ELF>@p,@8 @PPcc@@@XH XH p%p%p%@P %%% $$Std Ptdt!t!t!QtdRtdp%p%p%WWGNUGNUALÒ]Qn9V،Q MP@F`D%!"PB @@"SA Q!*QQ  8 @!! BB@8XX CH [ 2 "dB(@@P@pC  @   ZP@`$@"@, *#j@  AHHR  h @0"By !Ѐ @ D $x$2Df BXA3@  ADP0B C# PR2@0.@#( @&2(A@2B @P@0H  !LBQ`APB *"( B@@ @H `"BK@0 A@A8 $@#PR @( =02hIJSB(H(0*M*"A $@AA$JTq -R@"%PHxB0P A  h0@)&< !!01t@@@  @!@ @B@2b bD@&`("@ ( @QPH2`  !* :X  Ę@BPE0)HAC hdb8D`b  @@F @@ L!2 $`"'RLH &!@B$  HPEE$r8U#XlP  D 0I'ebaz 0F"`'!d0K$$@@D 0 AHt %(H0 X8$K` 'BP ! AJ,@@!H BA P   P0C aB R0Nh "@  2** %U BH!DB)@CH@@ DU  CAh $^(` (Hh(FX $4@* @ @ ` h PBF":@@B Q@HH  YB @ @ B+ @`@@@H@C $ 0XB4!P( p )9h"*@ "@B ¤D( 2P$& #ÊЈB@"(D#HDID@,#D P  @ Z@-(`@ (6 B:Dr+@ ! @Ht Jp!(@)8 &BDi@¢AnVWZ^`begilqrvz{|   !$')*,./1379:>ADEFLMNOQSUVWY\_`cfikmnoquwxyz}   !$%'()+,-/3457:;<>@ADHKOPRSTVWXYZ[]_`bceghjkmpqstuvy|}~  #%'*+-/1234579:;<=?DEHJKLNOQTVY[\^degjmpsvwy{~  $)*+./13457<>@ACDFGIJLNQUXY[_`adeimqtuwyz|}  "#&(+,.02468;<?CEIJKLNRSVWZ`cegilnopqrtvwy}  "%(-245678:;<=@CEHIKMNOPQRTVWZ]^_acdhklnoqstuxy{|}~  "$(.1378<=?@8(.}WI)FZguh #D[nP"ɛWPvyk; C.cPС ޴t`8ms%8$rf=T?bDXْ_j0c^=ם@# ].VJxifSd}bm2b`5 ѕNTڸBSeyo(8BdhIdWwWSG4E0gd;L'XEgV,wӿk21HoY=JGӁVxD)ھw}+ʒ5>oǠ#,U>wMC jXn -iܼnIiK2O@R 06 Λh&zW?ΏDgǒЮPVIAI!m`,4 s%zH7#qBڌrBa =h)Gdn`t1"Giy"ZPb~8vv.'V qȒh2/rIӦmڰ>`Nh6txB^Vu4H{͜P5bK!C9L8mFrao,SBƩ)gL!}02 xͱ;1NIʵ*rR r^m<*p@9zd꒑s/w<X%k@v?R4өApZ-[CV%  h}dtE^r/y"#/9 ߤGVτ9^a8~k!|7BD@ GVQm`%ziߤQLcߺ ,zxeUpo, x(U ^I=J5 Z}$䎣E}RG3UI}FErݲ׻eQ~ 3~Eӧk m@rk|7;#޻dWqGuV4򎩴¾k֜sI7ЌI攀+9]LǺ^.cD㤘7Lf'#5?ޗq1&h3pƒkq9^PpUȻ uĿ*h*mRXna΀* 8n]-ϋ0-wme*Hu?lZv #b1 ImڨFaTqb$ aPcxFoƑ1R*TԈ+|ʭBFU,U2(qWX>({%ȓ,ɋ*@1rꞋpF#b|¡=,vE3!MۃHn^PuFI 8 eq2)'t]6`UH TU2@2ԥ EWH”:o<˜Hrڬ`5ԟܚȁ<qrW ٍ^C=^i,B# ]쯺NΧW>Ⱥۖ//~̰o_6͏y#Ғ9 >7mZ%N(9)U2 R[M:V,dZk5ky_:p}c`VNTGt2βPi&!^dáZ\ЩFj'^}^`Jwg6'i7(}f#lX!fV;I ֌>`fh' 1VTGtNB|(v63oQJڵ>Ϝ}+3jz'U xP%%fXU6՞U&e5I{}FмR RK$ =>F7j{] p?YIc6DֳW8'"X~*/UFōyKN<@cՍcuNua/oӃF]\axnEÉ̈0ϋW d&Suȼe5[G#{د6i@SxzmW dzA1eIecy_n3 I Ng"cӪ=vsEtKpղ.0t. jKusW(8fr:zj 9mOЊͫɳ)Mظ'@GH')" b?QP_{LWםҔFN'o/@MS sN%,7NNSEH@F-$D!@gh$]U=D˭9sLRha\Fm 38WI)XB62XyOk%d[<R+ 3M6Q:ILZLe7ڀY[N-SQ1mmOpgСm]<'o- xR*u?"@y("kJYGcേ1ؑ,8~Z!/.EuUR1Z dX"9ƨK:dqwˎ TG, <4\P{Q;;.w[_ҮnӀdȄj^\e9623Baѳ7y. 'Bp' Vm {LCij݁g v$'9}ҢKj]b{RNȓC(NU].HYWwmܮ|;2VJ9 8f)Q2mT4svnr 'ny`W_b|O] NڔF UI$llH@[Z z!j՘*F*jy5=\4U ,^&p>`-GiwoPI 2 f,ˋב[(8 StG;bSYWU>@&bmMDn}&#%~uĥ~=hyW2&zsPV2H򢱏(aJ0/bn  7ڋPU*9afBr+x8 Vt6%oۛyFT̛;/XbJ$炌!<׋O>kTc?炌 I` a?ZdIoֲ$kCX~e%}fWvGޘ$mW\ؖf wW~H՟u+AZ܍aWJ6׸x%clX5=F1y9 4\GCkhYVflX&3{-?^VyAC^\f}WUĚB5MF dt63*cΧQAC[owFU[9B]̒,Z[(!#V*RrI~LβcS~s+ᰀ([H(r@ȂBźZwy8P#C٢i2z37yU?r@?좦 H$hrP[:Zm }ۮ3iڄ0 D{ zV[ џvԬ뱢 ;JuMnMs6O H'ץ/KԔ =aUt^`s1շWXD[B\qIs A`I,K 3oQ0_zQ"25:t &TPHQV ))`d*>d?WB8 +;3Į#sYf"Ԙ5žP,~FV&QXE#)_:ݪanaHF׿W&m3\p"Ot\:|yL 󐼏H ̠ak]y}\ȬÕ߸:cs2 p#-W+O8#v YPu2)N c_SY4AWگZ[0 d,^mWud.z=7W>PT$Er1nkXDYpvWAW)3_Ӎ];NaE*ked&Ȭ%d#SqE'L7Wg*~T"@fɵ M sv2zN'RV~|])VJ8kH4|nXqjn͒c΅{rBEc,nEd'ԂQZE7ZFǧ罏 wjGFrPlwH#%%lX$SYS G锛e*M1ZxKmKǝ@ : sG[Hrzu$tOwẋ %EOs:hɷ&8hyr^hl=ma?$Uq{8hFB>+& `Qݴz0w*#f}TQ5_a/d0wBN>G1~fE&B]>!xqF1/}9 Kfwu&xD'o!5>ukaJsk.WIàϙKfѶ(N*BwKfA0!W=?|If+Z_"%QCyޢd|NMaGr FL QGM ۰eduLI^;65Yl&1j mN{x _tg=NMX3К']uI>ҔIEv<.F-lV ~vgk;.NVO2ܗgq#†fƈ̓Z)h.YEӅY{p4E?΍~4VsY)pps)E ݒoY߇ >~LYY.~{iOD#%A ~ӒŋYk݈ Y ThÌ>~_| ԃ)E/~TA<*lBqOw, A:}~a3Y2ZlF"4ыՆC E3IO+yφ߉~˅_y<EXn=w}~wΈ~=>hoyՌ҇S~ӇI[`ω}b~eMO^kN3`Ee`h݌-#ƒH'OR{ȆORx~yۑ)YL44ƉPO~y#,zy_։#~ +ˁ)<ڇo)hP{:\Yse~%0Zֈ :4BɇU1hY fAn߆XЌ[چCFfk @J 0 '"U I\:   |Y xi7 #g  ,z ,Ƃ PT j ^D meg ` ! y  y`f; P [ pz, P 7 `%''5 Xx  |` p ]5\, P> ) N /H'/? :aU MC}) Orb PU%f bP!' 3n-i!  P >' >^ 9h 7 7 |^ OH 4 K 0dJk wl `Wv&> @( L: x} 0  &80 p y P  *( PX  ƒ (x /}'J f @hu`'V `&P'@ &'q  &p',P# @" ,? eM m i  PZv/ T s T Bu _  1 9LF ` Yc p[\s@)(R Lv ܋ 3D. G  E  q~d fIb `TE1 cV1 ` fXx   `J 0*7 C SC P k 0@\? А  1GK'0 Pp ?> - sa0 q `) @ ( n  ^['> 1\B 4z p&/M    ]| PsL 1t жw `: @Yk AEx  7 P /`^'Q@P' " m)  p- ?0 Wp @x R0\ l@| y=P Y]{ Z%\ 0g TP P=il V!  | g?|] ^ H 7m BsC u) p2  ] P, :FjX fO `#AG `6 p ? 7%  *H @7f"$ 0* (n n&/U `rZ $P  xa ?q^"'"'R?  ~ m) X|J nn Pq6< p 3b Rx0 /S- `hÐ `y^s 8 ` 9[ jN *?M x~j  9  gH@'d _!2 P @_ - * qkW R @"   @ Z <  7M ?>   >Qw 0`. P  x[ k @L-i ~ 9<  8 > ' LR Pvc @Z,N JL `uGf PF xy} Pq\ 0~ A , [. `@ U `M5 S- 9s wM ~.Q d  |' TTn  yQV r, + Iَ&/' ' # 0 nk&'<  0 W ] =n `p P ZH 9 wW @R_('/ `W H_ PvV pr  Q ^ {@ U')1  Rhy J8 @ %o w f |I Pe "  'eo si`n') P ISL  Б* @P ZO@ Hlq }`''ڀ 1` E  @*uE z1  |{ `,g `Q [j:'j  @e'[ 9'A y-S T+v   9.&'J 0T 6q {X PsW s# p) 5"_ 04` T j}_ p= pd3q- '2  )x'| d| _ ]V 0 rg ` 'y `I'N{ Z-eH 5k; u V 0: m @nLq `|H pJ 5 @ G'( p njK 0dn [2  ,b Lp%(( W &? ;^ v-z> ) N  C? -^ P `YHg 2m ^C+U 0I] @f( P_ pd 0C3 pS &/) 0 cB@(/ _ c+ @ < > :e xF9 yJ Жu 'yo v|@q'z2  BJ  s 66 ` ICV P Z| c< %Z &/, 01\d hPz1 L n p h+) O 6  x\ 0Y5" #(x K Trn p  "7 38 P LY7 ` 3 0xL | }  Q 'z'n 7 6uL `Z>> ( LJs pV]b TErz >'`&/hE @ "i / pM <y-S e Pt}3 06 h @KK M$(#$ ) 3- P ?3s UIR a!{  `b U! @fS 6p` IG `4Oht ly U { G+@G @ Wp pw  '^ dT `& B`q |C ^_ d%'@ ` I `ec3 3 5<`'E T AA 0 T V{i w? Z= @ Y( t  '5_ @;7 Cԍh'/s  * a&'# p# {t `% ,iK  b pY ;` p m-S $P(p p = & z| }.H( G/ Q  i `'s 0YI f v   p 3 U 2 pxU3 pCt Pi`-' | b K r -! y. G ] _#'  #f @s': 9 a'/ P M #; ؂ 2d Pa@!#| xee sI7 0 #} G  @x: ~y}g P`'m? Б EKU @jm   @C(P|d3.b-  1 tx  9]9   wb5 P ]) } !x  "^ pS> ( o* 0 = &  P6 H `[/ @[ = ! ]x #U Z> T=J ^:  p 0xQ P&'mG  q@ @ O 7aK  '& 7{U 65 P U r[ @k%'Њ 0odh Zu d 0W C p/ e @l a$(M v1 P zF 0 `  Q _A p 5\,Z 3 [9|h3.9U Ir 0C ` B y7U@l'q D 4g1  5'P sp d f У X p %1=  1  A[-" `6S  @!''+ p # =5   gs24 u !8Q [H$o @s;g  @  0:i e K  v" %r op w-  UM zt @ '/u  ( o ri V2  (r 0X _a Pf G X h2 P V ?w @ ('u G7 #, <r `8!' eC ` R jQ&f'? 0 f8 '] @P P2\ P '{; P za - 0  5 7  4 ZPv Q+ <  c P] v' 9  ^] z4 y 4 ~ 1 0q#9 D s n prU 6 p I W L pQ@'8  <h> P) N'8 ?Z 0iv  J `fW q 9 0 F.O R -y''6R `aD N-* p&q ROj 'W J  X @H!'Rz  U `p| 0t>@ Ч 6# ! SI `aU=q {$D ` k< P >. `I ` g p 0 2A sV  w  i N$0(U 3r n n o3 5 ]`   $#b LTl  x@v's 2 $ ( -V&'U r" x @ yr P 0$  xJ4 Pv f w = ! EN ] 'p' @v-,z u* 3d K 0 a: ^P'/8 o v4 q uK Z Y%a 0 ? k O0 Ќ Dm `_%] VU 6p  F [W b/bd Pes^ `3 A D u } w 1W 0'/]} 7 = D(q 0NK [ `kE <5c'A8 7l D{ \T c PZEK 0n rW s P  xW p'2  2 s- B PMO -A Mi ]. B v8 ] Pz @- zp)  `1Bmܗ_ B`(' @U`# P" v p    xa pz:  0V'@H'd f  \z7 А CB( 0Iς z CS `zD D'֏ b4 x > a Nl PF8 p %| `~- o v pH|~ 7; @'  0p xbz P 4a 0Z=3 p+ 2ES pJe pj @S\ 0l U] pM5 p.#%@cPy J~  !$v  ' I* p `_ `fM {/<   ' 0=F pW & 0G6K 0k  AUl9 p u'l [ CD # # dF 2&/ 'i W p:<B() а QF -m @M" %U 0] 0x Cq y{;\,d k!  @y 0x YT 0&gA FZ `9p xC  0#n '/! ЙUS() '.! @c \p e nC02'= `' $x),3 A b  P YDh+)- Dn<  L0'/V qj5   |+, m h9 W;G #d vci Y +V ++ )O zM:\,Z, $p),U 3!q z( @y. D N @En r-{ @Hr@bQ+ 0 _v PU E 0 I u( o  [ iC  |7 C Q/f Pw'o p}5 #' @L \ H  x(. P> o v +G 0   E' #'q }m ]; R aHgI d k O)? BL p, p <i F p  Ю~O e6h'đ @Vo Cc \ H 5? S&/? @ WV 6`'/g P U jP PZOV psy Au 5 SB P A/p 0w- n~'/D @ : R^ Ro sS@ D <Ba @3g$([J `^\ Pl:3N t'o > *6 P R `HUB@(\'cW pjC b 0Z9V  6M ''I `O=( X W1 P N ^6w 7 |M  'w 5 ` F B 9   "L'  K@+ 3B  WG d̄ l< P* x`n pu )  ` J!  e-C  * NO P p f s  `_~ 9 X'/Dv @ h )` y{ Z3{m gTR ЋB' 9:  \fV ZX lu 0  + P ]] `zr Y7 09z !Rd @&Z( ^ 0'x`'9I @a!* % Ɍ @o&'V  `h` `  | x ( p m `hTTE I{$(rL w( 0p 7 `:  Ɏ&/= ! %0'V 0Zm ]rf| p w ' S+ 0@'L { Р[ k7ZD > =F ;"j c ք m'/M -@A'X@ `#Q 0[H~ '0n Pp@. `K } `bL Pc ^a [ kk. B sH @_4  #_ %M w_r,7) xT'j qVb* ` C pO`X'O `G&'4 P=5_\ 0|E e  <U 4 `  4y0r Ѝ#0'$p (( r (@'/# ) 5'p yy, 0* ` y|e @t  |l @ZPz `G+B 0 0 @ ?] 5w WG o >5  /'g КN/ P]  '! qB(w "n p*,h 6V ZUf `Sl [-2  : ` 5< @ m[ q}:  _ Pa pXQG p0z13 p)  P  yO ,J @%xR pdM9 ` y"/ P ]+ T >  }Q p\]  +' 93 `D 1 HT *c8 0  va %PX  r%(d `_ R> `pU @61 ` T UW ^8N'] Gs= R pyU{`3.T `6P}z.M    p/ Y ,u d i S  - p <, .t ! *'G 7 _ TS(ps  Ld 0bS'f'> ` G P/+ <@&/  %s+ P Pg; (;8'/ ^;   < } x+EY P0q @{HXA S.F   ; m" % c_   ]X   j, P mN `@F(b XF[ jE ' # P! [x 3 " A @ LY %D \ V @ jb Vk `? ` Cy `\G  #' W/z0 0 f% ( )C 3 0k څ \  P)H \Eh pQ{ p_)4 I@ p mw p h @MtT J  `(-  ;o sZ N <nN [Z :/T D, <c `]\ LJ) | l ~^ &p'd `hH}  u Q ^['7  cD- T Lv N \O *  KS- @ z `N @W R 0':c ZET &#0 p ~L P}pZ 9- 4   <-W U s, `dK p)In P  -b ['Wm ``I I |F g'A =0 J 5 P !I {7  +$\ Ѓ^e P{f    xG 3d%P'Eb'TP`,A ж n q, ! 0yW @]  |h v g P@%'j} g <  v F'6 *1 P  <cF p VG w 4x 0Va)  C%(c z=z P* 2 nJ 0>' U 1 p s fQ \HE 0+c Z@[%P(S3 1 [  x !Y @V9E  dR b)  {`<') b+h dK o3/ Q 3 @A 11 ? 0?'j fl: p# x76 `D 5.z PiN. ? s6 y  ! " 9S 0cz Fd: 0 zMb 2\G $ Z pFV 3R ].'6 Tn @q 'CW M/ \ D? " 0%   бZ Z yb ). PH F t p3yr @  NP Z5 0 F 6X  X F UE zB$ - )|)| pa >ND P IO Ka p(H 7 '!@' `  /Y 4/  Ph'R  tj  @F(Jc 0[@61 ` !3 @( m-@'2e oC Pqa @? f - pY ~Q \]'t  u8 F DrQ'* % PC p $ 0~g] pl9 P E=  / S ` p>; ,/ o v- l \ CU c: 'nV Z 0 Y 78i `z . `= gV< @ O9 @ _ O5} pX ` X PB  l Y^v( c V 0Z1j " `6 4*  QRa ? k kP`Pr5 Yp-G2  aP XP` ځ ` &yB(U*  . = r+ < ` = }H 07 B&0'&0'YN  R; {čp'/? pzB(S 0v h+)t pQ5) z IU `3Y'} g MH L| d @_B. ? V 0 j 0B,2  !g+ 0 m)- @ 6 3b `Y 7 .wA p =08 Щ S?  } 4 pj wr K <!y 0#&/h J" T ''k \ 0Xu @S u  ;7  b P?1# CC\ @m."8 .3%(O 6, B(7 p'~Q 0]q ~TwS o;d]=  >9 n; 4 @ ] `[]- 5 `g O "5o w '(' 8z=@4'6})0'' @VGA ` <* w{ a~a `$*W ` * p  ) u  P@t wM6 ` r'xO | u(H'P'e{ PZ>i @*  Nr I DN7' kp 6 cf^ Y trh 0! ykw   yY 0 PC <"X t @ l ЍYn'%0(Z/ T s) @y Mk pDUU I] 8 0L 2 /V Z ( p2 `WH-` 0<0L W F j'9 E2  jf &P XFe-Cp `w6 p #| N. |y`'D P ={ VD _ R,Sg pOQ [Ho s$Y W { GrT {E 0 B (w P : @ 9?  0&/Wt pzB `q> 08 X* . R 1  x 5.W PxGC 3 U֐ yO =D @X@$} `;6 #r 0&On pp qD @ t Ы 1D b* L5'h @v ;$'; FU[ jE 6h] `X 0 * j Dl 0\6 u `P=  !w  t n pb p1!'@ | ~^__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Py_add_one_to_index_F_Py_add_one_to_index_C__fprintf_chkungetc_Py_gitversion_Py_gitidentifierPyGrammar_RemoveAcceleratorsPyGrammar_FindDFAPyNode_ListTreestdoutPyNode_Free_PyNode_SizeOf_Py_delbitset_Py_addbit_Py_samebitset_Py_mergebitset_Py_meta_grammar_Py_freegrammarPyToken_OneCharPyToken_TwoCharsPyToken_ThreeChars_PyObject_HasLenPyBuffer_IsContiguousPyBuffer_GetPointerPyBuffer_FillContiguousStridesPyBuffer_ReleasePyNumber_CheckPyNumber_PowerPyNumber_InPlacePowerPySequence_CheckPy_GetBuildInfoPyGrammar_AddAcceleratorsmemset__printf_chkstderrPyNode_NewPyGrammar_LabelRepr_PyParser_TokenNames_Py_translatelabelsPy_DebugFlag__ctype_b_loc_Py_newbitset_Py_newgrammar_Py_findlabelPyNode_AddChildPyParser_AddToken_Py_addfirstsets_Py_adddfastrdup_Py_addstate_Py_addarc_Py_addlabel_Py_pgenPyParser_DeletePyTokenizer_FreePyParser_NewPyTokenizer_FromFile__errno_locationPyOS_InputHookclearerrfgetsfeof_PyOS_ReadlineTStatePyBuffer_FromContiguousmemcpyPyOS_StdioReadlinefflushPyExc_OverflowErrorPyBuffer_FillInfoPyExc_BufferErrorPyOS_Readline_PyThreadState_CurrentPyOS_ReadlineFunctionPointerPyExc_MemoryErrorPyExc_RuntimeErrorPyObject_TypePyExc_SystemErrorPyObject_AsWriteBufferPyExc_TypeError__stack_chk_failftelllseek64_Py_NoneStruct_Py_FalseStructPyExc_OSError_Py_ctype_table__ctype_tolower_locPyExc_SyntaxErrorPyObject_GetBufferPyObject_AsReadBufferPyObject_AsCharBufferPyObject_CopyDataPyNumber_NegativePyNumber_PositivePyNumber_InvertPyNumber_AbsolutePySequence_SizePySequence_LengthPySequence_GetItemPySequence_SetItemPyUnicode_TypePyTokenizer_FromUTF8PyTokenizer_FromStringPyObject_CheckReadBufferPyObject_SizestdinPyExc_UnicodeDecodeErrorPyTokenizer_GetPyParser_ParseStringObjectPyParser_ParseStringFlagsFilenameExPyParser_ParseStringFlagsFilenamePyParser_ParseStringPyParser_ParseStringFlagsPyParser_ParseFileObjectPyParser_ParseFileFlagsExPyParser_ParseFileFlagsPyParser_ParseFilePyTokenizer_FindEncodingFilenamefdopenfclosePyTokenizer_FindEncodingPyObject_LengthPyObject_LengthHint_Py_NotImplementedStructPyExc_ValueErrorPyObject_FormatPyLong_TypePyNumber_RshiftPyCFunction_TypePyNumber_OrPyNumber_XorPyNumber_AndPyNumber_LshiftPyNumber_SubtractPyNumber_DivmodPyNumber_AddPyNumber_MatrixMultiplyPyNumber_FloorDividePyNumber_TrueDividePyNumber_RemainderPyNumber_InPlaceLshiftPyNumber_InPlaceOrPyNumber_InPlaceXorPyNumber_InPlaceAndPyNumber_InPlaceRshiftPyNumber_InPlaceSubtractPyNumber_InMatrixMultiplyPyNumber_InPlaceFloorDividePyNumber_InPlaceTrueDividePyNumber_InPlaceAddPyNumber_InPlaceMatrixMultiplyPyNumber_InPlaceRemainderPySequence_InPlaceConcatPySequence_ConcatPyNumber_IndexPyExc_DeprecationWarningPyNumber_AsSsize_tPyObject_GetItemPyExc_IndexErrorPyObject_SetItemPyObject_DelItemPyObject_DelItemStringPyNumber_MultiplyPyNumber_InPlaceMultiplyPyNumber_LongPyByteArray_Type_PyByteArray_empty_stringPyNumber_FloatPyFloat_TypePyNumber_ToBasePySequence_RepeatPySequence_InPlaceRepeatPySequence_GetSlicePyExc_WarningPyExc_LookupError_Py_abstract_hackPyExc_UnicodeError_Py_EllipsisObjectPyEllipsis_Type_Py_zfill__doc___Py_upper__doc___Py_title__doc___Py_swapcase__doc___Py_startswith__doc___Py_rjust__doc___Py_rindex__doc___Py_rfind__doc___Py_lower__doc___Py_ljust__doc___Py_isupper__doc___Py_istitle__doc___Py_isspace__doc___Py_islower__doc___Py_isdigit__doc___Py_isalpha__doc___Py_isalnum__doc___Py_index__doc___Py_find__doc___Py_expandtabs__doc___Py_endswith__doc___Py_count__doc___Py_center__doc___Py_capitalize__doc__PyTraceBack_TypePyType_TypePySTEntry_TypePyZip_TypePyMap_TypePyFilter_Type_PyWeakref_CallableProxyType_PyWeakref_ProxyType_PyWeakref_RefTypePyUnicodeIter_TypePyTuple_TypePyTupleIter_TypePySlice_TypePySetIter_TypePyFrozenSet_TypePySet_TypePyLongRangeIter_TypePyRangeIter_TypePyRange_TypePyCapsule_Type_PyNotImplemented_Type_PyNamespace_TypePyModule_TypePyModuleDef_TypePyMemoryView_Type_PyManagedBuffer_TypePyODict_TypePyDict_TypePyODictKeys_TypePyDictKeys_TypePyODictValues_TypePyDictValues_TypePyODictItems_TypePyDictItems_TypePyODictIter_TypePyDictIterValue_TypePyDictIterKey_TypePyDictIterItem_TypePyList_TypePyListRevIter_TypePyListIter_TypePyCallIter_TypePySeqIter_TypePyStaticMethod_TypePyClassMethod_TypePyFunction_TypePyFrame_TypePyStdPrinter_Type_PyAIterWrapper_Type_PyAsyncGenWrappedValue_TypePyGen_TypePyCoro_Type_PyAsyncGenASend_Type_PyAsyncGenAThrow_Type_PyCoroWrapper_TypePyAsyncGen_TypePyEnum_TypePyReversed_TypePyWrapperDescr_TypePyGetSetDescr_TypePyMemberDescr_TypePyClassMethodDescr_TypePyMethodDescr_Type_PyMethodWrapper_TypePyDictProxy_TypePyProperty_TypePyComplex_TypePyCode_TypePyInstanceMethod_TypePyMethod_TypePyCell_TypePyBytesIter_TypePyBytes_TypePyBaseObject_TypePyByteArrayIter_TypePySuper_Type_Py_TrueStructPyBool_Type_PyNone_TypePyExc_BaseExceptionPyExc_ExceptionPyExc_ArithmeticErrorPyMapping_Check_PyAccu_DestroyPyBool_FromLong_Py_bytes_isspace_Py_bytes_isalpha_Py_bytes_isalnum_Py_bytes_isdigit_Py_bytes_islower_Py_bytes_isupper_Py_bytes_istitle_Py_bytes_lower_Py_ctype_tolower_Py_bytes_upper_Py_ctype_toupper_Py_bytes_title_Py_bytes_capitalize_Py_bytes_swapcasePyByteArray_FiniPyByteArray_InitPyByteArray_SizePyByteArray_AsStringPySequence_DelItemPyMapping_SizePyMapping_LengthPySequence_SetSlicePySequence_DelSlice_PyStack_AsTuplePySequence_List_PyAccu_InitPyMapping_GetItemStringPyMapping_SetItemStringPyMapping_HasKeyStringPyMapping_HasKeyPyIter_NextPyExc_StopIterationPyObject_CallObject_Py_CheckFunctionResultPyObject_Call_Py_CheckRecursionLimit_PyObject_FastCallDictPyObject_CallFunctionObjArgsPyByteArray_FromObject_Py_FreeCharPArray_PyObject_Call_Prepend_PyStack_AsDict_PyStack_UnpackDict_PyObject_FastCallKeywordsPyObject_CallFunction_PyObject_CallFunction_SizeTPyObject_CallMethod_PyObject_CallMethod_SizeT_PyObject_CallMethodId_PyObject_CallMethodId_SizeT_PyObject_CallMethodIdObjArgsPyExc_AttributeErrorPyObject_CallMethodObjArgs_PyObject_RealIsInstance_PyObject_RealIsSubclassPyObject_IsInstancePyObject_IsSubclassPyObject_GetIterPySequence_TuplePySequence_FastPyMapping_KeysPyMapping_ItemsPyMapping_Values_PySequence_IterSearchPySequence_CountPySequence_ContainsPySequence_InPySequence_Index_PySequence_BytesToCharpArray_PyAccu_Accumulate_PyAccu_FinishAsList_PyAccu_Finish_Py_bytes_maketrans_Py_bytes_containsmemchrmemrchr_Py_bytes_startswith_Py_bytes_endswith_Py_bytes_find_Py_bytes_index_Py_bytes_rfind_Py_bytes_rindex_Py_bytes_countPyByteArray_FromStringAndSizePyByteArray_ConcatPyByteArray_ResizememmovePy_hexdigitsPy_BytesWarningFlagPyExc_BytesWarningPyBytes_Fini_PyBytesWriter_Init_PyBytesWriter_DeallocPyMethod_ClearFreeListPyMethod_FiniPyCell_New_PyGC_generation0PyInstanceMethod_NewPyCell_GetPyCell_SetPyMethod_FunctionPyMethod_SelfPyMethod_NewPyInstanceMethod_FunctionPyBytes_FromStringPyBytes_FromStringAndSizePyBytes_SizePyBytes_AsStringPyBytes_AsStringAndSize_PyBytes_JoinPyBytes_Repr_PyBytes_ResizePyBytes_ConcatPyBytes_ConcatAndDel_PyBytesWriter_Resize_PyBytesWriter_Prepare_PyBytesWriter_Alloc_PyBytesWriter_WriteBytes_PyBytesWriter_FinishPyBytes_FromFormatV__sprintf_chk__memmove_chkPyBytes_FromFormat_PyBytes_FormatEx_PyBytes_DecodeEscape_PyLong_DigitValue_PyBytes_FromHexPyBytes_FromObject_PyMethod_DebugMallocStats_PyCode_CheckLineNumber_Py_c_sum_Py_c_diff_Py_c_neg_Py_c_prod_Py_c_quot_Py_c_powhypotatan2sincoslog_Py_c_absPyException_GetTracebackPyException_GetCausePyException_SetCausePyException_GetContextPyException_SetContextPyUnicodeEncodeError_SetStartPyUnicodeDecodeError_SetStartPyUnicodeTranslateError_SetStartPyUnicodeEncodeError_SetEndPyUnicodeDecodeError_SetEndPyUnicodeTranslateError_SetEnd_PyCode_GetExtraPyException_SetTracebackPyComplex_FromCComplexPyComplex_FromDoublesPyCode_NewPyUnicodeDecodeError_SetReasonPyUnicodeEncodeError_SetReasonPyUnicodeTranslateError_SetReasonPyCode_NewEmptyPyUnicodeEncodeError_GetStartPyUnicodeTranslateError_GetStartPyUnicodeEncodeError_GetEncodingPyUnicodeDecodeError_GetEncodingPyUnicodeEncodeError_GetObjectPyUnicodeDecodeError_GetStartPyUnicodeDecodeError_GetObjectPyUnicodeTranslateError_GetObjectPyUnicodeEncodeError_GetEndPyUnicodeTranslateError_GetEndPyUnicodeDecodeError_GetEndPyUnicodeEncodeError_GetReasonPyUnicodeDecodeError_GetReasonPyUnicodeTranslateError_GetReasonPyCode_Addr2Line_PyCode_SetExtraPyComplex_RealAsDoublePyComplex_ImagAsDoublePyComplex_AsCComplex_PyCode_ConstantKeyPyExc_ZeroDivisionErrorPyDescr_NewMethodPyDescr_NewClassMethodPyDescr_NewMemberPyDescr_NewGetSetPyDescr_NewWrapperPyWrapper_NewPyDictProxy_NewPyExc_BlockingIOError_PyExc_Fini_PyGen_yfPyGen_NeedsFinalizingPyAsyncGen_ClearFreeListsPyAsyncGen_FiniPy_UniversalNewlineFgetsflockfilefunlockfile__uflowPyFloat_GetMaxPyFloat_GetMinPyUnicodeEncodeError_CreatePyExc_UnicodeEncodeErrorPyUnicodeDecodeError_CreatePyExc_UnicodeTranslateError_PyUnicodeTranslateError_Create_PyExc_InitPyExc_StopAsyncIterationPyExc_GeneratorExitPyExc_SystemExitPyExc_KeyboardInterruptPyExc_ImportErrorPyExc_ModuleNotFoundErrorPyExc_EnvironmentErrorPyExc_IOErrorPyExc_EOFErrorPyExc_RecursionErrorPyExc_NotImplementedErrorPyExc_NameErrorPyExc_UnboundLocalErrorPyExc_IndentationErrorPyExc_TabErrorPyExc_KeyErrorPyExc_AssertionErrorPyExc_FloatingPointErrorPyExc_ReferenceErrorPyExc_UserWarningPyExc_PendingDeprecationWarningPyExc_SyntaxWarningPyExc_RuntimeWarningPyExc_FutureWarningPyExc_ImportWarningPyExc_UnicodeWarningPyExc_ResourceWarningPyExc_ConnectionErrorPyExc_BrokenPipeErrorPyExc_ChildProcessErrorPyExc_ConnectionAbortedErrorPyExc_ConnectionRefusedErrorPyExc_ConnectionResetErrorPyExc_FileExistsErrorPyExc_FileNotFoundErrorPyExc_IsADirectoryErrorPyExc_NotADirectoryErrorPyExc_InterruptedErrorPyExc_PermissionErrorPyExc_ProcessLookupErrorPyExc_TimeoutError_PyErr_TrySetFromCause_Py_ascii_whitespace_PyCoro_GetAwaitableIterPyFile_WriteObjectPyFile_WriteString_PyGen_SetStopIterationValue_PyGen_Send_PyGen_Finalize_PyGen_FetchStopIterationValuePyGen_NewWithQualNamePyGen_NewPyCoro_NewPyAsyncGen_New_PyAIterWrapper_New_PyAsyncGenValueWrapperNewPyFile_FromFdPyFile_GetLinePyObject_AsFileDescriptorPyFile_NewStdPrinterPyFloat_FromDoublePyFloat_GetInfoPyFloat_FromStringPyFloat_AsDoublefmodfrexpldexpmodf_Py_SwappedOproundPyFloat_ClearFreeListPyFloat_Fini_PyFrame_InitPyFrame_ClearFreeListPyFrame_FiniPyClassMethod_NewPyStaticMethod_NewPyList_ClearFreeListPyList_Fini_PyLong_SignPyFrame_BlockSetupPyFrame_BlockPop_PyFloat_Pack2_PyFloat_Pack4_PyFloat_Pack8_PyFloat_Unpack4_PyFloat_Unpack8_PyLong_NumBits_PyFloat_Init_PyFloat_DebugMallocStats_PyFrame_DebugMallocStats_PyList_DebugMallocStats_PyFloat_Unpack2PyFrame_GetLineNumberPyFrame_NewPyFrame_FastToLocalsWithErrorPyFrame_FastToLocalsPyFunction_GetCodePyFunction_GetGlobalsPyFunction_GetModulePyFunction_GetDefaultsPyFunction_SetDefaultsPyFunction_GetKwDefaultsPyFunction_SetKwDefaultsPyFunction_GetClosurePyFunction_SetClosurePyFunction_GetAnnotationsPyFunction_SetAnnotationsPyList_SizePyList_SetItemPyList_ReversePyLong_AsSsize_tPyLong_AsUnsignedLongPyLong_AsSize_tPyFrame_LocalsToFastPyCallIter_NewPyFunction_NewWithQualNamePyFunction_NewPyList_AsTuplePySeqIter_NewPyList_InsertPyList_AppendPyList_NewPyList_GetSlicePyList_GetItemPyList_SetSlice_PyList_ExtendPyList_Sort_PyLong_FromNbIntPyLong_AsLongAndOverflowPyLong_AsLong_PyLong_AsIntPyLong_AsUnsignedLongMask_PyLong_New_PyLong_CopyPyLong_FromLongPyLong_FromUnsignedLongPyLong_FromDouble_PyLong_FromByteArrayPyLong_FiniPyDict_ClearFreeListPyDict_Fini_PyDict_MaybeUntrack_PyLong_AsByteArray_PyLong_FrexpPyLong_FromVoidPtrPyLong_AsVoidPtrPyLong_FromLongLongPyLong_FromSsize_tPyLong_FromUnsignedLongLongPyLong_FromSize_tPyLong_AsLongLongPyLong_AsUnsignedLongLongPyLong_AsUnsignedLongLongMaskPyLong_AsLongLongAndOverflowPyLong_AsDouble_PyLong_Format_PyLong_FormatWriter_PyLong_FormatBytesWriterPyLong_FromString_PyLong_FromBytesPyLong_FromUnicodeObjectPyLong_FromUnicode_PyLong_GCD_PyLong_DivmodNearPyLong_GetInfo_PyLong_Init_PyDict_DebugMallocStatsPyDict_New_PyDict_NewPresized_PyDict_HasOnlyStringKeysPyDict_GetItem_PyDict_Next_PyDict_SizeOf_PyDict_KeysSize_PyDict_Contains_PyDictKeys_DecRefPyODict_New_PyDict_GetItem_KnownHash_PyDict_SetItem_KnownHashPyDict_SizePyDict_GetItemWithError_PyDict_LoadGlobalPyDict_SetItem_PyDict_GetItemIdWithError_PyDict_SetItemId_PyDict_DelItem_KnownHashPyDict_DelItem_PyDict_DelItemId_PyDict_DelItemIf_PyDict_Pop_KnownHash_PyDict_PopPyDict_Clear_PyDict_FromKeysPyDict_DelItemStringPyDict_MergeFromSeq2PyDict_UpdatePyDict_Merge_PyDict_MergeExPyDict_SetDefault_PyDictView_NewPyDict_Copy_PyObjectDict_SetItemPyODict_DelItemPyDict_KeysPyDict_ValuesPyDict_Items_PyDict_GetItemIdPyDict_GetItemString_PyDict_NewKeysForClassPyDict_SetItemString_PyDictView_IntersectPyObject_GenericGetDictPyODict_SetItemPyBuffer_ToContiguousPyMemoryView_FromBufferPyMemoryView_FromObjectPyMemoryView_FromMemoryPyMemoryView_GetContiguousPyObject_SelfIterPyMem_RawMallocPyMem_RawFreePyObject_Freecallocmmap64munmapPyCFunction_ClearFreeListPyCFunction_FiniPy_IncRefPy_DecRefPyObject_CallFinalizer_Py_BreakPoint_PyObject_GetDictPtrPyObject_IsTruePyObject_NotPyCallable_Check_PyTrash_deposit_object_PyTrash_delete_later_PyTrash_thread_deposit_object_PyTrash_destroy_chain_PyTrash_delete_nesting_PyTrash_thread_destroy_chain_Py_Dealloc_PyMem_PymallocEnabledPyMem_GetAllocatorPyMem_SetAllocatorPyMem_SetupDebugHooks_PyMem_SetupAllocatorsPyObject_GetArenaAllocatorPyObject_SetArenaAllocatorPyMem_RawCallocPyMem_RawReallocPyMem_MallocPyMem_CallocPyMem_ReallocPyMem_Free_PyMem_RawStrdup_PyMem_StrdupPyObject_MallocPyObject_CallocPyObject_Realloc_Py_GetAllocatedBlocks_PyMem_IsFreed_PyObject_IsFreedPyObject_HashNotImplemented_PyObject_NextNotImplementedPyObject_GenericSetDictPyObject_InitPyObject_InitVar_PyObject_New_PyObject_NewVarPyObject_CallFinalizerFromDeallocPyCFunction_NewExPyCFunction_NewPyCFunction_GetFunctionPyCFunction_GetSelfPyCFunction_GetFlags_PyCFunction_FastCallDictPyCFunction_Call_PyCFunction_FastCallKeywordsPyModule_GetDict_PyCFunction_DebugMallocStatsPyModuleDef_InitPyObject_Hash_Py_ReadyTypesPyModule_NewObjectPyModule_NewPyObject_GetAttrPyObject_HasAttrPyModule_GetNameObjectPyModule_GetNamePyModule_ExecDefPyModule_GetFilenameObjectPyModule_GetFilenamePyModule_GetDefPyModule_GetState_PyModule_ClearDictPy_VerboseFlag_PyModule_Clear_PyNamespace_NewPyObject_RichComparePyObject_RichCompareBoolPyObject_ReprPyObject_StrPyObject_Printfwriteferror_PyObject_DumpPyObject_ASCIIPyObject_BytesPyObject_GetAttrStringPyObject_HasAttrString_PyObject_GetAttrId_PyObject_IsAbstract_PyObject_HasAttrIdPyObject_SetAttrPyObject_SetAttrStringPyModule_AddFunctions_PyObject_SetAttrIdPyModule_SetDocStringPyModule_Create2_Py_PackageContextPyModule_FromDefAndSpec2_PyObject_GetBuiltin_PyObject_GenericGetAttrWithDictPyObject_GenericGetAttr_PyObject_GenericSetAttrWithDictPyObject_GenericSetAttrPyObject_Dir_PyObject_DebugTypeStatsPy_ReprEnterPy_ReprLeavefputc__snprintf_chkPyFileIO_TypePyBytesIO_TypefputsPyCapsule_IsValidPySet_ClearFreeListPySet_FiniPySlice_FiniPySlice_AdjustIndicesPyStructSequence_SetItemPyStructSequence_GetItem_PyDebugAllocatorStats_PyObject_DebugMallocStats_PyTuple_DebugMallocStatsPyCapsule_NewPyCapsule_GetPointerPyCapsule_GetNamePyCapsule_GetDestructorPyCapsule_GetContextPyCapsule_SetPointerPyCapsule_SetNamePyCapsule_SetDestructorPyCapsule_SetContextPyCapsule_Import_PySlice_GetLongIndicesPySlice_GetIndicesPySlice_New_PySlice_FromIndicesPySet_NewPyFrozenSet_NewPySet_SizePySet_ClearPySet_ContainsPySet_DiscardPySet_Add_PySet_NextEntryPySet_Pop_PySet_UpdatePyTuple_SizePyTuple_GetItemPyTuple_SetItemPySlice_UnpackPySlice_GetIndicesExPyStructSequence_NewPyTuple_New__strncpy_chkPyStructSequence_InitType2PyStructSequence_UnnamedFieldPyStructSequence_InitTypePyStructSequence_NewType_PyStructSequence_Init_PySet_DummyPyType_GenericNew_PyTuple_MaybeUntrackPyTuple_ClearFreeListPyTuple_FiniPyType_IsSubtypePyType_GetFlagsPyTuple_Pack_PyType_GetDocFromInternalDoc_PyType_CalculateMetaclassPyTuple_GetSlicePyType_GetSlot_PyTuple_Resize_PyType_GetTextSignatureFromInternalDocPyType_ModifiedPyType_ClearCache_PyType_FiniPyType_GenericAlloc_PyType_Lookup_PyType_LookupId_PyObject_LookupSpecialPyType_FromSpecWithBasesPyType_FromSpecPyTextIOBase_TypePyIOBase_TypePyBufferedIOBase_TypePyRawIOBase_TypePyTextIOWrapper_TypePyIncrementalNewlineDecoder_TypePyBufferedRWPair_TypePyBufferedRandom_TypePyBufferedWriter_TypePyBufferedReader_TypePyUnicode_GetMax_PyUnicode_FastCopyCharacters_PyUnicode_ClearStaticStringsPyUnicode_New_PyUnicode_FromASCIIPyUnicode_FromKindAndData_PyUnicode_ReadyPyUnicode_FromUnicodePyUnicode_CopyCharactersPyUnicode_ResizePyUnicode_FromStringAndSizePyUnicode_FromStringPyType_Ready_PyUnicode_FromId_PyUnicode_FindMaxChar_Py_normalize_encodingPyUnicode_GetDefaultEncoding_PyUnicode_CopyPyUnicode_FromOrdinal_PyUnicode_AsKindPyUnicode_AsUCS4PyUnicode_AsUCS4CopyPyUnicode_FromObjectPyUnicode_FromWideCharwcslenPyUnicode_AsDecodedObjectPyUnicode_AsDecodedUnicodePyUnicode_GetLengthPyUnicode_ReadCharPyUnicode_WriteCharPyUnicode_AsEncodedObjectPyUnicode_AsEncodedUnicodembstowcsstrerrormbrtowcPyUnicode_DecodeLocaleAndSizePyUnicode_DecodeLocalePyUnicode_AsUnicodeAndSizePyUnicode_AsWideCharwcstombsPyUnicode_EncodeLocale_PyUnicode_AsWideCharStringPyUnicode_GetSize_PyUnicode_AsUnicodePyUnicode_DecodeUTF32StatefulPyUnicode_DecodeUTF32PyUnicode_DecodeUTF16StatefulPyUnicode_DecodeUTF16PyUnicode_DecodeUTF7StatefulPyUnicode_DecodeUTF7_PyUnicode_EncodeUTF7_PyUnicode_EncodeUTF32PyUnicode_AsUTF32String_PyUnicode_EncodeUTF16PyUnicode_AsUTF16String_PyUnicode_AsUTF8StringPyUnicode_AsEncodedStringPyUnicode_EncodePyUnicode_EncodeFSDefaultPy_FileSystemDefaultEncodingPy_FileSystemDefaultEncodeErrorsPyUnicode_FSConverterPyUnicode_AsUTF8AndSizePyUnicode_AsUTF8PyUnicode_EncodeUTF8PyUnicode_DecodeUTF8StatefulPyUnicode_FromFormatVPyUnicode_FromFormatPyUnicode_DecodePyUnicode_FromEncodedObjectPyUnicode_DecodeFSDefaultAndSizePyUnicode_DecodeFSDefaultPyUnicode_FSDecoderPyUnicode_DecodeUTF8PyUnicode_DecodeLatin1_PyUnicode_FastFill_PyUnicode_DecodeUnicodeEscapePyUnicode_DecodeRawUnicodeEscapePyUnicode_FindCharPyUnicode_AsUnicodeEscapeStringPyUnicode_AsRawUnicodeEscapeStringPyUnicode_EncodeUnicodeEscapePyUnicode_EncodeRawUnicodeEscapePyUnicode_Fill_PyUnicode_DecodeUnicodeInternalPyUnicode_TailmatchPyUnicode_EncodeLatin1_PyUnicode_AsLatin1StringPyUnicode_EncodeASCII_PyUnicode_AsASCIIStringPyUnicode_DecodeASCIIPyUnicode_DecodeCharmapPyUnicode_BuildEncodingMap_PyUnicode_EncodeCharmapPyUnicode_AsCharmapStringPyUnicode_TranslateCharmapPyUnicode_TranslatePyUnicode_TransformDecimalToASCIIPyUnicode_EncodeDecimal_PyUnicode_TransformDecimalAndSpaceToASCII_PyUnicode_InsertThousandsGroupingPyUnicode_FindPyUnicode_Count_PyUnicode_JoinArrayPyUnicode_JoinwmemcmpPyUnicode_CompareWithASCIIString_PyUnicode_EQPyUnicode_SplitlinesPyUnicode_ComparePyUnicode_Contains_PyUnicode_EqualToASCIIString_PyUnicode_EqualToASCIIIdPyUnicode_RichComparePyUnicode_ConcatPyUnicode_AppendPyUnicode_AppendAndDel_PyUnicodeWriter_Init_PyUnicodeWriter_DeallocPyUnicode_ReplacePyUnicode_SplitPyUnicode_RSplit_PyUnicodeWriter_FinishPyUnicode_IsIdentifierPyUnicode_Substring_PyUnicode_XStripPyUnicode_PartitionPyUnicode_RPartition_PyUnicodeWriter_PrepareInternal_PyUnicodeWriter_PrepareKindInternal_PyUnicodeWriter_WriteChar_PyUnicodeWriter_WriteStr_PyUnicodeWriter_WriteASCIIString_PyUnicodeWriter_WriteLatin1String_PyUnicodeWriter_WriteSubstringPyUnicode_ClearFreeListPy_UNICODE_strlenPy_UNICODE_strcpyPy_UNICODE_strncpyPy_UNICODE_strcatPy_UNICODE_strcmpPy_UNICODE_strncmpPy_UNICODE_strchrPy_UNICODE_strrchr_PyUnicode_ToNumeric_PyUnicode_IsWhitespace_PyUnicode_IsLinebreak_PyUnicode_ToTitlecase_PyUnicode_TypeRecords_PyUnicode_ExtendedCase_PyUnicode_IsTitlecase_PyUnicode_IsXidStart_PyUnicode_IsXidContinue_PyUnicode_ToDecimalDigit_PyUnicode_IsDecimalDigit_PyUnicode_ToDigit_PyUnicode_IsDigit_PyUnicode_IsNumeric_PyUnicode_IsPrintable_PyUnicode_IsLowercase_PyUnicode_IsUppercase_PyUnicode_ToUppercase_PyUnicode_ToLowercase_PyUnicode_ToLowerFull_PyUnicode_ToTitleFull_PyUnicode_ToUpperFull_PyUnicode_ToFoldedFull_PyUnicode_IsCased_PyUnicode_IsCaseIgnorable_PyUnicode_IsAlpha_PyWeakref_GetWeakrefCount_PyWeakref_ClearRef_PyUnicode_FormatLongPyUnicode_Format_PyUnicode_Init_PyUnicode_FiniPyUnicode_InternInPlacePyUnicode_InternImmortalPyUnicode_InternFromString_Py_ReleaseInternedUnicodeStringsPyUnicode_AsUnicodeCopyPyInit__string_PyImport_InittabPyWeakref_NewRefPyWeakref_NewProxyPyWeakref_GetObjectPyObject_ClearWeakRefs_Py_FinalizingPyErr_WarnExplicitObjectPyErr_WarnExPyErr_WarnPyErr_WarnFormatPyErr_ResourceWarningPyErr_WarnExplicitPyErr_WarnExplicitFormat_PyWarnings_Init_Py_Module_Py_Interactive_Py_Expression_Py_Suite_Py_FunctionDef_Py_AsyncFunctionDef_Py_ClassDef_Py_Return_Py_Delete_Py_Assign_Py_AugAssign_Py_AnnAssign_Py_For_Py_AsyncFor_Py_While_Py_If_Py_With_Py_AsyncWith_Py_Raise_Py_Try_Py_Assert_Py_Import_Py_ImportFrom_Py_Global_Py_Nonlocal_Py_Expr_Py_Pass_Py_Break_Py_Continue_Py_BoolOp_Py_BinOp_Py_UnaryOp_Py_Lambda_Py_IfExp_Py_Dict_Py_Set_Py_ListComp_Py_SetComp_Py_DictComp_Py_GeneratorExp_Py_Await_Py_Yield_Py_YieldFrom_Py_Compare_Py_Call_Py_Num_Py_Str_Py_FormattedValue_Py_JoinedStr_Py_Bytes_Py_NameConstant_Py_Ellipsis_Py_Constant_Py_Attribute_Py_Subscript_Py_Starred_Py_Name_Py_List_Py_Tuple_Py_Slice_Py_ExtSlice_Py_Index_Py_comprehension_Py_ExceptHandler_Py_arguments_Py_arg_Py_keyword_Py_alias_Py_withitemPyAST_mod2objPyAST_CheckPyInit__astPyAST_obj2mod_Py_asdl_seq_new_Py_asdl_int_seq_newPyAST_ValidatePyAST_FromNodestrstrPyAST_FromNodeObjectPyEval_GetCallStats_PyEval_SetSwitchInterval_PyEval_GetSwitchIntervalPyEval_ThreadsInitialized_PyEval_SignalAsyncExc_PyEval_SignalReceivedPy_GetRecursionLimitPy_SetRecursionLimitPyEval_EvalFrameExPyEval_EvalFrame_PyBuiltin_InitPy_OptimizeFlagpthread_mutex_initpthread_cond_init_Py_CheckRecursiveCallpthread_mutex_lockpthread_cond_signalpthread_mutex_unlockpthread_cond_waitPyEval_ReleaseLockgettimeofdaypthread_cond_timedwaitPyEval_AcquireLockPyEval_InitThreads_PyEval_FiniThreadspthread_cond_destroypthread_mutex_destroyPyEval_AcquireThreadPyEval_ReleaseThreadPyEval_SaveThreadPyEval_ReInitThreadsPyEval_RestoreThreadPy_AddPendingCallPy_MakePendingCallsPyEval_EvalCode_PyEval_EvalFrameDefaultPyEval_SetProfilePyEval_SetTrace_PyEval_SetCoroutineWrapper_PyEval_GetCoroutineWrapper_PyEval_SetAsyncGenFirstiter_PyEval_GetAsyncGenFirstiter_PyEval_SetAsyncGenFinalizer_PyEval_GetAsyncGenFinalizerPyEval_GetFrame_PyThreadState_GetFramePyEval_GetBuiltinsPyEval_GetGlobalsPyEval_MergeCompilerFlagsPyEval_GetFuncDescPyCompile_OpcodeStackEffectPyEval_EvalCodeEx_PyFunction_FastCallKeywords_PyEval_CallTracing_PyEval_GetBuiltinIdPyEval_GetLocalsPyEval_CallObjectWithKeywordsPyEval_GetFuncName_PyFunction_FastCallDict_PyEval_SliceIndex_PyEval_SliceIndexNotNone_PyEval_RequestCodeExtraIndex_Py_ManglePyAST_CompileObjectPyAST_CompileExPyNode_CompileAnnotateRWLockCreateAnnotateRWLockDestroyAnnotateRWLockAcquiredAnnotateRWLockReleasedAnnotateBarrierInitAnnotateBarrierWaitBeforeAnnotateBarrierWaitAfterAnnotateBarrierDestroyAnnotateCondVarWaitAnnotateCondVarSignalAnnotateCondVarSignalAllAnnotatePublishMemoryRangeAnnotateUnpublishMemoryRangeAnnotatePCQCreateAnnotatePCQDestroyAnnotatePCQPutAnnotatePCQGetAnnotateNewMemoryAnnotateExpectRaceAnnotateBenignRaceAnnotateBenignRaceSizedAnnotateMutexIsUsedAsCondVarAnnotateTraceMemoryAnnotateThreadNameAnnotateIgnoreReadsBeginAnnotateIgnoreReadsEndAnnotateIgnoreWritesBeginAnnotateIgnoreWritesEndAnnotateIgnoreSyncBeginAnnotateIgnoreSyncEndAnnotateEnableRaceDetectionAnnotateNoOpAnnotateFlushStateRunningOnValgrindgetenvPyErr_RestorePyErr_FetchPyErr_ClearPyErr_GetExcInfoPyErr_SetExcInfoPyAST_Compile_PyCodecInfo_GetIncrementalDecoder_PyCodecInfo_GetIncrementalEncoderPyErr_OccurredPyErr_FormatVPyErr_SetObjectPyErr_FormatPyCodec_BackslashReplaceErrorsPyCodec_IgnoreErrorsPyCodec_ReplaceErrorsPyCodec_XMLCharRefReplaceErrorsPyCodec_NameReplaceErrors_PyErr_SetKeyErrorPyErr_SetNonePyErr_NoMemory_PyCodec_ForgetPyErr_SetStringPyCodec_RegisterErrorPyCodec_LookupErrorPyCodec_StrictErrorsPyErr_BadArgumentPyCodec_Register_PyCodec_LookupPyCodec_KnownEncodingPyCodec_IncrementalEncoderPyCodec_IncrementalDecoderPyCodec_StreamReaderPyCodec_StreamWriterPyCodec_DecoderPyCodec_DecodePyCodec_EncoderPyCodec_EncodePyErr_SetFromErrnoWithFilenameObjectsPyErr_SetFromErrnoWithFilenameObjectPyErr_SetFromErrnoWithFilenamePyErr_SetFromErrnoPyErr_SetImportErrorSubclassPyErr_SetImportError_PyErr_BadInternalCallPyErr_NewExceptionPyErr_NewExceptionWithDocPyErr_WriteUnraisablePyErr_GivenExceptionMatchesPyErr_ExceptionMatches_PyCodec_LookupTextEncoding_PyCodec_EncodeText_PyCodec_DecodeTextPyErr_NormalizeException_PyErr_ChainExceptions_PyErr_FormatFromCausePyErr_ProgramTextPyErr_ProgramTextObjectPyErr_SyntaxLocationObjectPyErr_SyntaxLocationExPyErr_SyntaxLocationPy_FrozenMainPy_FrozenFlagPy_IgnoreEnvironmentFlagsetlocalesetbufPyFuture_FromASTObjectPyFuture_FromASTPyArg_Parse_PyArg_Parse_SizeTPyArg_ParseTuple_PyArg_ParseTuple_SizeTPyArg_VaParse_PyArg_VaParse_SizeTPyArg_ParseTupleAndKeywords_PyArg_ParseTupleAndKeywords_SizeTPyArg_VaParseTupleAndKeywords_PyArg_VaParseTupleAndKeywords_SizeTPyArg_ValidateKeywordArguments_PyArg_ParseTupleAndKeywordsFast_PyArg_ParseTupleAndKeywordsFast_SizeT_PyArg_ParseStack_PyArg_ParseStack_SizeT_PyArg_VaParseTupleAndKeywordsFast_PyArg_VaParseTupleAndKeywordsFast_SizeT_PyArg_FiniPy_GetCompilerPy_GetCopyrightPy_GetPlatformPyImport_GetMagicTag_PySys_ImplCacheTagPyOS_strtoulPyOS_strtolPyOS_vsnprintf__vsnprintf_chkPyOS_snprintfPyArg_UnpackTuple_PyArg_NoKeywords_PyArg_NoPositionalPy_GetVersion_PyImport_DynLoadFiletabPyImport_FrozenModulesPyImport_GetModuleDict_PyImport_Init_PyImportHooks_Init_PyImport_AcquireLock_PyImport_ReInitLock_PyImport_ReleaseLock_PyImport_FiniPyImport_CleanupPyImport_GetMagicNumber_PyImport_FixupExtensionObject_PyImport_FixupBuiltinPyImport_AddModuleObject_PyImport_FindExtensionObject_PyImport_FindBuiltinPyImport_AddModulePyImport_ExecCodeModuleObjectPyImport_ExecCodeModuleWithPathnamesPyImport_ExecCodeModulePyImport_ExecCodeModuleExPyImport_GetImporterPyImport_ImportModuleLevelObjectPyImport_ImportModuleLevelPyInit_impPyImport_ExtendInittabPyImport_AppendInittabPyMarshal_WriteLongToFilePyMarshal_WriteObjectToFilePyMarshal_WriteObjectToStringfread__memcpy_chkPyMarshal_ReadObjectFromFilePyMarshal_ReadObjectFromStringPyImport_ImportFrozenModuleObjectPyImport_ImportFrozenModulePyMarshal_ReadLastObjectFromFilePyMarshal_ReadShortFromFilePyMarshal_ReadLongFromFilePy_BuildValuePyImport_ImportPyImport_ImportModule_PyImportZip_InitPyImport_ImportModuleNoBlockPyImport_ReloadModule_Py_BuildValue_SizeTPy_VaBuildValue_Py_VaBuildValue_SizeTPyEval_CallFunctionPyEval_CallMethodPyModule_AddObject_PyImport_LoadDynamicModuleWithSpecPyModule_AddIntConstantPyMarshal_InitPyModule_AddStringConstant_Py_M__importlib_external_Py_M__importlib_Py_HashPointer_Py_HashSecretPyFPE_dummy_Py_HashDouble_Py_HashBytes_PyHash_FiniPyHash_GetFuncDefPy_IsInitializedPy_SetProgramNamePy_GetProgramNamePy_SetPythonHomePy_GetPythonHome_Py_PyAtExitPy_AtExitPy_FdIsInteractivePy_InteractiveFlagPyOS_getsigsigactionPyOS_setsigsigemptyset_Py_RestoreSignals_Py_get_387controlword_Py_set_387controlwordPyState_FindModulePyThreadState_Clear_PyThreadState_UncheckedGetPyThreadState_SwapPyInterpreterState_HeadPyInterpreterState_NextPyInterpreterState_ThreadHeadPyThreadState_Next_PyGILState_GetInterpreterStateUnsafePyParser_ClearError_PyTime_FromSeconds_PyTime_FromNanoseconds_PyTime_AsSecondsDouble_PyTime_AsMilliseconds_PyTime_AsMicroseconds_PyTime_AsTimeval_noraise_PyTime_AsTimespec_PyTime_GetSystemClockclock_gettime_PyTime_GetMonotonicClock_PyRandom_FiniPyArena_FreePyArena_MallocPyArena_AddPyObjectPyArena_NewPyModule_GetWarningsModulePy_SetStandardStreamEncodingPyThreadState_GetDict_PyTime_AsTimeval_PyTime_AsTimevalTime_tPy_UnbufferedStdioFlagPyInterpreterState_Clear_PyThreadState_DeleteExceptPyGILState_GetThisThreadStatePyGILState_Check_PyGILState_check_enabled_PyState_AddModule_PyState_ClearModulesPyThreadState_SetAsyncExc_PyThread_CurrentFrames_PyGILState_FiniPyErr_DisplayPy_FatalErrorabortnl_langinfoPy_HasFileSystemDefaultEncodingPyInterpreterState_New_PyThreadState_InitPyThreadState_New_PyThreadState_PreallocPyState_RemoveModulePyThreadState_DeletePyInterpreterState_DeletePy_FinalizeEx_PyParser_GrammarPy_FinalizePy_ExitPy_EndInterpreterPyThreadState_DeleteCurrentPyThreadState_Get__PyCodeExtraState_Get_PyGILState_Init_PyGILState_ReinitPyGILState_EnsurePyGILState_ReleasePyParser_ASTFromStringObjectPyRun_StringFlagsPyRun_StringPy_CompileStringObjectPy_CompileStringExFlagsPyCompileStringPy_CompileStringPy_CompileStringFlagsPy_SymtableStringObjectPy_SymtableStringPyParser_ASTFromStringPyParser_ASTFromFileObjectPyRun_FileExFlagsPyRun_FilePyRun_FileExPyRun_FileFlagsPyParser_ASTFromFilePyParser_SimpleParseFileFlagsPyParser_SimpleParseFilePyParser_SimpleParseStringFlagsPyParser_SimpleParseStringPyParser_SimpleParseStringFlagsFilenamePyParser_SimpleParseStringFilenamePyParser_SetErrorPyErr_PrintExPy_InspectFlagPyErr_PrintPy_NewInterpreterPy_NoSiteFlagPyRun_InteractiveLoopFlagsPyRun_InteractiveLoopPyRun_InteractiveOneObjectPyRun_InteractiveOneFlagsPyRun_InteractiveOnePyRun_SimpleFileExFlagsrewindPyRun_AnyFileExFlagsPyRun_AnyFilePyRun_AnyFileExPyRun_AnyFileFlagsPyRun_SimpleFilePyRun_SimpleFileExPyRun_SimpleStringFlagsPyRun_SimpleString_PyLong_AsTime_t_PyLong_FromTime_t_PyTime_AsNanosecondsObject_PyTime_ObjectToTimespec_PyTime_ObjectToTimeval_PyTime_ObjectToTime_t_PyTime_FromSecondsObject_PyTime_FromMillisecondsObject_PyTime_GetSystemClockWithInfoclock_getres_PyTime_GetMonotonicClockWithInfo_PyTime_Init_PyTime_gmtimegmtime_r_PyTime_localtimelocaltime_rgetrandom_PyOS_URandom_PyOS_URandomNonblock_PyRandom_InitPy_HashRandomizationFlag_Py_InitializeEx_PrivatePy_DontWriteBytecodeFlagPy_InitializeExPy_InitializePyCode_Optimize_Py_DisplaySourceLinePyMember_GetOnePyMember_SetOnePySys_GetXOptionsPySymtable_FreePyST_GetScopePySymtable_LookupPySys_AddWarnOptionUnicodePySymtable_BuildObjectPySymtable_Build_PySys_GetObjectIdPySys_GetObject_PySys_SetObjectIdPySys_SetObject_PySys_GetSizeOfPySys_ResetWarnOptionsPySys_AddWarnOptionPySys_HasWarnOptionsPySys_AddXOptionwcschrPySys_SetPathwcscmpwcsrchrwcsncpyPySys_SetArgvExPySys_SetArgvPy_IsolatedFlagPySys_WriteStdoutPySys_WriteStderr_PySys_Init_PySys_ImplNamePy_NoUserSiteDirectoryPy_QuietFlagPySys_FormatStdoutPySys_FormatStderrPyTraceBack_Here_PyTraceback_AddPyTraceBack_Print_Py_DumpDecimal_Py_DumpHexadecimal_Py_DumpASCII_Py_DumpTraceback_Py_DumpTracebackThreadsPyOS_mystrnicmp_PyOS_ResetGetOpt_PyOS_opterr_PyOS_optind_PyOS_optarg_PyOS_GetOptPyOS_mystricmp_Py_dg_stdnan_Py_dg_infinity_Py_parse_inf_or_nan_Py_fstat_noraisefstat64_Py_write_noraisePyThread_init_threadPyThread_start_new_threadpthread_attr_initpthread_attr_setscopepthread_createpthread_attr_destroypthread_detachpthread_attr_setstacksizePyThread_get_thread_identpthread_selfPyThread_exit_threadpthread_exitPyThread_allocate_locksem_initperrorPyThread_free_locksem_destroyPyThread_acquire_lock_timedsem_trywaitsem_timedwaitsem_waitPyThread_release_locksem_postPyThread_acquire_lockPyThread_create_keypthread_key_createpthread_key_deletePyThread_delete_keyPyThread_delete_key_valuepthread_setspecificPyThread_set_key_valuePyThread_get_key_valuepthread_getspecificPyThread_ReInitTLSPyThread_get_stacksizePyThread_set_stacksize__sysconfPy_GetArgcArgv_Py_dg_freedtoa__strcpy_chk_Py_string_to_number_with_underscores_Py_dg_dtoa_Py_dg_strtodPyOS_string_to_doublePyOS_double_to_string_Py_strhex_Py_strhex_bytes_PyUnicode_FormatAdvancedWriter_Py_device_encodingPy_DecodeLocale_Py_wgetcwd_Py_DecodeLocaleExPy_EncodeLocale_Py_wreadlink_Py_wrealpath__realpath_chk_Py_EncodeLocaleEx_Py_dupfcntl64_Py_fstat_Py_get_inheritableioctl_Py_set_inheritable_Py_set_inheritable_async_safe_Py_open_noraise__open64_2_Py_open_cloexec_works_Py_wfopenfopen64_Py_fopen_Py_get_blocking_Py_set_blocking_Py_stat_Py_open_Py_read_Py_write_Py_fopen_obj_Py_GetLocaleconvNumericlocaleconv_PyFloat_FormatAdvancedWriter_PyLong_FormatAdvancedWriter_PyComplex_FormatAdvancedWriter_PyImport_FindSharedFuncptrdlsymdlopendlerrorPyThread_GetInfoconfstrPy_SetPathwcscpy__wcscpy_chkfseekwcstokwcscatwcsncat__wcsncpy_chkPy_GetPathPy_GetPrefixPy_GetExecPrefixPy_GetProgramFullPathPy_Mainstrtoksetvbuf_PyOS_mystrnicmp_hackPyObject_GC_Del_PyGC_FiniPyObject_GC_UnTrackPyObject_GC_Track_PyGC_CollectNoFailPyInit_gcPyGC_Collect_PyGC_CollectIfEnabled_PyGC_DumpShutdownStats_PyGC_Dump_PyObject_GC_Malloc_PyObject_GC_New_PyObject_GC_Calloc_PyObject_GC_NewVar_PyObject_GC_ResizeclosedirgetpidqsortPyInit__thread_PyLong_FromUidgeteuid_PyLong_FromGidgetegidgetgid_Py_Uid_Converter_Py_Gid_ConverterPyOS_FSPathsched_yieldgetgrouplistinitgroupssched_setschedulersched_setparamctermidrenamerenameatexecvsetgroupslstat64readlinkatsendfile64readdir64faccessataccessfchdirfchmodatfchmodchrootfsyncfdatasyncfchownlchownfchownatmkdiratmkdirgetprioritysetpriorityunlinkatrmdirsched_get_priority_maxsched_get_priority_minttynameniceumasksched_getschedulersched_getparamsched_rr_get_intervalfdopendirrewinddirsystemutimensatfutimensfexecveforkforkpty__sched_cpuallocsched_setaffinity__sched_cpufreesched_getaffinity__sched_cpucountopenpty__ctype_toupper_locsetsidgetpgidgetppidgetlogingetuidkillpgsetreuidsetregidsetpgidtcsetpgrpsetresuidsetresgidsetuidseteuidsetegidsetgidgetsidtcgetpgrplockf64wait3wait4mkfifoatmkfifomknodatmknodposix_fallocate64posix_fadvise64fstatvfs64waitidfpathconfwaitpidpipe2getloadavggetresuidsymlinkatsymlinktimesopenat64dup2dup3pipepread64writevreadvpwrite64putenvunsetenvgetresgidfgetxattrlgetxattrfsetxattrlsetxattrfremovexattrlremovexattrsyscallflistxattrllistxattrsetpwentgetpwentendpwentPyInit_pwdPyInit_posix__environgetpwuidPyInit_errnogetpwnamPyInit__srePyInit__codecsPyInit__weakrefPyInit__operatorPyInit__functoolsPySignal_SetWakeupFdPyInit__collectionsPyInit_itertoolssigaddsetPyInit_atexitalarmPyOS_InterruptOccurred_PyOS_IsMainThreadPyOS_FiniInterruptssiginterruptsigwaitsetitimergetitimerPyErr_SetInterruptsigismembersigpendingPyInit__signal__libc_current_sigrtmin__libc_current_sigrtmaxPyErr_CheckSignalspausepthread_killsigwaitinfoPyOS_InitInterruptsPyOS_AfterFork_PyFileIO_closedPyInit__statclockgetrusageclock_settimeselectmktimewcsftimetzsetPyInit_timewcscolldcgettextbind_textdomain_codesetwcsxfrmbindtextdomainPyInit__localePyNumber_AsOff_t_PyIO_ConvertSsize_t_PyIO_get_module_state_PyIO_Moduleftruncate64_PyIO_get_locale_modulePyInit__io_PyBytesIOBuffer_TypePyStringIO_Type_PyIO_str_close_PyIO_str_closed_PyIO_str_decode_PyIO_str_encode_PyIO_str_fileno_PyIO_str_flush_PyIO_str_getstate_PyIO_str_isatty_PyIO_str_newlines_PyIO_str_read_PyIO_str_read1_PyIO_str_readable_PyIO_str_readall_PyIO_str_readinto_PyIO_str_readline_PyIO_str_reset_PyIO_str_seek_PyIO_str_seekable_PyIO_str_setstate_PyIO_str_tell_PyIO_str_truncate_PyIO_str_write_PyIO_str_writable_PyIO_str_nl_PyIO_empty_str_PyIO_empty_bytes_PyIO_zero_PyIOBase_check_closed_PyIOBase_check_seekable_PyIOBase_check_readable_PyIOBase_check_writable_PyIOBase_finalize_PyIO_trap_eintr_PyIO_find_line_ending_PyIncrementalNewlineDecoder_decodegetrlimit64setrlimit64_Py_hashtable_hash_ptr_Py_hashtable_compare_direct_Py_hashtable_new_full_Py_hashtable_new_Py_hashtable_size_Py_hashtable_get_entry_Py_hashtable_set_Py_hashtable_get_Py_hashtable_pop_Py_hashtable_foreach_Py_hashtable_clear_Py_hashtable_destroy_Py_hashtable_copy__wcscat_chkPyInit_faulthandlerPyInit_zipimportpthread_sigmasksigfillset_PyTraceMalloc_Untrackfstatat64unlink_PyFaulthandler_Finisigaltstack_PyFaulthandler_Init_PyTraceMalloc_TrackPyInit__tracemalloc_PyTraceMalloc_GetTraceback_PyMem_DumpTraceback_PyTraceMalloc_Fini_PyTraceMalloc_InitPyInit__symtablePyInit_xxsubtypesigtimedwaitgetgroupsuname_Py_maketrans__doc__Py_UseClassExceptionsFlaglibm.so.6libc.so.6libpython3.6m.so.1.0GLIBC_2.29GLIBC_2.2.5GLIBC_2.14GLIBC_2.7GLIBC_2.6GLIBC_2.28GLIBC_2.25GLIBC_2.4GLIBC_2.33GLIBC_2.3GLIBC_2.17GLIBC_2.3.4GLIBC_2.32GLIBC_2.34GLIBC_2.3.2GLIBC_2.9/opt/alt/python36/lib64:/opt/alt/sqlite/usr/lib64:/opt/alt/openssl11/lib64                                       0 ;ui FRii ]ii gq|ii  ii  ti ȓri ӓii ߓui Fp% x%%%%N%7%%!Ș%W%!%W%qQ%` %N0%78%P%qQX%`p%!x%W%!%W%Dș% DЙ% ؙ% %)!%D%K%K%K %x!(%jP0%K8%Wi@%sjH%j`%^h%p%%}%%z%_ %%"%}%}%}Ț%К% ؚ%%%}%}%t%%%}%4 %M(%}0%8%@%PH%P%X%4`%h%Tp%}x%}%}%}%}%}%}%}%}%}%}ț%}Л%}؛%}%}%}%}%}%}%}%% %(%}0%}8%c@%H%'P%}X%59`% h%8p%xx%%6%6%Q7%7%d%%|%*%Ȝ%М%}؜%a%% %^!%"%"%"%#%g$ %4(%N0%8%g@%H%1P%2X%+`%,h%,p%8-x%%a%%}%}%%3%.%W/%ȝ%CН%؝%Q%~%%-%%.%(%.)%)%@* %*(%}0%}8%Z3@%H%?P%X%}`%h%p%$x%%%}%}% %4%%%'%}%%~Ȟ%О% ؞%}%}%z % % % % %%4 %(%&0%8%~@%?H%P%X%`%0h%/p%"x%}%}%}%}%}%}%}%}%}%}ȟ%}П%}؟%}%}%}%}%}%}%}%}%} %}(%}0%}8%}@%}H%}P%}X%}`%}h%}p%}x%}%}%}%}%}%}%}%}%}%}Ƞ%}Р%}ؠ%}%}%}%}%}%}%}%}%} %}(%}0%}8%}@%}H%}P%}X%}`%}h%}p%}x%}%}%}%}%}%}%}%}%}%}ȡ%}С%}ء%}%}%}%}%}%}%}%}%} %}(%}0%}8%}@%}H%}P%}X%}`%}h%}p%}x%}%i%%j%%k!%%Ȣ% Т%آ%%% %%ʾ%%%&%Wi %@%fH%P%5X%!`%{!h%!p%!%g!%k!% % % %7%&!У%&!%&!%% %F! %vS!@%H%$!P%R!X%&!`%%!p%x%&!%%&!%&!%Ȥ%&!%%!%!%&!%&! %%!(%!0%&!8%&!`%&!h%&!p%aQ!%&!%&!%%K%&!%%%!%!%&!%&!%%! %(%fS!0%%R!@%y!H%fS!P%%R!`%h%fS!p%%R!x%&!%%!%y!%y!%%y!Ȧ%K%%K%&!%%!%y! %@%H%KP%&!X%&!`%%!p%x%&!%%&!%%!% !ȧ%Wi%%%%! %(%0%%!@%H%P%xX%Wi`%%!%%%%!%y!%%JШ%%vS!%vS!%vS!%vS! %vS!0%vS!@%vS!P%X%fO%%K%Q!%&!%ȩ%KЩ%&!%y!%y!%UT!%6F! %y!@%H%WiP%KX%&!%%!%!%YT!%&!%_S!% Ъ% %_S!%BF!%T!%T!%T! %T!(%T!0%T!8%T!@%T!H%T!P%T!X%U!`%U!h%"U!p%/U!x%>U!%JU!%VU!%aU!%nU!%{U!%U!%U!%U!%U!ȫ%U!Ы%U!ث%U!%H%7% %H(%70%@%a!P%`%p%a!%a!%Wi%`!%%!%b!%b!%a!%b!%%%b!%% %(%W0%x!@%H%a!P%a!`%h%a!p%a!%%a!%a!%x!%ȭ%a!Э%a!ح%a!%%a!%a!%a!@%H%a!P%a!X%a!%c!%)c!%7c!%Ac!%Nc!Ю%Xc!%cc!%nc!%wc! %g!@%٪H%KP%xX%!%٪%K% %7%%u!%x%!%܌!%!%!%! %!0%!@% !P%ڌ!`%!p%!%!%!%!% !%!а%!%$!%,!%4!% &A &> &E 8&H &L && & & && (& 8& &`&&F& &x&H& (&H0&p P&HX& x&H&0} &H&p &H`&& h& &H& &$&&H&0 &@$&&H& &$&&H & 0&#&@&H& X&`#&h&Hp& &#&&H&0 &"&&I& & "&&I&л &!&&I&` &!&0& I8& H&`!&X&I`& p& !&&P!&l &`&&&-I&p &&&&p& &%& &5I(& 8&@%&@&K&`~ &(y&HK&0 &`y&RK& &y&\K& &`?&&l& &>& &p(& 8&=&@&mKH& X&z`&ZGh&@ &xK& &`<&&S& &`:&&ߥ& &:&&` &@ & & &p (& 0& ~ 8&`~ @&@~ H&p &0 &`~ &p & &K(&P 8&KH&7P&` `&Kp&Kx&`) &K&#W!&@ &qQ&K&@ &qQ&K&p- &qQ &E!(&`| 8&qQ@&E!H&z X&qQ&H&` &T &L&H&p &@U &xz&/L& &z &KH&X&E&`&ZGh&P&ߥ&&@E&&&&&&@&&P&&p&@&P&Х&p&&M&M0&MX&M&M&N&N&N &NH&'Np&3N&&?N&GN&VN`&OGh&&H&0&J &8|`&Hh&&J&8|&H&p|@&& H&P&oN&0&rF&&F&&& &`&`F& &F(&`8& F&`&Fp&x&C&&2&&&@' s 'rF('P8'X&@'& H'X'p&`'Fh'x'X&'P'-'`.'''r'N 'N('HH'|P'Np'|'N' '` 'N'w'$ 'N '& ('p& 8'N@'OH' X'q&`'!Oh' x'@q&'ߥ'& '3O'OG'0 '}'F' '8}'4K' 'x('9K0'`Y @'yP'LOX' h'}x'VO'pY '}'>K' '}'bO' 'x& '=('` 8'u&@'RH' X' s&`'HKh' x'(~'mO' 'P~'wO' 'x~'RK' '~'ZG' 'ߥ' 'OG('R 8'`'V h'pW p' x'` '` '@ 'p ' 'С 'G 'PX 'P ' '@ ' ' ' ' H' P' h' 'H' ' 'H' 'й 'O'p ' 'H '  'p 'O( ' 0 ' H 'P ' p 'Hx ' ' 'H ' 'O( 'OP 'Ox 'O 'O 'O 'O@ 'OH '0 X '(` 'Oh ' x '` 'P ' ' 'E ' ' '[ '0 '( 'F 'P 'h 'OG '  ' '@0 '0 '0 ' 'P' ' '{!''P'FP(''6H0>'` >'D >'&?':H@'3 @' &@'`O XA'{!pA' A' K A'`&A'&A'&A' A'@&B'I B'R (B'@&0B'&xB' B'VHC' 8C'1 C'&D'`HD' D' hE'&E'@ 8F'sHPF' xF'0 F'&F'~ F'~ F'` G' &G'&HG' XG'0 G' G' H' PH'P pH'&xH'} H'@~ H'&H'`&H'p xI'HK'0K'o XK'0 hK'&pK'&xK' K'&K'&K'P K'p K'P K'&K'&8L'0w L'TIL'm XM'0 `M'Pn @N'N'IN'c N'Y O' &PO'&XO'0 `O'p hO'O xO'G O'`&O'@N'O'f XP'IQ'G (Q'@&Q'IR'H R'&S'IXT'0H hT'&8U'IPU' U' V'p\ V'&V'IV' W'0R (W'@&xW' W'PF W' ,xX'IX' X'0R X'Z'X'&Y' (Y'K 8Y' F HY'&Z'R pZ'T xZ'T 8['IP[' x['0R ['Z'['&[' ['K ['E \'@&\'I\'@ x]'0 ]' ]'&x^'I^'@ _'0 @_' H_'&`' J0`'@ `'0 `'p; `'&b'i0b' Xb' hb'a'pb' &b' &b' b' b'> b'E b'@&(c' 8c'p c'Uc' c' d'@&d' &Pd'&Xd' `d' hd'p+ xd' d'@&d'  Xe'6Jpe'@ e' f' (f'&f'KJg'p g' g' g' &h'YJh' 8i'p `i'0 hi'&8j'@HPj' j'P k' k'&k'kJk' k'Xl'Jpl' l'&l' m' 0m'`&8m'k'Pm' hm' m'kJm'p n'xn'Jn'P o' &o' o'0 Po'&Xo'm'po' o' p'Jp' p' (p'J0p' 8p' Pp'JXp' `p' xp'Jp' p' p'p'Hp'Щ p' p'Hp' q' Xq'pq' q' q' q'&q'P 0r' &8r'p'Pr' xr' r'-s' s' s'P s'&s'&s'&t'Kt'& hu'&xu' &u'V u' Xv'Kpv' v'v'v'@zv' w'b w'Kx' x' y'Ly'A&y'Ly'j y'A&y'#W!y' ^ y'@&z'L0z' S Xz'% z' z'a z'y'z' &z'&{'L{'B&{'L{'j {' B&{'#W!{' ^ {'A&8|'dLP|' S p|'&x|'% |' }'{'}'`&}'&}'L~' 0~'}'~' ~'`c ~' &'L'@ 'p'X' 'n '&X'!p' '{' 'a (' &'s 'M0' S P'Ђ'X'% ' '&'@&'&'8Є'0P'&X'' '`&؅'` X'Mp'' &'p ' ('&x'` '!M'8'Т`'`'Ȉ'&Ј'`&؈' &''4M'؉'8'p'`&x'&''8'FMP'x'؋''&'`&'@&0'`8' ،'XM''P@'x''&'`&'&Ѝ'0x']M''P''H'&P'`&X'&p''|M0'X'0x'''PȐ''&' &' &'Б'@''&'&('X'h'@x''&ؒ'X'+p''&'`'Ў('@&0'`&8'&P'pX'h' ''8'@'&X'h''&'ȕ'@&Е'&''`!'ؖ''0'@&H'h'`&p'&'08'`NP'x''' И' &ؘ'`'@'&'&0'X'pؙ'Q''8'@'@P'pp'`&x''p'@&'&'`&К'P'Јx'-'@'' '('X'&'}N0''''&'ZG''FȞ':'H'.''F 'G!('8'V&@'FH'F`'h'@;'F'0F'l'{'U&'pȟ'`؟'`U&'B'PF'#G'`9 'G('@9@' GH'9`'Fh'9'F' 9'F'9'FȠ'9'F'9'`T&'J', 'F(':@'KH'@X'S&`'.h'x'R&'Џ''Q&'(!''O&'Fȡ'pF'F'F'K'- 'ݏ(' 8'N&@'یH' X' L&`'Kh'0x'K&'b!''I&'̌'*'I&'FȢ'F'K''@H&'F'; 'F(':@'H'LX'F&`'Fh'@:'l'0أ''p'P@ ''('&0'p&8'CH'`@`'`&p'&'@'`'''x'N''P@'H' ''N'~'p& '& ('8'p&@'wH'X'@p&`'OGh'p~x'o&'''`o&'F' 'Hȧ''k!'p' o&'G'p'n& '('@~@'G!H'X'l&`'Fh'v''''J''l&'FȨ'@x'l'' k&'p'0'j& 'B('x@'vH'X'i&`'#Gh'2'G' 2' G'@3'Fȩ'3'F'1'F'5 'F('4@'FH'X'h&`'Jh''F'д'K'P'@h&'.Ȫ' wت' g&'Џ''`e&'''`d& 'Z(!('8'c&@'(!H'X'b&`'.Jh'.x'@b&'F'@y'F'y'Kȫ'@'ݏ''``&'ی''`^& 'K('8']&@'b!H'X' \&`'̌h'px'@[&'F'v'K'p'Z&'FȬ''F''' ' Y& 'F('@@'lH'p'`.'`'''@n'ȭ' 'z-'' 8'b p's '&'( Ю'''k '@u '!'` د' 'p 0'h}H' h''x'''` '@ X'p'p ' ' б' ر'0 '&' '@ ('@ '0' '8''h' x'` '@ '8'h@'@ 'h'h'&'@i'sP' ش' '` '' 'H'P'@X'`p'Px'p' 'P'''P'Pȶ'pж'0ض'P8'2QP'px'`'ез'ط'''@'''' 'H' X'ظ'ý' ' '&8'` H' p'&' '&'&'0 x'ы''''Ⱥ''к'''@'''&('8'H''''Q0' X'@ x'@ '| ȼ'`} '`&'&'&'н'PF 'o '`''F ('o P'&h'P ''''ؾ' X'PKp'`{ ''&'@2''&'@ȿ'P'@|&'('&x'8'AP'p''' '`&H' X''x'g8'~P'''0''' ''H'''pp'x''''' 'P'`' 'h''x!'7'''Ɍ'%'!b!'%@'׌H'%''%''%'`!' '('[H'Eh'Nx'''O'I'I'M'''' ' '(' '@'@'H'@'h'H'w'H'QF'x!'7'''QF@'ɌH' %'!b!'0%''P%'׌'p%@'H'%''''pP'ɦX'`''''P X'p'p'p''@''h' x'''''J 'J('H'IH`'h'!E'H'M'!'M''w'i'G('IH'Ih'M'M'w'H'4K'9K'@''@'{E`'h'J''''& ' '`!@'-Px'K'E!'ZC'2W!'L'#W!('@'X'p'p'''@''h'P '''|'p'˫'''''P p'''l'p0'ޫ8'@''''P ' '8'[P'p''' ''H'P '''H'pp'x'''''P P'`'x'6'p'и' '`'''P '''$0'p' ''''('P ''''pP'X'`''''P 0'@'X'p'p'2''@'`'h'P ''''p'D'''`''P p'''ѩ'p0'X8'@''`''P ' '8'P'p'l'' ''H'P ''''pp'x'''`''P P'`'x''p'' '`'''P '''u0'p''''`&(' 8''''f'pP'(X'`''`&' '0'@'X'Xp'p'''@'`&h' x''''J'p'й'''`&' 'p''';'p0'(8'@''`&' '' '8'-P'p'`'' '`&H' X'''''pp'x'''`&' 'P'`'x''p'' '`'`&' ''''0'p'''''(' 8'''''pP'@X'`'''' '0'@'X'֨p'p'''@''h' x'''h'p( ''0'P'&'`&'$ '''' & 0'ͬ8'0@'Pp'&'`&'# '( (8(P(p(P((( (@&H( ((((Pp(hx((@(`((` P(`(x((P(( (@`(&(` (((x0(p((((((( 8((((n(pP(X(`(('( (0(@(X(Zp(p(( (@ (@'h ( x ( ( ( (K (p (+ ( ( (@' (  (p ( ( (B (p0 (E8 (@ ( (' (  ( ( (8 (P ( (^ (@ (` ((H( (((l(H(p(x(@(`('(@'('( P(`(x( (p(p( (`( '( ((((0(((((( '( '((((((pP(PX(`(( '( (0(@(X(ߧp(p(p((@('h( x(('('(+(!(((a(X(i((J!((t((|(h (((0(8(@(H(P(X(`(h((N8(>(.J(`!(P(J((( ((((0((@(`!(o(~((@(H(`(P((`(h(p((fO(((`!((!