&D(r:Ūz6,&z7m7mol TpN\a3pKB ,\&+D8?@9'hj1BUP̂ӎkMf&2O醔\*tT>6ACjޙk̢E9uTm0A>BgMv 20lnLshM26H_I*rF#Ę*]τT3  w* $uՓVv=r@!䷉&m8#4CǯV\*?8tLhC&+c` MGjynO^ȉۡQ"|ųͶ?kx"I Ъd#U`ԹB鞪DCm7VHF9n2!uP;pW~ɕʙEb ەR7Z2K3)t]oV7 ˨{vmS `p}f{Q'iNޡoi]o'\h͸'+TQr,H-:-!F[8f'1@u bQ;o w렔vz?x!+d]AhՖJT I1Qԙ؏WI-",,9?Ѳ0SoaF-W<d?OaoæqUCB}uWT}RIɓT *}gR9hFA)ւ(kVM+ fIOtK٥3ibڢʍ/?᫋M"]n,pOKD`_.dwW4:s).(ʯt8ܣ}|/56/m:XN/gvb?8XpL\pqh8UHĎt3.Nu[.mt1gG]_sS:9K]x,uq=Ts$ G2A(&7N__CZH,0jS'JgX2db[O缤dN.AwV; _i$X^:kiKvdo2`a*&cN1n=+BD:RPq|T]1"Q J=L1"EjjwsEض7P({!`"4Ñr旼EGWmNR;YeS6WՉ<8;!5&j9TJ54Εhz,qip9hWC=> ʷ_ޡ7eA_L-g=ψjz o4s(+5/u972,<ĞRfdR!1rԆLE+rùAV|֗,)3GJp&+$0Ǟڛz5ǹiaRq%" NF?Ӓu{Ķ̀)כ9 DR1$؍@mȴx:k(Pz+u|X o<, 4tu=MR)a<'"r 4"U#lHI]81{2ub~9 pw^{ciEb0WuL|!Tګ!V}oガH ml0 >9 2j=t$ 2x,4* ^7US a>+#|r8^`Ix Q !br_*Yd3 _ˁQNuܒ9`|K՚]\.]SBBr #L;(w1vnU\[NJ#~gnxgU;Y^΋veN_dW W ay$wVoY sZ:$4޴mh Ȭ]d<Ox Zdm"feo!)VH:Q@9?<e>"Y@ mk;XDhaDBI=2wbɸ~ћ,?o(K<⩴]1PiL mV0/S+ce_1'5e?:TCTtC /ʪ.ɨX[!1EM 8Ǩ,ׁIM?*Z"w4z-&MoGgiOZZ;x *ƕlS99*4Iw ì$ JL&bJxJL;-~~Ws'ܭh9h/v0HaMǪ^=gdl$.#ؠ紩6Y.a+JTؓYgWtzl;>]>ye/@F)Jw,=t%;  q7ljQNņSXPkt%CMiMq:f,Km@~^US70#rn*"?#uB4bꖷ(F(SBK}ZP%v7YRY3CB^0nd` MǺ=֭/Ja{N"A5a @CPևrķUĒdg+O5'n22mPG"ņ;0׳.ƷHƇ/umr]k -=ElLcŶs rτÙu$aᔡ'kڛN!1KHZ1 ʭ{56Ae";=lOP 7o CRċu^u&Q-xaK ! <ǸDMT""_b*ד@33pcZp-2 \bo 81RrMe~KS#M`ϝ' Uzԧ j "R r`eȕ!JW{iYKJY/L ȸpg9n:Y:.Y)O_ILPio\@&@Q!I8pȞQhc>nC4H2K_z+SmEȧǿwF:25oԅUDغ RhKW/+#7ͱ0x=+'ߘ tF&4%S Zu樻֦[ـz/@JDT6k|o_duWCl g'B~%H2`ǫ*ѫ#I5۠LE"|u\y5}[%B.l&Vbm ۦC3!kr\A]ӲHNoam@} j͸{fVyH0fV2#hV*XGRIz zl^-OPgJ,g H25R.̫ !@v)r<QкrFxkM1M+ }Hh,EBȲIVa9%=A |P;$IXno[vk8z\2p65>+#ǎ̵\mfb mgRp>H㮻 #0d׽H1RmΤTSpN҇tאm(NGNR:/,OzBWXh܉1u-^W*젢_~8yd1{9'/WM-HҦ"H*+3eAL?