(I(M(I0(>8(P(`(>h((>((I(((x(H((H(Hh($H(M( ( `4(Kh4(`hx4(K4(x4(h4(4(K4(h4(K5(R!(5(!5()!5(и5($(5(5(5(#(5(!5(5(#(5(E!5(5("(6(!6(6( ( 6((6(]86( (@6(V!H6(`X6( (`6(#W!h6(x6((6(6(06(@(6(1!6(`g6((6(Ț!6(g6((6(K6(\6(`(7(E!7(h7(( 7((7(@7(H7(Ё7(K7(G7(7(1!7(N7(3(8(8(N8(@3( 8(Ț!(8(`N88(2(@8(#W!H8(OX8(2(`8(Kh8(Ox8(`2(8(E!8(PO8(1(8(8(08(1(8(E!8(8(@1(8(8(8(`0(9(r!9(9(/( 9(!(9(89(.(@9(ZCH9(X9(-(`9(!h9(Px9(,(9()!9(9(,(9(9(09(+(9(9(P9(@+(9(!9(9(*(:(V!:(p:( )( :((:(@:(FH:(p`:(OGh:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(;(:(;(:(;(;(;(;( ;(;((;(;(0;( ;(8;( ;(@;(0;(H;(0;(P;(@;(X;(@;(`;(P;(h;(P;(p;(`;(x;(`;(;(p;(;(p;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(<(;(<(;(<(<(<(<( <(<((<(<(0<( <(8<( <(@<(0<(H<(0<(P<(@<(X<(@<(`<(P<(h<(P<(p<(`<(x<(`<(<(p<(<(p<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(=(<(=(<(=(=(=(=( =(=((=(=(0=( =(8=( =(@=(0=(H=(0=(P=(@=(X=(@=(`=(P=(h=(P=(p=(`=(x=(`=(=(p=(=(p=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(>(=(>(=(>(>(>(>( >(>((>(>(0>( >(8>( >(@>(0>(H>(0>(P>(@>(X>(@>(`>(P>(h>(P>(p>(`>(x>(`>(>(p>(>(p>(>(>(>(>(>(` >( >( >(Ё >(0 >( ?( ?( ?(0 ?(P P?( X?( `?(0 h?(P ?( ?(Ё ?(0 ?( ?( ?(Ё ?(0 ?( ?( ?(Ё ?(0 @( @(8@(FX@(Kx@(kJ@(QF@(@(H@(J@(A(8A(HXA(HxA(A("A(-A(HA(HB(H8B(wPB(XB(HB(B(B(p0C(%(8C(F@C(GhC(5(pC(5(xC(`4(C(C(F8D(PD( D(4(D(GD(HE(E(7(E(7(HE(XE( E(& E(Т F(F(F(F(0F(N88F(iXF(xF(F(F(F(F(F(p_ G(Ж H( H( HI(E(I(Н `t(7ht( xt(J(t(1 t(0t(`J(t(t(@t(J(u(: u(u(L( u()!(u( 8u(L(@u(ZCHu(PXu(K(`u(E!hu(xu( K(u(: u(u(Q(u()!u(Pu(`O(u(r!u(u(N(v(!v(@v(N( v(J!(v(8v(@N(@v(E!Hv(Xv(@M(v()!v(@v(R(v(v(v(R(v(!v(v(E!v( w(J(w(Hw(KPw( pw(1 xw(w(w(2w(t w(0w(0 x(7Hx(zpx( x(!y(: y(y(T( y(E!(y(Z8y(T(@y()!Hy(HXy(T(`y(ZChy(@Bxy(T(y(Ky(Cy(PT(y(#W!y(0Dy(0T(y(Ky(/y(T(y(y(P0y(S(z(1!z(0z(S( z(Ț!(z(018z(S(@z(E!Hz(1Xz(S(`z(hz(z(!z(_z(`S(z(z(gz(0S(z(V!z(z(S({(1 {(2`{(G!h{(Nx{(U({(!{(N{(PU({(!{(.{(0U({( {({(U(|(K|(`|()!h|(p|(W!|(|(r!|(|(!|(|(J!|(}(E!}( }(K(}(0@}(1!H}(P`}(Ț!h}(p}(#W!}(}(E!}(}(}(~(K~(P(~(J0~(PP~(KX~(~( ~(! (#W!((@(: H(`(h(`(1!(Щ(Ț!(@(K((E!( (( (((@(KH(`(!h(x( V((((V!((U(()!Ȁ( ؀(@W((r!( (W((!((V( (J!(( 8(V(@(ZCH(X(`V(`(W!h(x( W((E!((U((OG(p(K(P(J(P0(K8(( (!(#W!( (: ((@(H(``(Ț!h(@(K((E!( (ȃ((((E!((U( (V!((8(U(@(KH(`(!h(x( V((((OG(p(K(P(J(P0(K8(( (!(: ( (K((P@(#W!H(`(h(`(1!(Щ(K((E!Ȇ( (((( ()!(( 8(@W(@(W!H(X( W(`(r!h( x(W((!((V((J!( (V((ZCȇ(؇(`V((!(( V((( (V!((8(U(@(OGH(p(N(& Ȉ(ZG(I ([ ((f H(h(I(t ( ȉ( ((b}((OH( h( (( ( (( (p (0@(H( P( X(h( p(p (0ȋ(!O( (H(( H(h(O(H(HȌ(O(K(H ( @(qQX( x(qQ( (qQȍ( (qQ(I( d (K (h8( H(pg P(\ X(p((h (' (( (d (K Ȏ(( (l (J (8( ((l 8(qQP( `(`- h(U p(( (`- (K (( Џ(pb ؏(0M (( (pb (M (@0(nI@(pb H(0N P(ph(~Ix(pb (N (( (pb (0O (ؐ( (pb (O ((uI (m ((K 0(0H( X(- `(\ h(`(% (k (pV ((- ȑ(. Б(`W ؑ((5 (. (0P (@((x8(pi @(' H(`( p(_ ((@ (@o (L (qQВ(H (`e (K (`(R (f (K ((@(\ P(f X(K `( x(f (3 (J (P (n (3 ȓ(K Г( (w (5 (J (  ( 0(5 8(K @( X( h(6 p(J x( !( (6 (K (P!Ȕ( ؔ(9 (J (!( (9 (K (!8( H(`; P(J X(!p( (`; (K (0"( (< (T ȕ(p"( (< (T ("( ((* 0(K 8( P( `(* h(K p( ( (+ (K (#(" Ж(` ؖ(R ( #(+ (@+ (K (H#0(6 @(> H(J P(h#h(A x(> (K (#(M (@ (J (#ؗ(X (@ (K ($(d  (B ((J 0(H$H(l X(B `(K h(x$(u (C (J ($(} Ș(C И(K ؘ($( (0E (J (%(( 8(0E @(K H(H%`( p(`+ x(K (x%( (+ (K (%Й( (+ (J (%( (+ (J ((%@( P(+ X(J `(0&x( ( , (J (h&( (@, Ț(J К(&( (`, (J (& ( 0(, 8(J @('X( h(, p(J x(H'( (, (J ('ț( ؛(, (J ('((F (J ('8(H(F P(K X(((p(!(`H (J (`((-(`H (K Ȝ(((:(- (J (((H(( - 0(J 8()P(U`( + h(K p(@)(_(08 (J ()(jН(08 ؝(K ()(v(, (J ((*0(@([ H(Q P(`*h(Jx( * (J (*(I(@* ( U (*؞(bI(@* (@R (+( ([ ((Q 0(`*H(f `(J h(P ( (W ( !( П(W ؟(P!(J(@ ( Y (*((I8() @(Y H(*`(bIp() x(Z (+(G(_ (pS (8+Р( (J (p+(  (W ((+(N8(A P(`W((u((`t(X(Q (@X(((u((e (@Z(ȥ(v((`!(P5ئ(0F0( c(8(@(`(@h(y(p( x(x( w((P8( P(PШ(h((`{(({(H(@3ة( (p(j(x(p((`|((|(($x( (((l((pH (H@(H( (P(~(X(~((p( 0(X((m((pH(H((((((((0( Ю((P(n(X(pH`(H(((((((ȯ(@(h(Kp((!Ȱ(Ѕذ(a((((@a((V!((`( (K((08( `(@(#W!H(@X(_(`(h(pFx(^((1!(F(`^((Ț!(F(](( ( (  (. @(KH(0X(@](`(E!h(px(\((AI((KI((ZCȲ(ز([((!((Z(((P(`Z(X(= p(`(@o((F(0F(@ ((((8(@(ȴ((\ (R ((H H(@ h(x(- (5 ȵ(% ( (uI(( @( X(nIp(~I( ( ( ض( ( ( 8(X( x(I(H(:ط(!(-(8(X( x( ( ( ظ( ( ( 8(vX( x( ( ( ع( ( ( 8(u X(} x(d (l (M غ(X (6 (A 8(+ X(Ux(" ( ( ػ( ( ( 8( X( x( ( ( ؼ(_(j( 8( X(w x( (f (n ؽ(J(G(I8(bIX(Jx(( (0] (6(nI( ( - ( !((8(Fx(pC(@eH( ((K0(P((-(K( (p( -0(N@(!H(W`(!h(W((7((!(L({!(R (V0([@(f!P(c`(np(x(((((P!((((( (0(@(P(`(p(K(((( ((((.(`((H(H( (?(((!(7((x(/,(( (ЪH((X((((& (@('H(X(@(`('h(x(((!+((2+(?+(J(M+(+(x(E(T+(+(h (((_+0(f+8(q+@(}+H(t+P(X(J`(+p(Ex(T+(+( (+(+(x(+(F(F(G(+(+(+(+(P!(+(x(+(x(U}! (+0(x8(i@(+H(xP(xX(B`(Ip(xx(+(+(B(Q(+((+(Ji!(+(d(x(x(x(+(+(>(x(+ (+((+0(+8(+@(+P(MX(I`( h(+p(+((+( (+(Ji!( ( ( (I(E(T+(x(t (t ( (t (d(t ( (({E@(+H(+P(+X(+`(+h(Qp(Ix(+(I(+( (+(+( (+(+(+( (+(+(+( (+(+ (+((h0(x8(,@(+H( P(x`( ,h(xp( ,x(x(J(,(+(+(,(J((+(,(',(J((+(, (',0(E8(T+@(+H(+P(+X(+h('(((b!((( (@(X(t!((8,(jP(E( ('(A,(x!((8,(P,(x!( 8(k!X(Hx(P!(QF(}+(f+(q+((_+H(t+((?+(2+(M+8(+X(+x(+(+(G(F(F(U}!8(iX(+x(+(B(Q(+(d(+8(P!X(>x(+(+(M(+(+( 8(Ji!X(Ix(+((+(Q(+(I8(T+X(dx(+(+( ( (,(h8( X(+x( ,(E(x({E(+(,8(',X(,x( (+(t ((J (J((P0(J8(v@(dX(Px(j((7(K(K(k!8(jX(ix((j( %(j)~))))_j)) ) ) )@ )) ):)( )P8 ) )@ )~H )pX ))` ),h ))x ) ) )~ ) )) )G#! ) )( );i ) )`( )~b! )@ ) ( )i ) )( )q%!( )8 )(@ )iH )0X )(` )bih )x ) ( )]i ) )( ) )p )( )w )0 )( )P ) )( )i )p )( )~( )08 )@(@ )pH )`X )(` )P!h )x )( )B ) )( )6j ) )`( )Aj ) ) ( ) ) ) ( )i! ) )( )J( )8 )(@ )+(!H )X )`(` )J!h )x ) ( )E ) )`( )~ ) )( )O! )  )( )Eh! )p )( )M} ) )( )( )8 )`(@ )W}H )X )`(` )ih )Px )( )b} )0 )( )2j )` )( )H+ )P )()#~H)KP) )`)))))qQ)>).J)RK )j&!()/~@)!H)1EP)٪X)Kp)>x))_j)))H)KI8)AIX)x) )J)~)L))J8)ߧX)ߧx)=j!))N)E){E()EH)jPh)!)E)K)H)k!)))@U )X()0)8)%H)P)(!X)`)`(p)x)*-))-)p):)Ϯ)P$))))03)x)-)-)@5) - ) -()P;H) &)(&) 8&))@&)H&) =X&)`)`&)h&)x&) )&)R&)p>&)`)&)&)&)$)&)&)&)$)')˿')@')#) ')ؿ(')@8')")@')ZH')@X') ")`')h')x')!)')')@')`!)')w')C') !)')׻')') )')˻')')@ )()()f()) ()(()8())@()H()`X()@)`()h()@x())()!()()))) &)8)))!X))E!x))(!)))) %)))&)*)`8*)lX*)Hx*)g*)*)-*)n*)+)8+)X+)x+)+)+)+)!+) %+)+):+)?H7),)p7),)7),)7) ,)7),)8),)H8)(,)p8)$,)8)<,)8)8,)8)0,) 9),,)H9)`,)p9)\,)9)X,)9)T,)9)P,):)H,)8:)@,)h:)p,):)h,):),):),);)|,)@;)x,)h;),);),);),);),)<),)8<),)`<),)<),)<),)<),)=),)(=)`-)P=)P-)x=)D-)=)8-)=)0-)=),-)>) -)@>)-)h>)-)>),)>),)>),)?),)0?),)h?)-)?)x-)?)p-)?)-)@)-)8@)-)h@)-)@)-)@)-)@)-)A)-)8A)-)`A)-)A)-)A)-)A)-)B)-)HB).)pB).)B) .)B).)B).)C).)8C)-)hC)P.)C)@.)C)<.)C)0.)D)(.)HD).)pD).)D).)D)x.)D)p.)E)h.)8E)`.)`E)\.)E)X.)E).)E).)F).)HF).)pF).)F).)F).)F)/)G).)8G).)hG)(/)G)/)G)(!)pM)`) ) !()M8))@)!H)X)@)`),!h)Yx)))?!)0)@))U!))))o!)))){!)))) )@X)) ) ()O8))@)L H)NX))`)!h) x)))i )N)))!) ))) )R) ))!)pS)))| )O)) )!()pQ8)@)@)!H)X))`) h)Sx)))!)R) ))!)))) )@Y)))!)Y)))!)T)) )!() U8))@)$!H)PUX))`)7!h)Vx)) )J()!0)U!8)!@)P!H)!`)W!h))p) ))/)!))#W!)d!)2W! )AI()W@)KIH)t`)#W!h)@t)J)X?!))?! )n%!() 8)?!@)%!H)вX)8@!`)&!h)jx)p@!)\%!))@!)&!))@!)&!)W) A!)$#!) )`) )'!() 8)`)@)'!H)|X))`) E!h)|x)))'!)`)))>(!)`)))+'!)))):'!)Ѕ)))'!)) ) )#!()8))@)D'!H) X) ))"!)x) ))P!)y)`))R'!)z) ))"!)@z)))\'!)r)`) )AI()x8) )@)KIH)yX)`))˿)`w)))"!)`w)))ؿ)Pr)))P!)Pr)))j'!)j)`) )}()j8)`)@)AIH)`wX))`)KIh)Prx)))!)T)))v'!)T)@))~'!)j)))!!)l)) )'!()i8))@)'!H)PiX) )`)!!h)Plx)))'!) i)))'!)@k)))'!)pZ)`))'!)i)))'!)U)`) )'!()X8))@)'!H)YX)))'!)%)'!)У%)(!)%@)/(!H)%);(!) %)C(!)@%)S(!)p%@)a(!H)%)o(!)%)y(!)%)(!)%@)(!H) %)(!)`%)(!)%)(!)%@)(!H)%)(!)%)(!) %))!)@%@))!H)`%)")!)%)/)!)%)8)!)%@)B)!H)%)L)!)%)[)!)%)e)!) %@)n)!H)@%))!)p%))!)%)&! )X))!p)`V)px() )0)))%!))!))!))!))! ))!0)*!@)*!P)*!`)**!p)3*!)@*!)R*!)]*!)s*!)~*!)*!)*!)*!)*!)*! )*!0)*!@)+!P)+!`)+!p)'+!)4+!)?+!)S+!)e+!)x+!)+!)+!)+!)+!)+! )+!0)+!@)+!P)+!`),!p),!)$,!)2,!)=,!)N,!)c,!)v,!),!),!),!),! ),!0),!@),!P),!`),!p)-!)-!)"-!).-!):-!)G-!)S-!)a-!)h-!)x-!)-! )-!0)-!@)-!P)-!`)-!p)-!)-!)-!).!)'.!);.!)I.!)V.!)c.!)p.!)}.! ).!0).!@).!P).!`).!p).!).!).!)/!)/!)&/!)1/!)J/!)@A!*c/!*v/! */!0*/!@*/!P*/!`*/!p*0!*0!*(0!*50!*E0!*S0!*`0!*m0!*y0!*0!*0! *0!0*0!@*0!P*0!`*0!p*0!* 1!*1!**1!*:1!*L1!*f1!*s1!*1!*1!*1! *1!0*1!@*1!P*1!`*1!p*2!* 2!*.2!*A2!*O2!*^2!*j2!*{2!*2!*2!*2! *2!0*2!@* 3!P**3!`*`A!p*D3!*^3!*y3!*3!*3!*3!*3!*A!*4!* 4! *!4!0*14!@*=4!P*J4!`*W4!p*c4!*o4!*{4!*4!*4!*4!*4!*4!*4!*4!*4! * 5!0*5!@*jH*5}!P*!X*p*x*&!*+5!*&!*!*) *)X*k!*G5!***0*V5!8*U@**} *h5!(*X*~5!p*t*5! * *) *)P *!!x *)! *@@ *H * ) *` *95!0 *sX *0x *)8 *{ *5! *ps *w*)*O!*O!*O!*O!*O!*P!* P!*P! *P!(*"P!0*,P!8*3P!@*BP!H*KP!`*YP!h*Tx***O!*d***bP!*@*@**kP!*sP!*P!*B!*P!*P!*P!*P! *P!(*P!@*P!H*P!P*r(!X*P!`*P!h*Q!p*Q!x**Q!*BQ!*B!*JQ!* C!*!*PC!*&!*RQ!*jQ!*rQ! *{Q!0*Q!@*Q!P*Q!`*Q!p*Q!*Q!*Q!*Q!Ȥ*Q!Ф*Q!ؤ*&!*Q!*Q!*Q!*Q!* R!*R!*"R!*)R! *;R!(*CR!8*XR!H*C!X*tR!`*R!h*`R!p*R!x*R!*R!*|R!*R!*C!*R!*C!*R!*D!*R!ȥ*R!Х*S!إ*S!*6S!*>S!*\S!*cS! *jS!0*sS!@*}S!`*\%!h*px***mR!*p***%!* ***h)!Ȧ* ئ***U)!****E)!* *`* *)!(*8* *@* )!H*X**`*(!h*x***;)!**`**S!****S!ȧ*`ا***S!*p*@**(!*** *(!(*8*~*@*)!H*X*~*`*(!h*x*|**%!**|**(!**{**(!Ȩ*ب*@{**8%!**y**(!*@*w* *(!(*8*u*@*(!H*`X*t*`*$!h*Px*`s**AW!**p**r(!**`p**%!ȩ*Pة*p**S!*W* o**h(!**m* *Z(!(*8*`l*@*M(!H*X*@g*`*$!h*0x*@f**=(!**e**$!* *e**4(!Ȫ*ت*d***~* *c**(!** c* *'!(*8*b*@*&!H*PX*a*`*&!h*x* a**'&!* *`**$!**_**$!ȫ* ث*^**S!**^**K&!**]* *&!(*8*]*@*S!H*X*`\*`*S!h*x*@[**S!**Z**S!*@*Z**S!Ȭ*ج*@Z**$!**Y**S!*W* Y* *S!(* 8*X*@*D!H*0X*X*`*S!h*Px*W**S!*`*W**S!**@W**&D!ȭ*ح*W**.D!**V**D!**`V* *D!(* 8*V*@*:D!H*X*U*`*D!h*@x*`U**D!**U**HD!*0*T**S!Ȯ* خ*@T**$!*`*`S**\W!**S* *aD!(* 8*R*@*)H*PX*R*`*TW!h*Px*`Q**LW!*@*P**6E!*` *N**dE!ȯ*Pد*N**D!**M**T!*`*`M* *TD!(*8*M*@*D!H*PX*L*`*_D!h*Px*L**2W!**`J**#W!*0* J**D!Ȱ*ذ*I**_V!*02*H**E!*!*`H* *W!(*8*H*@*D!H*X*F*`*BE!h*x*F**)!*!*E**E!*0&*D**E!ȱ*p"ر*B**E!*)*B**E!*0$*A* *E!(*P(8*@*@*F%!H*0X*?*`*W!h*@x*?**E!*`**@>**T!**=**qE!Ȳ*ز*<**W!* *@;**V!**@8* *E!(*-8*7*@*E!H*-X*7*`*E!h*0.x*7**mD!**6**V!**5**E!ȳ*p س*`4**E!*` *`2**F!*.*2* *F!(*08*1*@*FPH*1X*`1*`*^)!h*`x*0**2)!**0**+*t*@0**%)!ȴ*pش*/**E!***`/**V!*@+*.* *V!(*+8* .*@*V!H* ,X*-*`*V!h*,x* -**V!*p*,**V!**@,**V!ȵ*@ص*+**)E!*` *@+**V!** ** *D!(*8*)*@*YE!H*X*`)*`*LE!h*x*(**tV!**'**T!*J*&**T!ȶ*ض*%** *A*@%**~D!*P*$* *D!(*8*@$*@*%T!H*0X*#*`*/T!h*2x*@#**TV!*4*!**CV!*7* **,V!ȷ*0:ط***V!*=***9T!*** *KT!(*8**@*2F!H*PBX**`*~E!h* x***%!**`**%!*`***%!ȸ*ظ*@** V!*B* **V!*p<**@*mT!H* *P***R***`**{!** */X*Q!*J!*@****J!*@**@**U!Ⱥ*`*к***J!*****J!* *** *J!(*@*0**@*J!H**P***L***`**U!*% * V!(*%`*V!h*%*$V!* %*8V!*@% *LV!(*%`*]V!h*%*oV!*%*}V!*Ш% *V!(*%`*V!h*%*V!*%*V!*% *V!(* %`*V!h*0%*V!*@%*V!*P% *V!(*%`*W!h*%*W!*%*W!*% *!W!(* %`*)W!h*@%*7W!*%*IW!*% *RW!(*Ъ%`*ZW!h*%*~b!*** *a!(*Ч8**@*`!H*X***a!**a!*P*a!*0 *H*6)p*a!*a!*`!**@* *!E(*8**@*1EH*X**`*`!h*x***%!*0*@**Yb!*p*`**ob!****a!*P***Ib!**`*H*`*b!h*x*(`!*a!*Wi*%!`*b!h*@x***b!**`**b!**`**b!****b!****b!*0*@* *b!(*0 8**@*b!H*X**`*b!h*x***a!* *p**Ib!*@*@**a!@*b!H*X**`*b!h*@%x*** b!*%*,b!* %H*V`***8b!*`*0*@*P***** ***@*Gb!H*@%*Vb!*P%*cb!*`%*mb!*p%@*vb!H*%*Gb!*%*b!*%*b!*%@*b!H* %*b!*@%*b!*`%*b!*%@*b!H*%*b!*%*b!*@%*b!0*X*x*`***Ц*`****`** c!**@*** +rF(+G8+@*@+& H+ZX+*+i!+G+xp!+++@*+Di!++* +k!(+.8+*@+a!H+X+*`+Gh+x+*++p+ *+'J+ +*+Oi!++`*+B++*+v+ +* +(+8+`*@+Zi!H+X+ *`+& h+x+*+Z(!+P+*+IH+0+`*+.J+++ *+h!++*+OG+PG+*@+@,H+P+X+PJh+`x+@+0++- +bi! +s +p! + h! +P +p! +h! + + q! +h!( +`8 +Xq!@ +>f!H +MX +hi!` +Bf!h +Nx +q! +B + +q! +'g! +s +i! +b! +Pt +i! +5g! +t +i! ++ * +a!(+8+*@+d!H+=X+*`+a!h+x+`*+d!+>+ *+d!+?+*+e!+ @+*+c!+/+`*+c!+0+* +c!(+18+*@+c!H+2X+@*`+%e!h+@x+*+7e!+pA+*+Le!+B+*+c!+3+@*+c!+4+*+d!+5+* +'d!(+68+ *@+ae!H+BX+*`+=d!h+ 7x+*+d!+ <+`*+va!+p+ *+{e!+@C+*+k!+7+*+e!+C+`* +Xd!(+88+ *@+e!H+pDX+*`+ld!h+9x+*+e!+E+`*+d!+`:+*+e!+E+*+d!+P;+*+e!+ F+@* +e!(+F8+`*@+a!H+X+*+I++n+*+ +8+l!+c+@*+ ++*+nl!+R`+(+*+(+`)+++++n+l+l!+R +l!+l!+l!+H+f!+hv! +++[+@++@++@v!+TX+-+K+ ++X +l!p +T +- !+@K(!+ +x!+!+l!"+8"+@"++H"+@+"+*"+P,"+."+"+0"++"++#+#+#+0l!#+T#+Д$+ 0$+`*8$++h$+`+$+P8%+Fl!P%+Sx%+%+%+*%+`+&++X&+&+Zl!&+T'+Y@'+p'+@*x'+@+'++'+0x(+l!(+-)+' )+ (*+l!0*+P.*+P]*+ '*+p'*+Pa*+@+++l!++R++W ,+@UP,+`*X,+&,+@+,++,+@+,+O`+jS!`+{!`+}S!`+{! `+{!(`+!0`+\S!8`+{!@`+cS!H`+@!P`+sS!X`+{!``+{!h`+{!`+z!`+0/`+ 8+`+Vy!`+'`+7+`+y!`+-`+6+`+y!`+.`+ 6+a+{!a+<a+4+ a+^y!(a+P(8a+@3+@a+y!Ha+0Xa+`2+`a+y!ha+*xa+1+a+{!a+P<a+@1+a+l{!a+ >a+0+a+y!a+)a+`0+a+{!a+`2a+/+b+|!b++b+.+ b+|!(b+>8b+.+@b+v!Hb+Xb+@-+b+!b+&b+A+b+k!b+!b+@+b+!b+P#b+@+b+|!b+%b+?+c+)|!c+"c+`?+@c+}!Hc+Xc+B+c+rFc+0c+ C+c+& c+c+\+c+& c+0 c+\+d+Fd+d+Z+ d+OG(d+ 8d+`C+`d+& hd+ xd+\+d+Fd+d+Z+d+OGd+ d+`C+d+& d+d+\+e+Fe+e+Z+@e+& He+Xe+\+e+& e+pe+\+e+& e+ e+\+e+Fe+e+Z+f+OGf+@ f+`C+@f+& Hf+p Xf+\+`f+Fhf+xf+Z+f+OGf+` f+`C+f+& f+f+\+f+Ff+f+Z+ g+& (g+8g+\+`g+5|!hg+@xg+S+g+& g+ g+\+g+Fg+ g+Z+g+& g+g+\+ h+& (h+@ 8h+\+@h+FHh+Xh+Z+h+& h+h+\+h+Fh+h+Z+h+& h+h+\+i+Fi+i+Z+@i+& Hi+@Xi+\+`i+Fhi+0xi+Z+i+a!i+i+ Z+i+& i+i+\+i+Fi+@i+Z+ j+& (j+8j+\+`j+& hj+xj+\+j+Fj+j+Z+j+& j+`j+\+k+C|! k+`!`k+ hk+ xk+\+k+Gk+`k+@\+k+a!k+`k+@\+k+& k+k+*l+v!l+pl+@]+@l+S|!Hl+8+Pl+`+l+l+9+l+`+m+m+@B+ m+b+0m+ "8m+"@m+#m+m+C+m+@c+m+!m+$!m+!Em+Gn+!n+}!0n+8n++Pn+Xn+x!pn+xn+x!n+n+x!n+Fn+a!n+n+>Ho+xPo+@_+`o+l+o+Io+Mo+i|!p+8p+p+H+p+p+0p+c+q+@q+z|!q+0r+ I+8r+0`r+hr+c+r+8s+|!Ps+s+L+s+ t+Pt+`d+Xt+ t+|!t+ pu+L+xu+`u+u+d+u+pxv+|!v+@v+pw+N+w+@w+@Hw+@e+w+x+|!0x+ x+O+x+ x+x+e+8y+py+!y+pPz+P+Xz+z+`z+e+z+X{+|!p{+{+Q+{+ |+p(|+@f+x|+P|+|!}+`}+R+}+p}+p}+f+~+~+}!~+00+ S+8+p`+h+ g++8+(}!P+Ѐ+T+؀+++`g+X+؁+8}!+p+U+x+@++g++x+J}!+`+@V++@+ H+ h++0+[}!0++ X+++ +h+8++o}!І+PP+X+X+`++h+؇+X+}!p++Y++ +(+@i+x++}!+ +`Z++++Ȋ+i++p+}!+p0+Z+8+p@+h+ j++8+}!P+pЍ+ [+؍+++`j+X+؎+}!+0x+ ++j++@x+}!+T+Y+]++0- +-H+`k+P+k++0 +K(+H+1 P+@p+ x++#W!+++++@+`++)!+++ +ZC(+8+ +@+H+`X++`+V!h+x+++!++++E!++ ++++++1!++`++Ț!+`++ +(+p@+FH+@++@H+2W!+0+`++:!+ q+++}!+ v++ +v!(+r8+ +@+!H+}X++`+!h+rx+@++!+s+++!+t+++!+t+@++!+u+++!+ ++ +!(+u8+ +`+Š!h+ʊ!p+!x+!+!+!+*!+2!+G!+N!+e!+l!+!+!+!+!+!+!+!+!+ߋ!+! +P!(+X8++@+l!H+UX++`+c!h+Xx+++!+PZ+@++s!+Y+++!+[+ ++!+`_+++!+_++ +!(+d8++@+)!H+eX++`+ !h+bx+++!+b+++!+Pd+++!+n+++@!+f+`++W!+X++ +J!(+g8++@+1!H+ iX+`++!+@@+++!+@+++'!+@A+@++/!+A+++7!+@B++ +@!(+B8+ +@+H!H+@CX++`+Q!h+Cx+++Z!+0D+@++c!+D+++k!+E+++s!+E+@++z!+I++H+Kh+J++)!+r!+!+ % +!(+@%h+#W!+J++'J+)!+W!(+!H+!h+!+!+0++8+pq@+q`+Ph++x+ +++p8+!P+p+++PH+#W!+K+R!+E!@+ˌ!H+%++@++++++p(+0+0+@+++!+!+`++P!+`++ ++ !h+p+@++++#W!++E!(+G!H+!h+K++)!+ +(!+r!(+H+ h+Ț!+1!+!+K+-!+% +C!(+%`+H!h+%+K+J+!+N!+%@+a!H+ %+t!+@%+E!+#W!+Ț!(+1!H+Kh+E!+J!+!+W!, ,ճ! ,@ ,!H ,X ,! ,! , ,۳! ,! , ,! ,! ,p , ! , ! ,p ,+!@ ,!` ,! ,! ,  ,۳! ,! ,0 ,! ,l ,p ,0!@ ,C!H ,0X ,+` ,N!h ,`x ,+ ,[! ,P ,+ ,g! ,p ,+ ,!E , ,+ ,: ,` ,`+ ,}! , ,+ ,!( ,@8 ,+@ ,!H ,X ,@+ ,! , ,x! ,v'! ,v ,! ,! ,  ,! ,! , , ! ,ͱ! , ,! ,Ŵ!( ,P8 ,!@ ,!H ,X ,!` ,!h ,x ,! ,! , , ! , ! ,` ,! ,! , ,! ,! ,w ,!, !, , ! ,!(,8,H!@, !H,0X,!,0!,K ,Q! ,ή!(, 8,,@,8!H, X,,`,!h,px,+,]!,,@+,"!,P,+,t!,,+,!,,`+,!,p,+h,p,+, ,,,,R!, ,,@ ,,tx,e!H, ,P,@ ,,t(,@, ,,,`+,@ ,,!H,P,+`, ,p,r,x!,٪,!,2}!,u"!,s|!,٪,>(!,٪,!H,!,!,!X,µ!,ʵ!,٪,!,K,K,k!h,p,,,!,!,%8,ݵ!P,x,@,@,,q, ,,,H,P(%@%%@Q'%%%%A%%%%t% %E(%0%8%@%H%P%X%U(U@(U(U`%h%-p%(''x%%%5%%%%L%}%%%%%%%O%v%%Z%%% %(%0%c8%@%/H%P%X%!`%Qh%\p%x%}%%% (')'`+'@0'3'<'='`G'I'@c'd'm'o'''' ''C(( #+,+ q+r+`t+v+w+@y+z+|+ ~++`+++@+++ ++`+++`,%m%y%C%%l%%%O%+%I%q%l%9%%O'%8% %(%0%#'8%@%H%P%EX%`%h%Hp%Qx%m%%%%%%%Z%%R'%%g%h%%C'C@'C%%%1%G%A% %RF'RXH'Rxs'R'RX'R'R'R(R8,+R(%<0%8'8%v@%{H%XP%X%r`% h%Vp%{x%%j%%G%#%%7%%%7%%%,%%%%,%%%/% %&(%h0%8%@%H%P% X%`%h%Ep%x%v%m%%%N%r%%%j%%B%%%%%+%%'%%% %(%0%8%C@%Z0$'Z%'Zp''Z)'Z*'Z01'Z03'Z4'Zp6'Z8'Z9'ZP;'Z<'Z>'Z0@'ZA'ZF'ZK'Z0M'ZU'ZPW'ZX'Z['ZP]'Z^'Z`'Zb'Z0d'Ze'Zpg'Zi'Zj'Zps'Zu'Zv'Zpx'Zz'Z|'Zp~'Z0'ZЁ'Z'Z0'ZІ'Zp'Z'Z'ZP'Z'Z'Z0'ZГ'Zp'Z'Z'Z'ZP'Z'Z'Z'ZP'Z'Z'Z0'Zп'ZC(Z(Z0(Z(Z0+Z +Zp"+Z$+Z%+ZP'+Z*+Z0,+Zpp+Zr+Zs+ZPu+Zv+Zx+Z0z+Z{+Zp}+Z+Z+ZP+Z+Z+Z0+ZЈ+Z+Z+ZP+Z+Z,ZH%P%X%`%h%p%x%x%9#'9H%'9&'9('9(*'9+'9h-'9/'90'92'9H4'95'97'9(9'9:'9h<'9>'9?'9HA'9B'9D'9(F'9G'9hI'9K'9L'9N'9HP'9Q'9S'9(U'9V'9hX'9(['9\'9h^'9`'9b'9c'9He'9f'9h'9(j'9Hl'9hn'9Hq'9r'9t'9Hv'9w'9z'9(|'9}'9'9H'9'9'9H'9'9'9('9Ȍ'9h'9'9'9H'9'9'9('9ș'9h'9'9ȣ'9h'9'9'9H'9'9'9ȸ'9h'9'9'9H'9F(9hH(9(9(9h(9 *9 *9h(+9*+9%%%4%F%/%?%%%% %U%%M%%Z%%#%%" %(%n0%8%7'<'xb'd'X"+@%H%'P%X%d`%h%qp%x%}%%%%%%%%%%-%$%%%6%Q%%%:%y% %(%0%_8%@%H%?'u' ''''''P%=X%`%h%Np%x%%%a%%%4%%%%%j%f%M%%%%%1%8%% %;(%N0%8%t@%H%P%X%`%h%p%x%(')'P+'00';'='PG'H'O'0c'd'pm'o'u'Ѕ'p'p'''''C((0 *#++P,%T'%1%z%6%2%%%G%%L%%%#'''X)'*'x1'5'9'>'x@'U']'8_'`'f'g'Xi'j'v'w'z'}'~'p'x''؂'x''؝'8'D((x(8 *x+!+p+Xr+s+u+8w+x+xz+|+}+X+++8+؅+x+++++H2'x2'H'd'xm'o'x'''(X(((8(د(x((X,HN'Jk'Jn'Jp'J('JH(J(J+JH+JPN'k'n'p'0'(+P+hZ'a'_y'{'{'}''؞'''hا'h'08'0X'x'x''' ب' '8''x'8''X'~'~x'Mة'M'''['[ؠ'8''x'8''ء''''' ث' آ'['[''ج''8''x'8''X'' '''ȱ((Y((((?((3((((8(H(X(4h(x(u((((|((((((((8(H(X(h( (o((H))ط%%j%%%-%%%Y% %(%0%8%(@% H%P%X%u`%%h%p%x%%%%%%a%%%!%@ȸ%+и%ظ%%%%%U%%% % % (%0%8%@%H%.P%YX%v`%eh%p% x%%% %K%% %%%=%ȹ%й%ع% %%%% %c%$% % %(%0%>8%S@%VH%P%X%`%h%p%x%%5%%Q%%`%%%$%TȺ%=к%Aغ%%%%% %i%%% %(%0%8%B@%H%P%KX%`%Wh%p%x%/%%%%%%%%% Ȼ%л%"ػ%%%%%%<% %]% %(%0%U8%@%H%vP%X%`%h%6p%Wx%%?%!%#%F%"%#%P%%ȼ%[м%ؼ%$%%%%%&%i%%'% %(%0%_8%(@%H%P%X%i`%h%*p%x%%)%%%%*%[%)%+%,Ƚ%-н%.ؽ%]%%%%%%%z% %(%0%^8%w@%.H%P%X%`%h%p%x%%0%%%1%2%W%%<%Ⱦ%3о%ؾ%4%%@%_%l%%5%%z %j(%60%>8%7@%dH%DP%pX%`%h%@p%x%%8%0%%%z%K%a%F%mȿ%3п%ؿ%%e%9%%v%:%%;% %<(%0%8%@%H%P%kX%=`%>h%p%jx%5%E%%%%%%'%%X%%B%v%?%~%%%}% %% %(%@0%A8%!@%uH%P%BX%I`%Ch%@p%$x%p%%D%E%%F%%)%%%G%%H%T%%.%% %*%*% %(%0%I8%J@%H%P%KX%`%Lh%lp%x%%M%N%k%%_%7%%%%%1%%%(%%%O%%% %P(%Q0%V8%e@%RH%LP%X%j`%h%p%x%%S%%T%%%U%%%%%%K%>%%%%%%V%W %~(%b0% 8%X@%H%P%YX%I`%Zh%p%[x%%%%%\%c%S%%% %,%F%Y%%P%+%A%]%%^% %_(%0%?8%`@%H%nP%X%g`%h%ap%x%%%b%c%d%%%%E%%%%%f%h%%%%n%% %(%0%w8%@%H%P%hX%`%ih%p%x% %j%V%k%^%%%u%w%3%%/%%l%%%.%m%%%) %(%r0%L8%@%1H%.P%X%^`%kh%p%nx%%o%p%%q%%U%Z%r%y%/%\% %s%%%g%%%%R% %(%t0%8%5@%H%RP%yX%u`%Mh%p%x%%:%"%v%%w%W%r%O%.%%x%R%%%%%%%y% %N(%0%z8%b@%H%P%}X%D`%h%`p%|x%}%~%X%%%d%%%%%%%%%%%%%#% %? %`(%0%8%@%H%P%X%"`%h%op%)x%%%%%3%%%%J%%%%2%%k%H%%%%% %L(%e0%w8%@%H%P%iX%`%h%p%Ax%%%%%[%I%%%%%%%L%%%E%%%%/% %(%0%8%@%H%P%'X%`% h%p%x%%%%%%%%%%%%%%N%`%%W%d%%% %(%20%8%@%H%P%X%_`%h%p%-x%%%%%%%%%%%%%%%5%;%%%%%% %(%n0%>8%@%H%P%xX%!`%{h%p%x%%%%t%%%%%%%%%%%%%%*%%% %(%0%W8%@%H%4P%X%`%h%Bp%px%%%%e%y%2%%%,%%Z%%%%%%%%%S% %(%0%8%i@%H%P%qX%`%1h%p%x%%%%:%k%%%%%u%%%%%%%~%%%% %k(%0%8%x@%H%(P%|X%`%Gh%p%Vx%%x%4%%%J%%% %%%f%w%%%%z%%%% %(%0%8%@%H%P%qX%`%h%p%Ox%e%H%%%%I%%H%%%{%P%%%%%%%9%9%4 %2(%I0%8%.@%mH%P%!X%g`%h%\p%x%+%%%%e%%%%%%%%7%%%%%%R%% %[(%0%8%@%H%P%X%`%ch%Jp%x%%%%p%%f%%%&%%%%%%J%%%r%%u%t %(%0%8%@%H%P% X%`%h%\p%x%%[%%@%%0%x%%|%%%,%q%%%z% %%%%  %(% 0%8%(@%H%rP%X%`%h%Sp%yx%%D%%%%W%%a%%d%%5%{%%#%%%]%%% %^(%0%f8%)@%H%P%X%`%h%gp%x%%%%%%%%'%%G%%%%&%%%%%%% %(%M0%8%$@%H%P%X%`%h%op%x%%<%%5%%f%%%%%%%%%%%s%/%%%%% %(%0%X8%@%}H%?P%8X%`%h%Jp%5x%%%%%%%0%%%%q%%]%s%%%%%%%& %(%0%8%@%|H%P%X%@`%h%p%x%{%%*%%s%'%<%%%%%%P%%%%%%%% %(%0%b8%@%H%P%X%`%h%p%x%b%%% %k%%%%%%%X%%O%i%%%\%%% %(%0%8%@%H%P%X%`%h%p%px%%S%%%'%%%%%"%p%%%%%%%%%a% % (% 0%"8% @%H%oP%tX% `%h%fp%Ux%%%:%%%%%% %%c%%R%%Y%;%%%%% %(%s0%8%@%H%P%X%~`%h%lp%x%%%%%%%%%%%%%%6%%%%Y%%b% % (%0%8%@%H%mP%X%`%h%Cp%x%4% %%%%%7%%<%%%%z%o%%;%%D%%% %=(%0%8%(@%H%P%X%`%h%p%x% %% %;%!%%"%#%%$%^%%%%K%%%]%%&%%%! %^(%'0%8%@%(H%)P%*X%`%h%p%_x%d%+%%,%=%g%%t%-%%%Q%%.%*%%&%%%% %0(%/0%]8%@%H%{P%0X%`%1h%Dp%x%n%%%Z%%1%p%%%|%2%% %%%0%%Y%#%]% %(%0%38%4@%5H%P%X%`%h%6p%x%7%%(%P%8%%G%%T%%9%%%B%:%%:%;%6%C%V %<(%0%8%@%H%?P%=X%`%>h%?p%@x%%A%=%B%C%x%D%E%%&%%F%'%G%8% %%h%%H% %,(%P0%8%@%H%cP%X%I`%Ah%lp%Jx%%%K%G%%%T%7%%%%%%|%M%9%N%%:%O%b %P(%0%8%@%H%XP%X%Q`%h%hp%>x%3%R%S%T% %-%U%%{%%HH1 HtH5%hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhѿhh鱿h顿h鑿h避hqhah Qh Ah 1h !h hhhhѾhh鱾h顾h鑾h遾hqhahQhAh1h!hhhh h!ѽh"h#鱽h$顽h%鑽h&遽h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1Ѽh2h3鱼h4顼h5鑼h6遼h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAѻhBhC鱻hD须hE鑻hF遻hGqhHahIQhJAhK1hL!hMhNhOhPhQѺhRhS鱺hT顺hU鑺hV遺hWqhXahYQhZAh[1h\!h]h^h_h`haѹhbhc鱹hd项he鑹hf遹hgqhhahiQhjAhk1hl!hmhnhohphqѸhrhs鱸ht顸hu鑸hv選hwqhxahyQhzAh{1h|!h}h~hhhѷhh鱷h顷h鑷h遷hqhahQhAh1h!hhhhhѶhh鱶h顶h鑶h遶hqhahQhAh1h!hhhhhѵhh鱵h页h鑵h遵hqhahQhAh1h!hhhhhѴhh鱴h顴h鑴h遴hqhahQhAh1h!hhhhhѳhh鱳h顳h鑳h遳hqhahQhAh1h!hhhhhѲhh鱲h顲h鑲h遲hqhahQhAh1h!hhhhhѱhh鱱h顱h鑱h遱hqhahQhAh1h!hhhhhѰhh鱰h顰h鑰h遰hqhahQhAh1h!hhhhhѯhh鱯h顯h鑯h遯hqhah Qh Ah 1h !h hhhhѮhh鱮h顮h鑮h遮hqhahQhAh1h!hhhh h!ѭh"h#鱭h$顭h%鑭h&遭h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1Ѭh2h3鱬h4顬h5鑬h6遬h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAѫhBhC鱫hD顫hE鑫hF遫hGqhHahIQhJAhK1hL!hMhNhOhPhQѪhRhS鱪hT顪hU鑪hV遪hWqhXahYQhZAh[1h\!h]h^h_h`haѩhbhc鱩hd顩he鑩hf適hgqhhahiQhjAhk1hl!hmhnhohphqѨhrhs鱨ht顨hu鑨hv遨hwqhxahyQhzAh{1h|!h}h~hhhѧhh鱧h顧h鑧h遧hqhahQhAh1h!hhhhhѦhh鱦h顦h鑦h遦hqhahQhAh1h!hhhhhѥhh鱥h顥h鑥h遥hqhahQhAh1h!hhhhhѤhh鱤h顤h鑤h遤hqhahQhAh1h!hhhhhѣhh鱣h顣h鑣h遣hqhahQhAh1h!hhhhhѢhh鱢h顢h鑢h遢hqhahQhAh1h!hh%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݈D%ՈD%͈D%ňD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݇D%ՇD%͇D%ŇD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݆D%ՆD%͆D%ņD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݅D%ՅD%ͅD%ŅD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݄D%ՄD%̈́D%ńD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݃D%ՃD%̓D%ŃD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݂D%ՂD%͂D%łD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݁D%ՁD%́D%ŁD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݀D%ՀD%̀D%ŀD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%~D%~D%~D%~D%~D%~D%~D%~D%~D%~D%~D%~D%~D%~D%~D%~D%}~D%u~D%m~D%e~D%]~D%U~D%M~D%E~D%=~D%5~D%-~D%%~D%~D%~D% ~D%~D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}D%}}D%u}D%m}D%e}D%]}D%U}D%M}D%E}D%=}D%5}D%-}D%%}D%}D%}D% }D%}D%|D%|D%|D%|D%|D%|D%|D%|D%|D%|D%|D%|D%|D%|D%|D%|D%}|D%u|D%m|D%e|D%]|D%U|D%M|D%E|D%=|D%5|D%-|D%%|D%|D%|D% |D%|D%{D%{D%{D%{D%{D%{D%{D%{D%{D%{D%{D%{D%{D%{D%{D%{D%}{D%u{D%m{D%e{D%]{D%U{D%M{D%E{D%={D%5{D%-{D%%{D%{D%{D% {D%{D%zD%zD%zD%zD%zD%zD%zD%zD%zD%zD%zD%zD%zD%zD%zD%zD%}zD%uzD%mzD%ezD%]zD%UzD%MzD%EzD%=zD%5zD%-zD%%zD%zD%zD% zD%zD%yD%yD%yD%yD%yD%yD%yD%yD%yD%yD%yD%yD%yD%yD%yD%yD%}yD%uyD%myD%eyD%]yD%UyD%MyD%EyD%=yD%5yD%-yD%%yD%yD%yD% yD%yD%xD%xD%xD%xD%xD%xD%xD%xD%xD%xD%xD%xD%xD%xD%xD%xD%}xD%uxD%mxD%exD%]xD%UxD%MxD%ExD%=xD%5xD%-xD%%xD%xD%xD% xD%xD%wD%wD%wD%wD%wD%wD%wD%wD%wD%wD%wD%wD%wD%wD%wD%wD%}wD%uwD%mwD%ewD%]wD%UwD%MwD%EwD%=wD%5wD%-wD%%wD%wD%wD% wD%wD%vD%vD%vD%vD%vD%vD%vD%vD%vD%vD%vD%vD%vD%vD%vD%vD%}vD%uvD%mvD%evD%]vD%UvD%MvD%EvD%=vD%5vD%-vD%%vD%vD%vD% vD%vD%uD%uD%uD%uD%uD%uD%uD%uD%uD%uD%uD%uD%uD%uD%uD%uD%}uD%uuD%muD%euD%]uD%UuD%MuD%EuD%=uD%5uD%-uD%%uD%uD%uD% uD%uD%tD%tD%tD%tD%tD%tD%tD%tD%tD%tD%tD%tD%tD%tD%tD%tD%}tD%utD%mtD%etD%]tD%UtD%MtD%EtD%=tD%5tD%-tD%%tD%tD%tD% tD%tD%sD%sD%sD%sD%sD%sD%sD%sD%sD%sD%sD%sD%sD%sD%sD%sD%}sD%usD%msD%esD%]sD%UsD%MsD%EsD%=sD%5sD%-sD%%sD%sD%sD% sD%sD%rD%rD%rD%rD%rD%rD%rD%rD%rD%rD%rD%rD%rD%rD%rD%rD%}rD%urD%mrD%erD%]rD%UrD%MrD%ErD%=rD%5rD%-rD%%rD%rD%rD% rD%rD%qD%qD%qD%qD%qD%qD%qD%qD%qD%qD%qD%qD%qD%qD%qD%qD%}qD%uqD%mqD%eqD%]qD%UqD%MqD%EqD%=qD%5qD%-qD%%qD%qD%qD% qD%qD%pD%pD%pD%pD%pD%pD%pD%pD%pD%pD%pD%pD%pD%pD%pD%pD%}pD%upD%mpD%epD%]pD%UpD%MpD%EpD%=pD%5pD%-pD%%pD%pD%pD% pD%pD%oD%oD%oD%oD%oD%oD%oD%oD%oD%oD%oD%oD%oD%oD%oD%oD%}oD%uoD%moD%eoD%]oD%UoD%MoD%EoD%=oD%5oD%-oD%%oD%oD%oD% oD%oD%nD%nD%nD%nD%nD%nD%nD%nD%nD%nD%nD%nD%nD%nD%nD%nD%}nD%unD%mnD%enD%]nD%UnD%MnD%EnD%=nD%5nD%-nD%%nD%nD%nD% nD%nD%mD%mD%mD%mD%mD%mD%mD%mD%mD%mD%mD%mD%mD%mD%mD%mD%}mD%umD%mmD%emD%]mD%UmD%MmD%EmD%=mD%5mD%-mD%%mD%mD%mD% mD%mD%lD%lD%lD%lD%lD%lD%lD%lD%lD%lD%lD%lD%lD%lD%lD%lD%}lD%ulD%mlD%elD%]lD%UlD%MlD%ElD%=lD%5lD%-lD%%lD%lD%lD% lD%lD%kD%kD%kD%kD%kD%kD%kD%kD%kD%kD%kD%kD%kD%kD%kD%kD%}kD%ukD%mkD%ekD%]kD%UkD%MkD%EkD%=kD%5kD%-kD%%kD%kD%kD% kD%kD%jD%jD%jD%jD%jD%jD%jD%jD%jD%jD%jD%jD%jD%jD%jD%jD%}jD%ujD%mjD%ejD%]jD%UjD%MjD%EjD%=jD%5jD%-jD%%jD%jD%jD% jD%jD%iD%iD%iD%iD%iD%iD%iD%iD%iD%iD%iD%iD%iD%iD%iD%iD%}iD%uiD%miD%eiD%]iD%UiD%MiD%EiD%=iD%5iD%-iD%%iD%iD%iD% iD%iD%hD%hD%hD%hD%hD%hD%hD%hD%hD%hD%hD%hD%hD%hD%hD%hD%}hD%uhD%mhD%ehD%]hD%UhD%MhD%EhD%=hD%5hD%-hD%%hD%hD%hD% hD%hD%gD%gD%gD%gD%gD%gD%gD%gD%gD%gD%gD%gD%gD%gD%gD%gD%}gD%ugD%mgD%egD%]gD%UgD%MgD%EgD%=gD%5gD%-gD%%gD%gD%gD% gD%gD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%}fD%ufD%mfD%efD%]fD%UfD%MfD%EfD%=fD%5fD%-fD%%fD%fD%fD% fD%fD%eD%eD%eD%eD%eD%eD%eD%eD%eD%eD%eD%eD%eD%eD%eD%eD%}eD%ueD%meD%eeD%]eD%UeD%MeD%EeD%=eD%5eD%-eD%%eD%eD%eD% eD%eD%dD%dD%dD%dD%dD%dD%dD%dD%dD%dD%dD%dD%dD%dD%dD%dD%}dD%udD%mdD%edD%]dD%UdD%MdD%EdD%=dD%5dD%-dD%%dD%dD%dD% dD%dD%cD%cD%cD%cD%cD%cD%cD%cD%cD%cD%cD%cD%cD%cD%cD%cD%}cD%ucD%mcD%ecD%]cD%UcD%McD%EcD%=cD%5cD%-cD%%cD%cD%cD% cD%cD%bD%bD%bD%bD%bD%bD%bD%bD%bD%bD%bD%bD%bD%bD%bD%bD%}bD%ubD%mbD%ebD%]bD%UbD%MbD%EbD%=bD%5bD%-bD%%bD%bD%bD% bD%bD%aD%aD%aD%aD%aD%aD%aD%aD%aD%aD%aD%aD%aD%aD%aD%aD%}aD%uaD%maD%eaD%]aD%UaD%MaD%EaD%=aD%5aD%-aD%%aD%aD%aD% aD%aD%`D%`D%`D%`D%`D%`D%`D%`D%`D%`D%`D%`D%`D%`D%`D%`D%}`D%u`D%m`D%e`D%]`D%U`D%M`D%E`D%=`D%5`D%-`D%%`D%`D%`D% `D%`D%_D%_D%_D%_D%_D%_D%_D%_D%_D%_D%_D%_D%_D%_D%_D%_D%}_D%u_D%m_D%e_D%]_D%U_D%M_D%E_D%=_D%5_D%-_D%%_D%_D%_D% _D%_D%^D%^D%^D%^D%^D%^D%^D%^D%^D%^D%^D%^D%^D%^D%^D%^D%}^D%u^D%m^D%e^D%]^D%U^D%M^D%E^D%=^D%5^D%-^D%%^D%^D%^D% ^D%^D%]D%]D%]D%]D%]D%]D%]D%]D%]D%]D%]D%]D%]D%]D%]D%]D%}]D%u]D%m]D%e]D%]]D%U]D%M]D%E]D%=]D%5]D%-]D%%]D%]D%]D% ]D%]D%\D%\D%\D%\D%\D%\D%\D%\D%\D%\D%\D%\D%\D%\D%\D%\D%}\D%u\D%m\D%e\D%]\D%U\D%M\D%E\D%=\D%5\D%-\D%%\D%\D%\D% \D%\D%[D%[D%[D%[D%[D%[D%[D%[D%[D%[D%[D%[D%[D%[D%[D%[D%}[D%u[D%m[D%e[D%][D%U[D%M[D%E[D%=[D%5[D%-[D%%[D%[D%[D% [D%[D%ZD%ZD%ZD%ZD%ZD%ZD%ZD%ZD%ZDHy_$\11H^1.5(E1ӭ PXPZ18*FfDH=9%H2%H9tHF]Ht H= %H5%H)HH?HHHtH]HtfD=Տ%u+UH=]Ht H=~ )d%]wHHPHfDHHff.@~@GH|fDHHHH9tHHHH9}HHDxOLcljJI)IHHHL9t'HH H<L HH9}HI9ATUHSGx0HcЉHH)L$HIH} HHH(L9uH} HtH}Ht []A\[]A\ff.HAUATIUSHHf=~6v~!1HcLHHC H49kH[]A\A]ff >%tD8%~01L-װ1LL讪9- %%HKfu|HtHqL1qHQyL1[%F@-%H[]A\A]fD%H[]A\A]fDHLH1[]A\A]AWAVAUIATE1USHHcoL x5HcЉHHHHMtII)HH(IL9uMt!~FNHcHHII}Ht MdHL[]A\A]A^A_DHDHD @t9HHH뜐HH0Hv0CHV@HF@AUATUSHG$LgxMHDM,DAD$I\$~&1H{HtHCH(A9l$I(M9uH[]A\A]HGHcHHfDH]Hl%^%H8fDHtUHH]%Dff.@HtHHH(D1ff.fHcE1HHu ADff.HcHHVx^AVAUATIUHSHZLltHL9u[]A\A]A^DDsLDtDHLDff.@AUIATAUHtDLH]A\A]T@]A\A]f.Hc1HHJf.H:Tu9y1ff.fHcHHx1  HHH9uff.HU @AUATUHSH?~uE1fDIcHHEHH|7HUHڋr~2E1fDHJIcAHHHxHUHD9jHzAD9eH}E~ 1fHcÃHHEHx蹺9]H}[HH[]A\A]If%5Yw Hh8![wH-HcH>5f.=*5D=5D=(5D=)5D#*t=&5DD=$5D%=O1>D3D///='5Df<5H@=5D=>"5Df1=D@2=+5Dff.@*wH HcH>=u/tV5Ã=u>u-Ã=u*u.Ã.1҃.!