< 9 i2$ŧPJ936 i UR.EpFݲX| Eu0B,ʼnLqx$3$;b# / ߌy^J @7oìKxY|ӌ?]H"c<;#vг*rJQvC|{0 NF5f ATw%Vj5P5橩\#e!:,"lg{|t'F-)~. s| ,>0#7gcj:\#\C$%BR8G ]uBjC-el.P *r4sSW {Ku߻ĺ6򮄍RU9LǪ7:^`@ ng ˘9^i=4  0 .IaM?J]\4 cCPA]^" /5:08}FD89OM?ՏWЋZQaSc}Q: SWC8ޣ9D|\lJy~9xUp9X1kh=FOPAs~N 'k!ׇZ<9I,j4Y.׈12#>Uw4vb䏡]<NWEr'r'hhѴKG' WD6L K[``<Q79]fg(ދ}p*N>Vn@41Ds_E}BCn@s@>LR(> spJS0AJa hT]M߳ʸNs5fecc4R W s}p:v{9 ~c {PChE-,_GRĴ;u{OD*|6H;IVйJ.?{ReX5tۖО^wXcqJ{FP&wKo-̞Ja] E,A%1J}o2XAH9 (?/i֍He}^* ?놷ܯRڮmc@,X'=}alף%vg~PXbӶMQp7ɩk(سDBW-&y@23Aifg6hZbX{,b"n] N0=z/46UFˏ%tqx|8ilT !M@:lu[#ծVԽ5ɾpțp0eV VxҲ_4e94ieS$>Ο=Q5wrU1*#"M)Z-ze#M+0^uP.=gg_(m{]0K&?@9|OuǓ,o!m8 a7t$!ĮA~?hu^{RB`ʕYI4j#8| Eڄ}6R&] *$6kHβS_q<< eŸQgraɧoI{J/hXV`73%Q0[LZe+K@Ǒm)yS JjxB|ح#{Q!kO]85|n|RE˴ Fzq,4T 1VvC'+Dӂ [!# xB61aiu0OnM`҃pKzu6L~8s̯ h(cGat4pCT)Q)y'%bԺ\6l{M8A/_5(#j,> HjdLmqΛ?&m8d m^޷j?E)D$z}*Lv/AEqLB&Mu\8-[ `]Uܲrޞ(\c.ñ4Ό= ^6Xa˝¢Ph`H->)FYzĹeVHW5c JNq'[gízz87..}Π׭=6M )KMhN?f}$؊| ޲_ Xsd_Sw<ٙI50w<{M! ΃-w&Po}3zds\r8)J*1#(rK-Z C=,BMv$.j;p9:aeX P6iڛ<ҝ ĕhv/iz-UnMA )vZFWx ws^۾ #nel3¾> {pD  K´S1CQG$qKt͡/˭~gCm;} 2:@lexZX[ lR{v-GeՇ ;Qa םpHD^_W-kEѱ70DG;洳D0 @51? 4_L:&8: $ZwE[0Xv'\Q3/y& 6^b #qoAެr{v1M%ɨWUi YhW+]Wdmǘ*}FHq۾+ fk_f!; 40CHiɩǡ:,V0- 7_5eG OV ԺbIq=",u$Rz[ _4iBFnYk=zЏ?~.jxX R:SԤƭe%is]•jd|?twڷ\ a1 7xFr&!я)2SypAĪS,Nz61t{|9ki %2\ȭ-/7zq -lQ%;Ǣ*H#4 B ‚qMkqŬH k"44qon&AH,x:#yp gGjjOϣe;Fq]Z`|"]P^JDxF p`=a8kXXY]4M+*kj qů̽|234 b4pP,cE20dd`$=:bԉ bՔFOw`@|h:`__o} c:u<l'J\,m{^cp>?E:ǒ0SX+s $xr]Ӧ4RoBf irH((z0U ~$-i$ 5-VHF]Zs95>,@2Ucc&ҹ*ov[/k|Xʤ> ; x)|xϒn]E=}L$q*C Wh r%rp,l^E~t"6!%Kh. u㕀+*05z\ J͍~wO2цulmlLn,ݞXJ±"!_nK'ʉU %Ȱ((FB _^n.mToFz,=ISt$s~#U $MUbD+pN9cæÿٸJɳ4̔u?-"Bd605<4żqqPE4+8 u>{<`힁1R6ݠ5 I]_" ~]]Ci4<*Q&8Š}-}mg}y>u*f"k&V 9= yvӕc^$|/yZ56 Ѱqb"j{[˼{U-ޘ P@.T "h?@Vm b?ngNT*^#ۀxD:'J5ve&at. bn4j,7¬KڱW}C܈> *QÚغ548!q81y1 k1J@8y*ߪ"̝i raտsV` ]b*YeVڤ*%c*)6{B@sbFJycuW'~aW[:쌻Q+ s"U,jZ5AG<$Hn^T^~%5EtY+-qƠ8. Jt?ag@ؕP,mOml3а.#?,5v:8HI < ;3tVv6@NE*IcM!/.G"¯kG&#n':GRȥ>c'ۑn$f_)m v"`JX4WI :;z^.ٻ[=k%TL WJ* $z薥(h P;WѬcu`4LZQ 6y0q]272eYߟ| NA鿁e8]:|aEF]}Q쮪^,-I睚1 Gu)G[+JX/|?F"/$Xwn_q# P7`YVcڤj{oW&G ?uFV& rNU-@Tԯ }^U8HO2<EzDtaCِ-(G^q},=wꖃ(A1M|\_ 7yI"~\G23V4&"xwkD6{8[/p膋sY̏2Vµ|,PdA+  |)e˯-b.jNkܑ ?UH>F ! @dR Mp7')X# gOZK7^pVhjCDeHui u۔AHIڤ; q%14uP9oUQh dc>X7a |1uX}h←.bEH0jZ&tyH 7/l0] ŠKN q(;'lL\p8D'EDtS.!έHxFIsU0&@79EM>+YmM"4xm *7C86~=+V'`DI[u@)REI`& JMȠW[ 1}M#"HUH 8ԧ<z4}+nnjRf* GKWHTgOS;@t$ aYMqTW1l_{vg޵J$Ρ !Qư쿽'^u/Hj4Ww|~)v|UdfmAyDm$9c+NhA z<6#>fV9^Sg|TVD)@bt#sWQ࢒1bGllGPO;Jc+_' zu2pUNv/a&W^Lȇ{#eiPtc`^6wˌ-KXx<^Jf$9ӏXMaj{xBMEh^u/챘cǫ_+^!'+/Я.=sH`fM$%( {a"5* Q"Rm7# VU)y`5[@7RaWIVi¤av{ظU k8>㗹26!#W=&[7d'55ՕU li,"7+Icz~i]9L6py0HX +gɪBOK6PX*`HdGĐDc: !٘$w7>aym ui#MhA`Qʶm4a p(Mcw*m G}>}sߛz17(9 :;>hKlʚ:툵+q]#u*z^C(s JdwI/– Fj 586m:!r`/ȠI: ҘaʹY:ݔߋ.d*CRyh.+X64 ܦ6ţ0Ph?f"94=v%*Zrz.%COι:jD6lGDuJced^M/+k`ʶU||Ϋrém0/Aj:m|v}"MzPaι͋%鮪K)pTFtDM _G8tz?v`g7u(J?qYq [y z#U2;QMH`fy_KkWd /12>Q)4Z(^Hux$ړi4ÁJJ w˔awު wNsfw' /sԼĞp冷n"l4#xvb a϶ ZEJˑ"~fV7e:CbKVi0J ф[lkz4>iޮ`]U[އQ)vvfz8AXN`x]}D{ L@ H "nk] MhL .<*D-j7x VyiO,~vQk~qn3P' 6kϧVa^\:0.%"KIw=I4:l-x j~A QX5mW:6%-T4VDU cgKߡBWO [oǐCٜp:߽w=)l $#r;x./ǻc (GۣJcݲ j>uECHp/λDx}[4 RBTkZ 1- W9>K?u'5-/r!8Ƿ)0^O)v'jT~N whՏHVzKrJwΙ=v7 CVK:y69HeU y"C=|;;A̕g3~fME͍ b8t>T+Xߠ@zN=Cerl5emsBn!^capu8+[T~k<2%2֧:3QkgĐ$,`B#Y&AM(r`w\h!/)#֞wSK?+`}MyXFo8 (r ̧t,xRM X `OgYZ.shstrtab.note.gnu.property.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata  $1oD; 88XC KoP(P(XoH*H*8go**v`,`, BPMPMpp p p~~00oo pps !!$J."."%%%%%%n &&@&@&&& 1  & &`   &4T&nl/'!