¸5)=uLc H8L[]A\A]A^A_EuHHL$IcH HL$HHH1IcՉtHHT$HDA~KH|$D.Hp H;5p%HQT$$LEAaD9;1LEA!D9;HV1H5ؔ|HMp%HH3p%HSH511L-6Lct$$Hl$EODHHI9t=HHA؃sHHH蝄LH1ۏI9uH51ÏYHD$(EAH4HHH@H81D9;H|$HHD$HD$Hp H@HKHH8H81[]A\A]A^A_鴋H=H=ff.UHSHH4<uFE~51 9]~&HcHHEH4H~ uH9]H[]H5l1蝎ff.AUIATUSHHHHH4HRHCHtKHcLJHL$Љ A,$ID$ID$ID$LID$ H[]A\A]H=fSGHHHH4HHCHtGHcSJKH HHHiHBHBHBB [H=ATHcUSHGHL$A$I|$pHcH=ID$HtIc$HJA $f(fX[]A\H=Yff.AWAAVIAUATUHSHHGD/HD$E~DHE1@AHE9t+D9;uH{LJuHD[]A\A]A^A_@AuH|$HcH{HEHthHcULJHL$ME<$$ID$H9uL+eILMHIH51H=sff.SGHHpHcHHCHt(HcSJHHЉKH@H[HH=5DAWAVAUATUSHHH8( -HD$(H HD$(Hș1HH@H@HH$CLk H\$(HDMdfA}Mu (M~袴HH HE L}H{HEEpHEHc aHHCH HcL$JL H,HU2INpAVhHLM$LE LI(M9:HD$(DE H\$(HCH8VoCDH$)$@EDŽ$HD$(Hc$H@H $L4H7DE A6IVH$H $HD$xHD$(H@LHFFЃFD$h1D$lLt$ HAwH H$I΅YD$4MD$4L$4A;O3HcT$4Ht$XHH4уsHIW HT$8~D$MfDH|$8D$L$;HL$8HcT$HIHы tI}.pHHHt7DHH9 ;J uL:[LftTHcHIFxBH@Ll$pMH$HDHD$PH$H$H$H;D$PuMLl$pAE-DMD$4L$4A;OMLl$ Lcd$hL4$1L|$f.H$HcME1HHXELl$EAH݋$AI(E9t{I6H}MtHDELl$D{H$;h|Ll$ L|$Dd$hD$lD$l9D$hH|$ HcHHH@HL$XfLl$HDEt$LIcH4HMIHH|$H3KDcIDMcHcW$H0@HHH@@PH$LH$fpHcHIEHH[IcE$PHHŋAUE >EHEIH$LXHcHIEHpHDHt$H$HD$t*fDHD$HD$H;$HD$uHD$LXtHcHIExHXMHDHD$@tHH;\$@uMkL;tHcHIExLpH$IDLHD$HtHH;\$HuH$kLtHcHIExLxAIltII9tAuEwLDtIcHIExLpIDHD$`At@IL9t$`tAuAVLLH08D|$hHt$ L !AGLF0HMHH$I,A8E1MMAEAI(E9AL$uHD$ HXIEZEuSA4$A;2uJABA9D$u?CID$IRHHt0HHH9LZL9XtDI(D9uAI(E9rEME4Ht$ |$hL:H$$DL$hERHD$x@H|$ 4HL$($$;^H$HyH1>HD$(~HHEHcӃHHxټ;]|H\$(H{ƼH込H$Hĸ[]A\A]A^A_AD$t?LοD1LD$L$謁H.L$L LD$8 H(H9tADSEu~HsHHFHTDD9(uHH9uH(H9uADL$hEHD$ H<$L`H\8@E$EuH|$xAD$I(L9uLt$ Ll$xI^I I(L9thE|$EuA<$~3IcAt$LAHID$H Hc@HAT xE;<$|At$tAt$1LI(vxL9uHD$x@ E1~IcAHHCH8uD;#|H{H(H9uIWH5&1HD$ H0@Ht$XIVH511L-KEF AN1IVEN$H5wEFEA9n$ *A.H5HcDEA9n E1HE1oI^;Lc~TIc<$HD$(IAHHxsAT$LH1,D;;}E~H5~1H5mJ1~A;n@IVH5$1~H5R1~B|$hH$L$Ht$ %H+8HDŽ$.H=^H=]H=?H=`־fDUHHH]S{UHHHt7{HHtH/tuHHtH/tSHHtH/t1H}0tH}HtzHHtzH]zfHGP0HGP0HGP0AUAATUHSHG$IHtfHDHǀ%I$HHt]I$DHI$.I$IL$H9tHHJI $HBHZBHL[]A\A]smfDLE1yH-HH81xfHHHH@ H@H@H@H@( H@0H@8@@HǀHǀHǀHǀHǀHǀHǀHǀHǀHHǀHǀHǀHǀHǀǀHf.AVIAUIATUHSHIHtw I$HtxID$ID$H ID$Mt$0M$I$Ht5HHxXI$HHt(H谯ADŽ$[L]A\A]A^LE1ůATIHUHSHA=tHHӸ[]A\HAԉ=tHHf.HHt_wHt utf-@8@[H]A\ÐE(1HDžwAWAVIAUAATUHSHħL=]*IIHtA$H萻HDL肄HuMHA$!uEuXH$H84͕yH[]A\A]A^A_D1@H fquAWIAVAUAATIUSHHHWI9INHHc{$AH4IHHcS$~H1HrnAFtlL-$HHH{HHt5@LHHSLHLcHS0L{$AHuLwuHD[]A\A]A^A_DL-'H;HLE1_yAAWAVAUIdATIUHSH{HbHIgH(MtH;LH}1tH;:LdLt*u!LE1fHL[]A\A]A^A_@ALA^HHuJTHkL9swHtLIHtJL<LL)uuLM HA| uHsL裇IHaL踔CxHfDLE1蝔H&H5>|H8wfMHsLAIHwE1HHHAuAuwHpHtHHHH7HH1AHDAD@ H@HP(HPHDA@$AH@@HP0HPHEH@HHP81HH"H5n{H8蓵Hm"H5ƦH8vff.@AWAVAUATUSHL=%IH H9H&HIIH8:H=T%IH葑H=T%I=HgqHLLjHL]H=T%HHHɇLhLIHLHHH{HL[]A\A]A^A_fLgpcH%HLLHZ}HS%IHH!H5yH8zDHH %Hf.[uCfDE1=H"H5}yE1H8至fHtHGHfDH迃Ht 1HHH5¤HD$H:5HD$ff.AUATUSHHhdH%(HD$X1HHHHGHHtZHHtRIHLAąu;H$LHEHD$H諹HD$XdH+%(uYHhD[]A\A]DHH5AH8\赂AHuHH5H84͢ff.fAVIAUATUHSH0dH}0AgHH1DHH1H)HH=KoIHH!5EDALHwLPH5CU P1AV艹H IIEHIEHMtXH5T LɃI,$ItMt:HLHt H/uHGP0He[]A\A]A^[1]A\A]A^DH 1H8ol[1]A\A]A^@IELP0dID$LP0qL1ƙHHtH(H@P0sAWAVIAUATUHSH^HHH$HL$dH%(HD$81H~HT#f vkHJT5HM~E<#H$ǀAHD$8dH+%(HHD[]A\A]A^A_HrHH9tT#sH9oIL|L-I)f<=tu>H$AHHHH5rD$H81EyD$H$HD$HHAtFHǃAf|$/8H-:rEH$@($H HH5FrH81xH(iD$f|$/8-HUHpHHHLHLHH)H)ڃ1ɉσLD=L>9rf|$3-1k|$5`8UڋLLܛLfLr|$3n-1-wf|$3-1P|$5-Eff.HOHHt HHtHH/HQH5H81wHAUATUSHHhdH%(HD$X1HHuWHtRHI1H}AąucH$HIEHD$HKHD$XdH+%(uCHhD[]A\A]DszHuHH5H8A胚AWAVAUATUSHdH%(H$HGHHcH8YHFIHHBH88Hl$`H|Ld$LL|AŅHD$ H9D$pCHttCLc0FHNHc|$4HhIHDt$4LD$@ED1HLD$H^LD$AVLITDHHH9uHtQHLD$@Dt$4HLDLtrLHٛLLI˛HT$(LH蛲HuLmeH%LH$dH+%(HD[]A\A]A^A_ÐFL3HT$ Ht$H|$`'H迮L跮DLHDqLHLLI HT$(LHٱ?HEH5H8NHVLNA&HH5%AH8HAh蓗HHtKHWHB`HtH@0Ht HH!HRH5H81s1HDvHuHWH5H8xfDHHtKHWHB`HtH@8Ht HHHRH5ƘH81s1HDsvHuHH5H8fDHHtKHWHB`HtH@PHt HH!HRH5nH81r1HDuHuHWH5H8xfDHHtKHWHB`HtH@@Ht HHHRH5H81r1HDsuHuHH5H8fDHHtKHWHBhHtHHtHH!HRH5H81qHHtHuHWH5H8xfDWATUSHtkHWHHZhHt3HCHt*IHyHHtHx/IHC[LH]A\HqHRH56H81p[1]A\DCtHuHH5PH8ȣfDAUATUSHHHOHHYhHtIHC(Ht@IIHyH HtHxBIHC(HLLH[]A\A]f.HHQH5H81pH[]A\A]sHuH H5H8fAWAVIAUL-ATAUHSHoHdH%(HD$1AI~0 Adžu=LLHuAdžI~0t I>Ht_IF E1IFIFIFIAF(HD$dH+%(8HL[]A\A]A^A_ÐIv0qA*MAMIEHI9EkL`IHnIEH$IHt H/uHGP0H$McI92IdžILLHʫBD%IEHHAIE IELP0@I~0HD1HܔIHABIA4$L@@ymfD@@@:@fDS?HuHcH1@?@xf.HLhIHImIELP0S?vfAI@H5D@H H81lI~0AdžV^ALrHAAdžHIEu IELP0IDL)K<'HaIHL$$LI1+IH3H LLhcvfDATIUHHq1LHH讃HtAHH辨HmItHL]A\fHEHP0HL]A\E1HL]A\f.AUIATUSHHiqL`L轧H HAu#SH{HtkH u SH{HtI uSH{uEt  HH)HI9vHu2H[]A\A]f. tEuƅuHH[]A\A]bAE(AUAATUHSHIHHDHI$HHt}I$ADŽ$ADŽ$IDŽ$gI$Ht:8utf-fPI\$I\$I\$I$HL[]A\A]f.LE1őHL[]A\A]AVAUAATUHSH dH%(HD$1IHHHDH$HD$I$HHgIDŽ$H@I$EADŽ$<I$E1UH1ɄufPHt" uHcHԃtPHuIDŽ$H$HtA$ADŽ$M$Il$Il$Il$I,$HD$dH+%(@H L[]A\A]A^fLH5H=ϪzunI|$0ADŽ$tI<$Ht$XID$ ID$ID$ID$I$AD$(LE1ԏYM$I$MLHIHbHPrH}HL56LHH)L'I$Ht3H8IHh HIDŽ$}A$}Ht$HoA$SH)H{LLI$Hu/UH`dH%(HD$XHGHHtAHHt9H1HЃt2HJHT$XdH+%(uH`]1@+1袉fHtHGH@hHt HHtLH2iHt HHHH53H8諘fAWAVAUIATUSHHLcL;c{( wH{0H6HHH H0HBH8ziIHN1HHLHfUHHHt }HHtH}zLs LML{HLD$M)M)jH|$N$8It$]H@J<8HHH{HvHTHL#LcILLcHC {( fDH{ LMsHLD)H$LC( LLD$(jLD$I<H{I9BG< 6E1,f.HkHiH|H{ LHC IM)HMDL)L HLL[HthJ IH<(HHSL H1MHHH{HL{HC 2Hiu&HC fNfDC(HCHCH[]A\A]A^A_DHH HC( sDMtLRH+HHkHhHHCHHC%f.HHIRMCID$Mt$ HxўHHLH*I,$(ID$LP0HIHfH{MHGLcLI9| rG HH{^M)ăNHH mH=LH{C( HQC( HH@H=1#z-fD 讝HIHH HLHCHLLƒuAC( E1䉃MO@H@ME1~H1|HHHlH LC( e L}Ht>HH{ LHCID$HCA$H[]A\A]A^A_LfLI9uC( fDǃH{0t H;HtOHC HCHCHCHC( HfH;OHHOC(4L#I,$uID$LP0C( USHHhHH@HUHcDJu_u@H%HUHcDJuC( tHSHJHKH; rJ9tB1H[]H=ǀf.AWIAVAUATUSH8DHt$HT$dH%(H$(1HHHG EoAIWIW Q EEwIG HL8Ń IGHIG #߃A_ gHƒ.H HcDA'"L\A OALJLIG lŃ 4HIGHIG ߃A;fE1E1E11,߃Bu+E1E1LŃ"tL'tGD D tDD ߃ULE1E11AŃ"ufL9 1Ƀt)IWHrIwI;7t r9tB`E1L`u 9$\uL4f LŃuE1A( tA8H$(dH+%( H8D[]A\A]A^A_@E t;uO߃FuEAE11DRuE1AD߃RuA{fD1AfDAML^ʼn߃AvߍEЃ v_t҃̓t!IGHPIWI; P9t@hutIG HL$AHHL$IGHIW H)H:asynA:A7:awaiAAI Iw1H)>HH^x xH贔GH#eHm+AG(#ALJEuA IG ALJ11L t t& uHL11 uAO8ؙÉAŃ롃tMIWHJIOI;o J9tB ƒ#tt}uIgEEIcOYHT$L0<Ņ.HT$)߃EuFLHT$mHT$@ՃHHcDBcLŅ)߃Ju L'Ńt!IGHPIWI;P9t@hIG HL$AHHL$IGHLHD$HT$HcH Dq.Lƒ.t#IwIHFIGH9p~9t VIGIHPIWH9Mx.t@.IG HL$AHHL$IGH({?}AfAALމ‰D$ T$5BAIG HL$HHL$IGH1A8AG(IGIGIGAG(A8IGkEEu!L}zA$DIHt$ LZ}( pAD$HEHHUH]H)H)AT$H{ iID$HHE1fhIHH(ffDA>uA~@IyA$L8yE1HsHD$HdH+%(HXL[]A\A]A^A_E(A$|$,MIDžIHt$ L躉MWHnSvIHHPHxhgIEHH H|rH:HDžMu MAEA$DMALxEt$ A$A$E1A$ HU@< t<< t8Ht-<#u+fBHt< u< u@BHA$LyA$HE1q$HuHHxID$3lAWE1AVIAUAATMUHSLHA I@AI@I@ HtfHIpDLuCnHHtnID$ILDHHHH[]A\A]A^A_o8HfDH= B HLHAH9uHHPHHu(HCHP0HHHHHHH[]A\A]A^H+t"MtLHAH9t[]A\A]A^fDHCHP0@H9AU`ATUHSHHbH; tH[]A\A]fDH(tRHLcL;%L(tKHEIL$LH7H5!fL@16=H1[]A\A]fHPHR0@HCH5pH8auHEIL$LH6H5GeL@1<1Dff.fUxHSHHvH;t H[]fDH(t:HEHSH5[eL@HHJH 6H81[RHLIOIJff.fATUHHIHHGHHPpHtHRHtH]A\fDHPhHtVIpHN`HtBHt8HILH0GIHu /Hu6HLH]A\>HzuQHPHH5VH81M+H1]A\.HuHH5OH8@^fDHHVH5UH81*H1]A\fHAUHATIUHHHGIHPpHtHJHt ]LA\A]HHhHt^IpHV`HtJHt@H!LH0FIHu -Hu>LLH]A\A]ZHy(u)HPHH5PH81*]A\A]fHHVH5TH81)]A\A]d-HuHH5qNH8\ATUHHIHHGHHPpHtHJHtH1]A\@HHhHtVIpHV`HtBHt8HLH0EIHu ,Hu6HLH]A\!8Hy(u)HPHH5SH81(H]A\HqHVH5nSH81(H]A\B,HuHH5OMH8[DATIUHHtUHHtM HHthLHSHmAtHD]A\HEHP0HD]A\+HuHH5LH88[AUSHHHHRHB`Ht7Ht-HHH0+DHHt:HHH[]@H1HRH5RH81'H1[]HD$*Ht$HuHHH[]fDAUATIUHSHH;tH[]A\A]fDHUH(HZhIT$LjhtaHtH{LHHucMt I}HuOID$HUH5OL@H\HJH H81&H1[]A\A]fHPHR0@HLH[]A\A]ff.AUATIUHSH=H;tH[]A\A]fHUH(HZhIT$Ljht)HH{HHt'LHH[]A\A]fHPHR0@H{HuID$HUH5NL@HTHJHH81%H1[]A\A]f.MtI}HtHLvAUATUSHhdH%(HD$X1H)HGHVHH9H@`HtHH5TH aIH011HImIMID$H9uyHP`HHLTI,$Hu ID$LP0HtzIH9]ttHxSHmIubHEHP0VfTIHtDH9XtALESI,$H'ID$LIP0'IHE1HD$XdH+%(HhL[]A\A]f.IELP0['IHuH}H]H5H99I1HL*jHt$H<$/JHHt&HpHx dHmIu HEHP0Li]@HI@IHPHH5NNH81"I,$ID$LP0fHuHuWH=HD$XdH+%(Hh []A\A]XcHyH5"GH8UYDH}(f.HD$XdH+%(ubHhH []A\A]9OfHD$XdH+%(u2HuH} gHEH5MHPHH81!EfAUATUSHHHL-HL9 HG`HHHHIHHXL9LH7HELCHPMHHHMH81KTI,$AD$uID$D$LP0D$H[]A\A]!L7u\HH[]A\A]:f.K$IHE1HL[]A\A]fDHEIH[L]A\A]fEH[]A\A] @I,$u6HEHKH5)LHPH־H81D I,$zID$LP0jfH H5DH8*SIDATAUH}^HtXHH@u8HqH5LE1H8RHmu HEHP0HL]A\DHIE1ff.ATUHHHGHIH@hHtH@HtH]A\HX>tLL,RIHt\HHI,$tUH;t H]A\@H(~fDHEH5KHPHZH81H1]A\fDIT$HD$LR0HD$딐"HuHH5(CHD$H:QHD$mHPHR0yATUHHHGHH@hHt4HPHHtH]A\f.H@HtH]A\fDHHt$=t_H|$PIHtmHHI,$uIT$HD$LR0HD$H;-u5H(u HPHR0HEH5eJHPH H81x1H]A\fD HuHGH5AHD$H:cPHD$ff.ATUHSHHHGHXpHt[H{tTHH IHt]HHSI,$tH[]A\IT$HD$LR0HD$H[]A\fHPH-H5IH81H1[]A\fHuH_H5AHD$H:{OHD$po0HGII?IIHt2HO(HTH~#1D:4H@<H@rI9HHHG1HtHWHRpHt 1Hzff.fLG8Hcw$Mt7HO~$H01HH~I; u`HHH9uD~@HO0VHAH41HH9HHH9u1HD1ff.fLG8MtKW$HOx?HcH0HH)HDHHH~I9 uHHPH9uf1ff.fSHHHtHCH/t1H;Ht HH/t [f.HG[H@0DHGP0HuHHHaHff.H%H9GtHH@``hH9FuH#H91H9@H! ff.HնH9GtHH@``xH9FuHӺH9@H9 @k ff.HH9GtHPH@``pH9FuHH9@H91@ ff.Ht6HtAHH9sH"ft'HH9uH'HfHuHyH@HwHtH(zf.H=yd@Ht6HtAHH9sHft'HH9uHHfHfuHH@HwHtH(f.H=@Ht6HtAHH9sHft'HH9uHHfHּuHYH@HwHtH(Cf.H=YC@Ht6HtAHH9sHrft'HH9uHwHfHFuHɷH@HwHtH( f.H=ɺ @HtVHt4HH9s^H 1fDDHH9ttHFHÐHcx H<[ 1HwHtH(Kf.H=K@HtVHt:HH9s^H 21fD HH9ttHHH<1HwHtH(f.H=it@Ht~HuHHDH7H9stH5pE11!fu˹AHH9tuިttHAH9uIcf1@H<1ff.@HwHtH(jf.H=T@H~$LX1fD A  HH9ufH~$L1fD A  HH9ufH~oLPE11,fEuH AB HH9t5D GLAuAt%Et(H B HH9uE1AH~WLLNHAuGHH~3fDAtHAt H ) 1LHH9uHٷff.H~WL@1@H B  HH9t0DG LAuAtH B  HH9uff.@ff.fDHGHtHG(HYATUSHtqHWHHZhHt;HC(Ht2IHyHHtHx7IHC([LH1]A\fDHHRH5vIH81[]A\]HuHH5j6H8DHHtKHWHBpHtHHtHHHRH57H81tHHHuHGH55H8hDfDgAUATIUSHHHGHXpHtiH{tbHHIHHthLLHSHmAtHD[]A\A]HEHP0HD[]A\A]HPHH5>HH81AHuH[H55AH8xCfDATIUSHHGHXpHtWH{tPHH-HHtY1LHSHmAtD[]A\HEHP0D[]A\fDHPHUH5GH81A/HuHH5<4AH8Bff.UHHSHH8?Ht"H~1@HLHHLHH9uH[]f.ATUHHtXH1fKIHtSHHHHtSH(tHL]A\f.H@P0HL]A\fDCIHt+E1HL]A\DI,$uID$LP0@HyH5"3H8ASHH1JHHC[ff.ATUHHtPIHHHtJLH2 HmItHL]A\DHEHP0HL]A\[IHtE1HL]A\DHH5R2H8@AUATUHtMIHI$HHt\LLH HmAt D]A\A]HEHP0D]A\A]HuH$H51H8E@DAATe;Ht(H(HAt DA\H@P0DA\HLLH]A\A]A^G7E1vATUHHHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81HHt?u4111HvHT$8dH+%(H]A\H$Ht$ D$ HD$(HD$@D$$0HD$0IHtqHD$H@t51LHx)I,$wIT$HD$LR0HD$]Ht$1ɺHf.Ht1)H1H5%HD$H:M4HD$$ff.ATUHHHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81HHt?u4111HHT$8dH+%(H]A\H$Ht$ D$ HD$(HD$@D$$0HD$0IHtqHD$H@t51LH'I,$wIT$HD$LR0HD$]Ht$1ɺH f.+Ht1)HH5*$HD$H:2HD$.#ff.AUIATIUHSHdH%(HD$1<H}LHuqHHHEH,$LH1ɺ)IHmu HEHP0HD$dH+%(HL[]A\A]kHfDHD$dH+%(upHL11[1]A\A]L1H#&IuID$H5D7E1HPHH81$ZE1K!ff.ATIUHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HHtHHtH$1LHHD$HHD$ $D$0HD$HmIt"HD$dH+%(uRHL]A\@HEHP0@IHt E1fDHٚH5!H8/ ATIUHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HHHHLHHH$$HD$HD$ D$0HD$HmItHD$dH+%(uOHL]A\ÐHEHP0@KIHt E1fDHH5J H8.[ff.ATIUHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HHtHHtH$1LHHD$HHD$ $D$0HD$tHmIt"HD$dH+%(uRHL]A\@HEHP0@IHt E1fDHiH5H8-#ATIUHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HH~HHLHHH$$HD$HD$ D$0HD$9HmItHD$dH+%(uOHL]A\ÐHEHP0@IHt E1fDH1H5H8R,ff.AUATUSHHT$pHL$xL$L$t@)$)$)$)$)$)$)$)$dH%(HD$X1HH*HHH\$0HL$D$H$@HT$HD$0HD$HD$`HD$ BIHtsHT$1HHqHmIu HEHP0I9tLpHD$XdH+%(u`HL[]A\A]SIHt#E1fDHmuHEHP0DHH5:H8*Kff.ATH5u USHHh%H@%IH@h%MtL9#H HHHx[HL@HD$JlILrHHuHu@L9ImHD$OD+HmuHEHP0f.H|$Ht H/uHGP0Imu IELP01HT$dH+%(H []A\A]A^DHH f[HuHH5hHD$H:HD$@HmU Lt$L1LGAŅuHHt$ H|$HuIAL돐H9{H5]AH8mA[DLH)xHH >L^Ht$HLaHDL71LVNDHf.AIL II)D8MDHI9uHt$L1+fDALIIH 0AHDHH9E: u1LdfDD<E8< uHI9uHH?IDI9tALIIH 0LAHDfDI 4IHL9rHI9:uH)HH?IrHL/HuZHHwHtH(GH=4@AWfIAVAUIH1ATUSHL%~H|$Lt$@H$DD$H$H\$8dH%(H$1H$,HHD$0HO|OO:H$1HD$(Ld$8Ld$@f$)$)$ 1HT$ MHHLƄ$H|$8L9tHt$(vH|$@L9tHt$0ZLD$ Ld$(L|$0LLD$LD$H}LLD$H0Ht,H=wDD$8E1M9MHHtHd}H0tSHwH5H8* f.IH$dH+%(HL[]A\A]A^A_ LD$M1LLLD$%uH\$@HD$PLD$M9AMy MLHMy MLHLL)H9Hl$LH~|$Hu~fDM.LO!f.LHHHH)HDHxHtD:tHuI,fDH)H~HxLHHHHD$1D\INT 1H 3AIL II)D8MDHI9HD$LLd$1-AL2IIH AHDHH9CE:2u1L|5fDD$ E8$u HI9I9AL2IIH LAHDfD3|$uTH HHH9rfHH9:uf.HM?H HDH:tCH9rffDLd$HIfHLD$3LD$H-H)IHLHH)HD LXLPLADHD 3MHIL A8LDHufDHLD$LD$HpLDD< D8<uHuIHt#LHHHuH)0L) Iff.AWfIAVEAUIATIUSH1HHdH%(HD$x1H|$EHT$HHHD$(Hx,Hl$@HD$ HD$0HD$8HO|OO:HD$@1fD$p)D$P)D$`1HL$0HHT$LD$8LD$q4H|$0H;=`xtHt$ H|$8H;=@xtHt$(tkHl$L|$ LD$(HEt|H}1DHH9]HTELLLLD$LD$u1HT$xdH+%(HĈ[]A\A]A^A_DELHLLttOHT$xdH+%(uyHĈHc[]A\A]A^A_&fDHtH}HYuHmL%rI<$`SHEI<$HH5~HH11HAH7HHwHtH(7H=iw$@HAHWHHwHtH(7H=w$@AUfHH5ATE1UHdH%(H$1HLl$P)D$PHL)D$`)D$p)$)$)$)D$)D$ )D$0)D$@tHLSIH|$XtL H|$tH H$dH+%(uHİL]A\A]HHAHSHt HH1HfHHwHtH(wH=ud@HHAHFHt+HHt HH1oH5H81Hff.HHwHtH(H=9u@HHAHSHt HH1HfHHwHtH(鷿H=t餿@HHAH3Ht+HHt HH1nH5H81Hff.HHwHtH(gH=9tT@AWfAVIAUATUSHHMsH<$Hl$0HL|$(1H$ILdH%(H$1H$HT$HHD$ HO|OO:H$HcountH$1HD$H\$(H\$0HDŽ$DŽ$Ƅ$$X0H|$(H9tHt$H|$0H9tHt$ мH\$Ld$Ll$ HH:rHH0WH}H=D$(1ALM9MMy MLHM)MHI9ILIHtPHFHHtHqH0tOHkH5 H8Zf.E1H$dH+%(HL[]A\A]A^A_<@HG1HHbuHD$0LD$@M9MMLHMM)H4$LH4$IN$H4$MHHIL$HD$FTMXJ<A1IHf MIL MI)D8MDHH9uHD$LE11*fDLIIJ AHDHI9gD:uL<$1M$@D<E8< HI9uHII9$L@ALf.E1uMJ .E1HH@HH98uII9ufI9_LIIJ LAHDHHwHtH(7H=o$@HGHHx ff.HATUHSHGt(cHÉڸHwJ[U]A\ IHtSH+I,$HuID$LP0ڸHvHhH5 H80[1U]A\Ð[1U]A\ÐSHtHT$HOff.@ATUHHH5 SH dH%(HD$1HT$taHRh1H|$H9@IH9tHt:1HH1#I,$t,@HT$dH+%(u/H []A\1@IT$HD$LR0HD$@ATUSHHH5HdH%(HD$1HT$D$uA1EtEH5D Hߋl$IHtpHKHtGLK(~~HsML1H=HT$dH+%(H[]A\f~sHsLH=T1@+L%kI$zf.1HLHHsMH 1H=4iH=,HBfUH5C SHHHHtWHsHt6H{(1{HHsHI1[H H=q]fDH=J贺HCH-,jHEDAUATUSHHHHH9HH=eIHt*Hu7H@ E11I\$Ml$ID$(AD$0HL[]A\A]@LkLTID$ HtHueID$ f.I,$u ID$LP0H[]A\A]ߺHdH5"E1H8xf.HHHrID$ ff.HwHtH(隻f.H=i鄻@AWfAVAUATUHHH5SHdH%(H$1H$HL$`HD$XHD$HLD$X1HL$)$)$)$)$)$)D$`)D$p)$)$)$޷HD$`H\$XL$L$HD$ HD$pLMHD$H :M/M@H|$%L9IAHOHL)HHH9D$,Ht$1LL$(HL,IH H}LL$(L=hI|$EI|$(Lt$HkHl$(N,7I4HL$ HD$(H LD$M4LI@AIPLM9uLD$(II)MLLL*xDMH|$#M H=[gLCI>H|$Hm(IMEMM)9I/INM~1HL$(KD=JT=IHD$8D1HT$HALIIL II)D8MDHI9LHT$E11H#LHHJ 0HDHI9^D:uHD$1HtAD 8u HI9HD$I9/ LHHJ 0L؃HDHieH5H8BfE1H$t H|$8H|$ht H|$&H$dH+%(8 HL[]A\A]A^A_f.HMUH=e1IzL;t$IKMMM)vIlI~M~LD$01H|$(KD=IIHD$HDNT=1ALHHH LH)D8LDHI9LD$0L11(@ALHHJ 0HDHI9RE:uHD$01HtfAD 8u HI9HD$0L9 ALHHJ 0LHDfMH}(fDHfL}(E}Nt HE1MII9HxLDH)HuMLMHD$HHHL)HHH9H1J4 蒵IHHxLh(Lt$(HILd$0Ld$IHLLHD$L)HHt$ I|-LHL$N, LqHL Hl$(DLL)H@H?L9uHt$ LLMIfLHŴIDH=b@Ht$ LLL$FHLL$HnH\$LInIMH\$ LL$ M4Ld$0MI@A$HLHIAHHM9uHl$(LL$ H\$Ld$0III)1MIIH-LL1HT$0HLD$ LL$H)ڳIHHxLL$LD$ HT$0Hx(JD LKLd$0HD$Mf.HD$8LL$(10M1@ALAIL MI)@8MDHI9AII 1,fDLLHHJ3HDHL9@:4uHT$ 1HLAT8u HI9HT$ I9t"LLHHJ3LӃHD@HtRHH_HT$HHLHH)MtIIM)x JT=Ld$0H#qfDHT$Ld$0H)fI`MM)jI`I~M~1AH|$(KD=JT=IHD$8D1HT$HALLHH HH)D8LDHI9HT$LE1,DBLHHHK0LDIM9F:u1JL@A|@8<u HI9I9BLHHHK0M؃LDEuL|$HMNl II9HxLDH)QHuL|$MM+H\$L1H)IHHxLx(HLl$ELd$ II*DHLLL)LcHIEIHl$DLL)H赨HHuHLLd$ HLU1HHIsHHL$LT$8L)LD$0HL)HH9+H1LL$@J4 IHHxLL$@LD$0LT$8Hx(JD Ld$8ILHD$0Lt$L[f.HD$HHL$(11H|$HH@AL5AIL II)8IDHI9پH|$HH 1(ALIIH +AHDHI9A:uՈD$1M$AD A8 u HI9D$L9t!ALIIH +HAHD@HM9tiLHL\$iHt$ LHHVL\$J<3M ,HT$0L)MtIII)xO9Ld$8LHt$ LLL$@L\$LL$@L\$HLI@HT$0Ld$8LL)H=$\_MII9HLxH=[EuHD$ LHLL$DD8LL$HIL1LL$襭IHHxLL$HH(HLHLL$"I)LL$HJ(D8HxJ, HuPDD8HxH:HDH)iHu"MRML=[5Ll$LLd$ LH)HLD$pLl$`MH|$ H9HNHxILD$IHH|$XLD$MM)L\$(I>M5IXI@L|$0II|Hl$ ILHD$H|$81Ld$I@HD$8IM181DALAIL MI)@8MDHH9|AII 1(fDL2LHHH.HDHL9^@:<2u1I 1f.EDD8u HH9|H9L2LHHH.LփHDHL9~DHl$ HD$LL|$0Ld$LL HLHHU1IT$H,I\$H|$H!H$dH+%(HL[]A\A]A^A_DHk(I(u I@LP0I,$u ID$LP0E1H?LLt5ZIHI HD$H@N Lt$LL$ IHD$IL9d$tL\$(L+\$ LL|$0Ld$LLH+t$HHtJH HLHEHHHEHHEHP0Ld$I,$u ID$LP0E1H|$HHD$@>LL$@I) IALP0H|$ H9HNHxIH1E1H|$Lt$@I9HHUfDI9HH|HHTuHYI9H UHI9~ TtHH)葥IHI gID$NIM9aI9~$HTDDHI9uLl$Ml$`I9tH|HQfDHLHD$LD$dI({I@LP0lEmHIHCM_H|$7E1L1MIfHDD:lt)HI9LMII9OMt$@HH|H)XIHLI fIFNHCII9~L9d$uMLH|H)HHpH|$ ID$H|$H,Lt$ImHLHD$LD$'I({I@LP0l HYKH5TE1H8I)Ld$IALP0I9LH|H)KHHH|$H lID$H,Ll$IHHEtHEHP0eM]HLHEuHHEHEHP0HLHEu[HHEuHEHP0qI(MI@LP0HLuHHjE11HHEHEHP0HH[CLt$ff.fAWAVAUE1ATUSHHHHH ) HL%.OdH%(H$1LL$0LD$8HD$0Ld$8辒HD$0LKH|$8H$MH-OH4$LL$HHHIH$L9HD$@1HHD$(`Lt$PLd$@LL$MH<$ LL$H9HNHxIKqIH7H<$LL$3LL)IHIFMVE1AHD$fDA$LH|$LЉHA MHIL 8HDHuHL:fDHHLL$PHHtyL$I wHLL$L$HEHIXHEu.HEHP0"HLHHt1IUH,I]LcyImu IELP0E1H|$(H$dH+%(HĨL[]A\A]A^A_Hk(@TaHHuHH)TIHt`I JIEN$IM9HxHqNDHsL4$MuL;ImFE1(fLHHHHL)HDHLHL:6LED8umHuILLD$H)H|LT$iLT$LD$HII ]IENIL9$tHIL)HpHtLHHu L)O@H)CLLLD$ LT$L\$L\$LT$LD$ IHIjICLD$LLT$P0LD$LT$GH<$ H9HNHxLL$HIE1H<$L<$IY@H?HLfDH&THHuH|fDHLI$HI$ID$LP0I\E$$!LL$HILH|E1H<$MfHDD:dtHsML4$FfH)H|HPIH[I vIGN,IHCHbL94$uMHHpHH5H<$ jIEH<$H,H$HIELi@HLImtIELP0eIELP0HECH5@E1H8HHsbHHjH<$H IEH,L4$I3HIWICLP0HH!1!HHE)HEHP0MHI$ID$LP0JIXHLλ袚H1HHLTHErHHE}HEHP0nHL HEu?HHEHEHP0LMI/IIIGLP0:HHEHEHP0E1|HLԙHHL4$MAW1AVAUATE1USHHH5JHdH%(HD$xHFLD$HD$1莋H|$H;=FH|$L|$ 1LЩHkLd$ Ll$0HH[(H E1II9B4;LLN4;HuH@HEHH4+LLHuL)HHD$H;EL|$ tLHLwIHD$xdH+%(HĈL[]A\A]A^A_HkHtAL%DL4+1L5)FL5Fz@L)[HIHKHE1AW1AVAUE1ATIHH5XUSHdH%(HD$xHDLD$HD$1讉H|$H;=DH<$LD$ 1LLD$Il$H\$ Ll$0LD$HMt$(HE1@IL9C4>LHO$>/HuL)H$H;,DLD$ tLHL–IHD$xdH+%(ukHĈL[]A\A]A^A_f.Il$Ht&AHKM@M$.1L%iDL%YDoMPAW1AVAUATE1UHHH5SHL5MCdH%(HD$x1LD$Lt$tyL|$M9tPLD$ 1LLLD$YuTHuLd$ Ll$0LD$HH^Hm(H~HuH^HuCH-|CHdIHD$xdH+%(HĈL[]A\A]A^A_Hm(HxAL%HrJtLL:HuHsM9tLD$ LHt$*Ht$dH-B1AWAVAUATUSHHHHH / HdH%(HD$1LD$D$yHkDt$H1Lc(IHH1DHDA< < HH9HH)LIHHLIHIu IGLP0H9~H1IHuE1HD$dH+%(HL[]A\A]A^A_DH9mHs< t'EtH[f.HHHCfH9~A| uHsHItImsIELP0dIGLP0fATE1UHhdH%(HD$X1HHfx@Ht$1趒IHteHxHT$uBH=@CH莢x:HHD$XdH+%(uBHhL]A\Hx(f.I,$t E1@ID$LE1P0 ff.AT1IUSHHdH%(H$1Hl$PHD$`HD$Hw1HHbHT$Ht$`HH)H9H1萑IHt+Hx HT$`Ht$P%HT$H4$H|$`I|$ H|$`tHH|$tHH$dH+%(uWHİL[]A\ID$H5E1HHHCHPH9H81 f.軏E1v设ff.HHAWHAVHAUATUSHLIHL9H1IHHT$mIHtEHT$Ht;It$ Hx E11IueDIt$ I} LLHMH9HL[]A\A]A^A_fD11H[]A\A]A^A_ŎD6fDAWHHAVAUATUSHhHhdH%(H$X1HH@(HD$ H5tIHHHHH HD$0HD$(HD$Ht$E1E1IHDID$N,H;I9E1LHL$Ht$袟Ht$HL$ILHFIL)H9|~IItLL)H9jIHPI9L$eI9ID$bOlH:I9EfIE IELIHIEL)LnHFH9}H;H5XE1H8|I,$uID$LP0Mt1HHHP`L9|HD$H\$(H9H耈H;HD$ GHH9}HMI9rDIL9tA:3u?Hy(H5tE1H8fLLxIHIM)Mu(E1AWAVAUATUSHHHSH{LxLCIMHh(MQL%".LD$LD$HILL)x_I}MWMOLкHfLIHIL @8LDHuI@::DHuk11LD$}11IFpHt$LIF _IF(HImu IELP0HL[]A\A]A^A_f.ALHHL)HHDHrI@::`LDL8 u>HuHLLD$L~Ht$I<IFH)IEMn CHtALHHu L)|L)qI.u IFLP0E1 EI @K@I9H:uIDH%H5E1H8GfLLLD$}LD$HHQL)H@Lc(E1{AUE1ATUSHHHO(HGH HH)H9styDC0ELnHJ4*H9voH^fH*H,fH*Y[f/rHHHH HHLlMy*{AHD[]A\A]DHH9HtGLIHtHCHH9HFHH5*LaH{ ȴfDLؼIHvLc(E1Lc DHkLkA,H[]A\A]fDH&H5*H8芹HA[D]A\A]fDHs(nHfHH H*XfHHfHH H*XHkHuH ))E1H[D]A\A]H11xH(HHD1HÐAUH ATUHHH5SH(dH%(HD$1HT$LD$ OxLeDl$ HH\$I9It$H虋H}ujH)Hy LHHI9LINH,H)H|H贡H (DmHHT$dH+%(uIH([]A\A]f.HE(f.H'H5H8誷f.17ATHøUSHHH5HdH%(HD$1HL$膫HkDd$HH9tVHuHzxfH{u/H'D$(H'HHT$dH+%(u=H[]A\HC(f.H&H5H8ʶf.1WATUHHH5SHdH%(HD$1HH$Gvt~H]H$HHxMH9}MU0}HU(II)H<HtLD'ޟHsHrx)Aի HyH#H5DH81HT$dH+%(uMH[]A\f.H"H5ZH8躵1fDH1#H5H8蚵11ATHöUHHH5l`SHdH%(HD$1HL$膩H]t$HLe(@IH ~kHLpHtvL)HxnU0HItI<H)袞HsH6xZH$HHT$dH+%(uaH[]A\I9sLfD:tHH9uHH5H8荴D1@Ha!H5 H8j1AT1UHSHHH`dH%(HD$X1IL莇Ht$HkHH)H9|kHHPH{HT$H4$u8H=$HILHHHT$XdH+%(ufH`[]A\ÐH{(f.L診3uǐHCH5HHHEHPHH81H1@Lh1ff.@AWAVAUIATUSHHoH~BHIHHH9ILLLEy&H1[]A\A]A^A_E1LE1LxI}u\L5#HtYI .I~%HHLHHHI9uIEHL[]A\A]A^A_@Mu(HuA6LL?hDH[]A\A]A^A_sDAWIAVIAUMATUHSHHHWHtBO$/HO(MI)xEE1M~J<9LLMHD[]A\A]A^A_O$/H "MI)yC0ML)C(J4HLD$܄LD$+LCE1Mt{HK(yf.HHL)H9J4H苄HSHuBH !L)Jff.AVAUATUSHHH dH%(HD$HFHP`HtoHteL%I4$腐HH@HCHAH9BHD$dH+%(HC(<(H []A\A]A^鵜DH;ALd$Hl$HLH;~L4$LkHLLL誕HHIMH[(1H=iHtxHxHP(HL$H4*< H@zH $H9u'fHPHH5~H81s1HT$dH+%(H []A\A]A^Ð1@SvHuHCHI<$H5²Х1@H5@HC@Mt3H{(H|$HRhkD1H=y:hSDH=9fAWIAVIAUATUHSH8dH%(HD$(1HLg(IVHB`HHL-LIu4HHIGHH9H8Ht$ HAEtD$ A1@HT$(dH+%(H8[]A\A]A^A_DH;YLl$ HT$LHL$LHT${H\$ILHT$H+IHI9tH}H5H9u}HEHEH脇HHHLLZHmHUD$HR0D$L%Y^@LuM+H-<H(Ht$ H;t$}Ht$HMAG0M?HT$ HtHD$HHM~J@IOH4HHHQH)H9ItHBL)IL臌HD$HHM9uH\$ IIwH<H9}L)Luf.HCH\$ HD$HD$H9 H\$E1HHT$MHL"DHm(HHt$ H9t$M9KHT$ M~"HIHA HT$L9u1D@;rHuIGHI}H5蹡HBHD$IEHHHHHT$ HD$hHYH5H8bE1HDE1H)HI4@HqH5EH8}1fDkHH두u*HLHD$#HHD$HH&@fDfDfDfD1x軐L裛fDXH 0HcH>UG0H~HH5CH8;H} HtHEH]H@HHHHt1DHG@fHGHHHHt1DHHHHt1DLGMtHGI(t1fHI@LP01Hff.ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.HHHHt1DUHGHHWHHGHGHHWHBHGHHtH/tH]TfDHGP0H]TUHGHHWHHGHGHHWHBHGHHtH/tH]SfDHGP0H]SUHGHHWHHGHGHHWHBHGHHtH/tH]VSfDHGP0H]@SUHGHHWHHGHGHHWHBHGHH/uHGP0H]R@'USHS2$HHH;HtHH/uHGP0HH9uH=:$HtH/H:$tH[]HGH@0H[]fG GfLMt HI(tfDI@LH@0H=}1$ATD%l1$Ht*HGH]1$QH=Q1$-B1$HuDA\hHwHtH(Zsf.H=Ds@HwH /sff.@SHHHtHCHWH9|"HCH/t1[HGP01DHu#Hd<KHtHC[HW(fSHHHtHCH;G|%HCH/t1[HGP01D| HtHC[f.HWH1HtHzH+xHHȎHGE1HtL@L+GL頎HWHw 1H=fDAUATHLgMt3LoH=~HLH=ZHLA\1A]̚@11[IHt/H=~HLH= HA\1A]鏚H1A\A]ff.fAUATHLgMt3LoH=/;~HLH=HLA\1A],@11[IHt/H=}HLH=HA\1A]H1A\A]ff.fSHHnHt*HSHtHx2HRH9HOHCH6H[{]I1MuH{t1fDSHHmHt*HSHtHx2HRH9HOHCHH[]I1MuH{t1fDSHH=9gHtLHXHtHHPHHHHHu-HHPH,H2HpHvHpHHHJ[H=*͌ff.fSHH=|gHtGHPHHHHXHHHu-HHPHH2HpHvHpHHHJ[H=RfSH5HHH9t ntgH=fHtOHPH@HHHHHXHHuGHHPH H2HpHvHpHHHJ[Dz H=<1[H=觋SHGtnHH=OfHtOHPH@HHHHHXHHuKHHPH|H2HpHvHpHHHJ[fl H=Ԟ_1[H=\ff.@HH9GuHGHtHÐHH=1Hff.HHH9Gu;LGHtHHwMtI(t1HI@LP0@$H=D菇HH9GuHGf.HH=@K1H@HH9GuHGf.H"H= 1H@UHHH)$HHHP-)$HH)$H;HPHPH@ HHHEHhHHpHHHuwHHPH`H2HpHvHpHHHJH]fH=Ht$cHt$Hz2H= 1H=跈HHt HDH߁ff.@HHt 龁fDHHHMH9GuHGf.HH=p{1H@HxH9w~|7 '}HHH5lH8F1Hff.@HGHt HfDHHH5HD$H:HD$Hff.@UHHHHH H dH%(HD$1LD$LL$HD$HD$c:A1EtHT$Ht$H'bHT$dH+%(uH ]vff.ATUHSpYHHH9 HuL%/$MtQI$L[]A\@HEH&$L$Muѿ"oIH[]A\kG!oIHtHL%.$I$ID$ID$ID$EI$AD$ L[]A\H{!7oIHtHHSHI\$I$I|$ ID$ID$蜏L[]A\@H1H52E1H8fH!I$ID$ID$ID$EfAD$ EL$I$ff.AVAUATUSHHOHHtO!UnIHtdHIFIIFIFAF [L]A\A]A^f.H-aH9o8!mIHC[]A\A]A^E@HIHHH9|ILI9Iv+HE1H5H8ƒ[L]A\A]A^fDI|$!vmIHtL`HIIFIFCD& HSHu M|MMn Hs L辍H[L9LI|LH)H9HOHH萍L9|[L]A\A]A^H)H9GHIs I~ L8IFInIIFAF [SHHuH+$HH[ÐHHH9Hx!uJ=lHHHXHHPH@D HuH[H-+$@HiHtVH7HXHHPH@fD1Hx!pHH5&H8ʁ1[fD[ZCf.ATUSHHHHuSHtNH"$L$MtI$L[]A\fD1IHttEAD$ EL$Ɛ1HIHtNHtHx HH芋HuH "$HH5E1H8tf.E1bAWAVAUIHHATHH E1USHHdH%(H$1LL$PLD$XHD$PH\$X>4rHT$PIE H|$XHD$M}HHHIH$H9HD$`1HHD$@}SoLD$pHl$`MWH<$ H9HNHxILD$ IHH<$kLD$MM)L\$ IQMHIXI@LL$HD$H|L|$(IH|$01Ld$ILl$HMfDHD$0IM181DLAIL MI)@8MDHH9AII 1)L2LHHJ.HDHL9^@:<2u1I 1f.DDD8u HH9H9L2LHHJ.LփHDHL9~DLL|$(Ld$Ll$HHt)HD$H|$H6HD$HiI9EHD$H|$LH)HqHHI1IT$H,I\$H|$@H$dH+%(!HL[]A\A]A^A_I(u I@LP0I,$u ID$LP0E1뭐HLMt5*qIHI HD$H@N Lt$IL9$$H|$HD$L\$ HII)LL|$(Ld$LH+t$pHHtJH MHLnHEHHHEHHEHP0Ld$I,$u ID$LP0E1H|$HHD$8.nLL$83I) IALP0H<$ H9HNHx菅IH11H<$Lt$I9H8fDI9AT HHuH_I9~ H fHI9~ AT tHuI9uHI9EHH)LRoIHH `ID$LHH9,$QI9~%HDAD (HI9uH,$Il$]HI9@fHLHD$lLD$[I(uI@LP0wm5IHAMwH<$E1L1MIHDA:l t1HI9LMIM/I9Mt$H|$HH)HnIHI kIFNHCII9L9$$xMH|$LH)HmHH\H<$ ID$H<$H,L4$IdHLHD$kLD$I(vI@LP0gHD$H|$LL|$(Ld$HH$H5H8yID$IEL(v1H=I9}E1I)Ld$IALP0vI9H|$LH)HlHH`H<$H zID$H,H,$HID$IEHL(MHHEHEHP0HH[ID$IEAL(HLjHEHHEjHEHP0[HLiHEoHHE-HEHP0I(MUI@LP0FH1I9ESH|$LkHHHHEHEHP0 MWhL4$iff.AWfAVAUATUSHH<$Hl$ HH5HdH%(HD$x1)D$ )D$0)D$@)D$P)D$`skHD$(H\$0Ld$ HD$H$H@HD$HasIHHD$II)H$H HT$HHD$N#LK1A|MrLCIJ4LAIL MI)@8MDHL9uHE11f.BL6HHHILDIM9!B:<6uH $1Lf.ED8T HI9uML|$LLLiHt$LIEHD$HH)HIE wiIE(.FHuIfH|$(tH|HD$xdH+%(2HĈL[]A\A]A^A_ImuIELP0E1I9@BL6HHHIMƃLDIM9DH$HIEH$HIE HHIE(>fDuA4$H [HIHHH9rIL9tA:6uL+t$H)H5$E1H8tfL|$HT$L~/IHJM)SeDAWfAVAUATUSHH|$Lt$ HH5LdH%(HD$x1)D$ )D$0)D$@)D$P)D$`2hLL$HD$(L|$0Hl$ HD$IAHD$MLL$ppIHTHT$LL$HL)xaMa IuMGILAHDLMHIL @8HDHufA:4tjHH:$HIEHHIE IMM(H|$(tL zHD$xdH+%(HĈL[]A\A]A^A_LI fDTD8T HuHLIKfHt$K<dH%(H$1LL$0LD$8HD$0H\$8$|Ht$0ID$Mt$ H|$8HD$HHHIH$H9HD$@1HHD$( DL|$PH\$@M!H<$ H9HNHxIRyIHH<$t|Hl$L)I~nHxiIGMOE1AHD$LH|$LȉHD MHIL 8HDHuA:. fHMHI9D$xHt$L_cHHt1IUH,I]LryImu IELP0E1H|$(vH$dH+%(HĨL[]A\A]A^A_fDMM}LryImu IELP0E1AL.HHHHL)HDH A:.LI ,DD8\ u|HuHt$I/LL$ I<LT$H)ObLT$LL$ AHII ]IENIL9$HL)Hl$H.fDHtAL.HHu L)?H)4LLLL$ LT$L\$_L\$LT$ALL$ IHIdICLL$LLT$P0LL$LT$A;H<$ H9HNHxvIHwHD$E1HH<$HD$HLH,$MIHHhfDHAT HHuHtDAT HHuH9t$LHH)`IHI _IENIL9bMHx HAD HsL<$TfI|fHLHD$^LD$I(uI@LP0wHoI9G:LMHIIEIL +HuIHHD$HH<$R1L|$MIDHDA:l t!HsLML|$HH$EH)I|H@_IHI vIGNIHCHL9,$uMHpL_HHH<$ CIEH<$H,L<$IM}Lyn@HLHD$\LD$I(kI@LP0\Hl$DHLL$i^HH%L$I \HLL$0\L$HEHIZHEHEHP0HH5wH8YjIEI$L HIICLP0HsL]HHH<$H yIEH,L<$IH= I9|$"IEI$L HHE"HEHP0I(LiHEHP0ZMHL [HEHHEjHEHP0[JIZI(MI@LP0H=GI9|$;H}OE1HLZHE'HHEHEHP0HHE!1SYLMH$8@HI9D$Ht$L!\HH,AWI1AVHH56AUATE1USHH-MdH%(H$1LD$(Hl$( H|$(IO MoHL$HH9 È\$MH 1DHL9tAD uHD$LfDA| H t HHH9}L9u|$tHI9GH|$H)HZIH$dH+%(HĘL[]A\A]A^A_DHD$01HHD$t:uHl$0Ld$@1M0DHL9At LH!HuHD$MCt7 LH!Ht L4$II9}H|$mL9,$u|$t HI9Gt!H4$H|$H)HZIDIM@D$qD$1Vff.fAW1AVE1AUATUSHHH5f4HL-dH%(H$1LD$(Ll$(tH|$(Lc L{Ld$Ld$Ht L9M~4HT$H51DHHL9tc uH!HH9CH|$LXIH$dH+%(HĘL[]A\A]A^A_@L|$L|$E1fHD$01HHD$L8uLl$0Lt$@M~}1DHIL9tKA4$LLHuH|$kH2Ld$I)6fDHI4@H|$~kL|$L|$E1H|$bkTHT$I)ff.AWI1AVHH52AUATE1USHH- dH%(HD$x1LD$Hl$thH|$IG I_H$HtH9uHf.AL Ht HHyH9uHI9GH<$WIHD$xdH+%(HĈL[]A\A]A^A_fHD$ 1HHD$6uLl$ Ld$0IfCt7 LLHt LIyH|$iH9u HI9GtH<$HiVIOIMBOSff.@AWfAVAUATUSHHH5oHdH%(H$1H$HL$`HD$XHD$HLD$X1HL$)$)$)$)$)$)D$`)D$p)$)$)$!fHD$`LL$XH$L$HD$ HD$pHD$Mt*HCHD$(HtMHt$H5DHH9C?HsH{ UH$H$t H|$ahH|$ht H|$OhH$dH+%(H$H[]A\A]A^A_fMIHCHD$(Hu/HH9CH{ 1sTH$df.H|$Lc 0IHD$(H8IM),I"I}MuL$1H|$0JD5IIHD$8DO<41LHHH LH)D8LDHI9HL$11L*ALHHHJ(HDHI9E:uH$1H D8D u HI9H$I9W ALHHHJ(L؃HDHH5lH8_f.H$ IHt$HLcM9ID$LLHL)HIH9L|$1LL$(LILRH$HtLL$(Hx LLs N,?HMyHH|$ H4$F M~HtHCH1[SH;Cu'1[HPHvH5]H81[HoH5]H8J[þH=-_H[ÐAU1ATIUSHHdH%(H$1Hl$PHD$`HD$H I1LLHt$`HuHlI9D$HD$HHH)H9H1=IHt*H\$`Ht$PHx H]THT$H4$HHITH|$`uQH|$uYH$dH+%(HĸL[]A\A]ÐH H9KzHIHtfHPH|$tILuPHCH5VHHID$E1HPHH81VI$롐 E1:9ff.AWAVAUATUSHHhHkH|$ HH5VdH%(H$X1q4HHHIHHH 4HH91H@S>t:v "1fD1M91҃9ufH٨@tfHv H 5SM9.ŅtvGtI1(IN 8O VHv H L49fD?f.LLE)e;L-8HL%)tACH5Of.wf.LL(D8ff.HGHtÐSHwHH -HC[fAVAUATUSHHH dH%(HD$HFHP`HtoHteL%֦I4$"HH@HCHAH9BHD$dH+%(|+ H []A\A]A^.H;ALd$Hl$HLH;L,$LsHLLL'HHHD$HI1H,HtwHL$H HP H|( D4 H@rH $H9u'fHPHH5MH811HT$dH+%(H []A\A]A^Ð1@SHuHCHI<$H5`71@I8I9t1H| HL+f.1H= 2+kDH H9KuHHM (f.IAHAIJIR Lff.fHHwH Dff.HHwH \ff.HHwH ff.HHwH ff.HHwH ff.HHwH ff.HHwH <5ff.ATE1UHhdH%(HD$X1HH x6Ht$1)IHtPHT$Hx CHx$H 1A@H8IEI9t!AIH‹uعI9uHM~H+4$H|$(HT$(HH=HH=ufH;5١L$1LH$H$H=\HH5:H8w1L81HI9F2H|$(H/uHGP0IL1L$HHD$1Ll$0 H2I9FH|$(IH/uHGP0Lt$(h1vLH$7L7H$YL71JH!UHHHHH ~H dH%(HD$1LD$LL$HD$,A1EtHT$Ht$HpHT$dH+%(uH ] DATUSHH`H?dH%(HD$X1Ht2HHHtNHu H H9Gt{HH;HH/t7HD$XdH+%(6H`[]A\f.HHHuHD$XdH+%(HGH@0H`[]A\f.I1HHD$LHuXHt$HhHH)H9HH|HHT$H4$H|( h9L6$H@H5v<HHHEHPH2H81H;HHH/HGP02L5H;HuUHs"HtHmt]DHEH]H@0fAVHAUATUHSDGHEt,HHRHHHIHHHH)H9HMދ} UuLH}H HH)HIKE H]tjHE$[L]A\A]A^Lu$L)IŅH1$!HEHtwMMtuHx LL7E H]HUMHB tHzthHB({HuAHH)HI\AH[1]A\A]A^ÐH1]HW(f.H@Hxt Hx(LH=y@@HHtAF/ƒHSDL|$H I6/ƒHSDL|$H * /wMƒHSLL|$H 5t/wHƒHSLL|$H 5PD$x{HSHBHCHSHBHCHSHBHCHSHBHC4HSHBHCHSHBHC:HH58H8v"% ff.HHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$HT$dH+%(uHFfDAWAVAUATUSHH|$8HT$dH%(H$1HHD$pHIHHD$0 HL$iIH/u DŽ$HD$HxH2HGpIHD$H5Hx*H5H9IIHD$HD$ DAL$w%HA  HڊLEDL+D$8DH57H81f.H|$0 D$,t HL$HHD$HHu HAHP01H$dH+%(HĨ[]A\A]A^A_H@E1HD$HGpHIIHD$ D$,Ll$8KL%HxLLHL)HHEIHI)II)LIIBA}%ImuHD$hA}(I\$E1MHuHHSF<wH=8HcH>fDD@*$ @t$IEA.E1ۺAD$ )HHHD$L9k H|$INHL$IHX H~ AgA$AD$ۃBH B8HcH>@AA0HA*RIcHHA.HVH51H8fAA-@AA#@AA {AA+kIuu A LT$@HDDAWE1LLD$x*Y^HHD$hLT$@LpLH DEAA0EACը IILM9IME1M9HH EtA tEII9. HEAtAD$ wHHL9A`A LLLHL$@&HL$@ML)L IH5MHL$H9L$} H|$ H|$hHt H/uHGP0ILt$IIH|$ u L9t$T$,tHL$HHD$HH H|$0LIsH;5? AiAdEE LHt$XLT$PT$HL\$@ L\$@T$HLT$PHt$X ANLT$PLHHȉL$XT$HL\$@ L$XLT$PT$HL\$@HH^HGDDLT$HH|$@H|$@LT$HIH/ HGLT$@P0LT$@I{y H5xH9O L\$PLT$HT$@lT$@LT$HL\$P& LH5gLT$PT$HL\$@ #T$HLT$PHL\$@ILT$HT$@U 1H1I.T$@LT$HIuHD$PIFLP0L\$PLT$HT$@MICMsMK @LLT$HT$@oHD$hHaH HcT$@LT$H LHHLpI9L9LIA HMfDHE1|I{LAnI{ H5H9t(L\$HLT$@LT$@L\$Ht I{ LT$@A] Ht$dLLT$@IƋT$dI > HH5+H8WHDeHA%HDŽ$1Lt$f.H|$ $ I}LcH@IxE<)t2<(HIyHyH5*H8DHHH)Hf IHDL$,EtHL$HHD$HHH|$ LImHD$u IELP0H|$r D$,II\$E1HD$M.1;KL)DLDT$XHID\$PLL$HMDD$@DD$@LL$HLD\$PDT$XA tLLLM3!|fDLT$@>Ht$IHDqET$McHKLGHpDeHBDaHA|$HgfffffffHcH)HH?HH)L9}HH5:)H8 @IHHE1HDeH}A*wEMHH1f1HD$L9H|$IHIC LHT$HHL$@L\$&L\$HL$@HHT$HIzHHHWDeHIHA.jHH+DL\$@LT$LT$L\$@HA]H/@ATDHDeHBDaD)HcHigfffH")9}H~H5'H8o:f.EEtAXA wHLFLLLHL$@HL$@ML9LLT$HT$@T$@LT$HHIHLt$nA tAIIAGAAAGHHHIf.EAA EILt$A%IIH|$0HQLDD$PLL$HHL$@`HL$@LL$HHDD$PIHq~H5z)H8DM9LIMAAA HAHP0H5~H9Hp0LHH@LpLE΅M9LA IM IAAXEAAotAx DH|$0LLH$IHLt$I@A+DDLLT$@LT$@ILt$hMyAF IV0MNH@LEDMvEAA0XE1LDDH$HAWLL$@,_AXIHLMsML IL\$hx HcL9M9LA ILAIIAGAAAGL\$PHT$@HL$HD$HHL$HT$@HLT$HL\$PjAIMfDLHT$@HL$&HL$HT$@HI+HD$I9:H|$IH<ICLLT$@L\$ L\$LT$@A7H1IEAIDeH-H|$0LHPDD$XD\$PHL$HLL$@LL$@HL$HHD\$PDD$XIVfDMNHLLT$@HH9Ht$dLT$HHD$@3H|$@LT$HIH/tHGLT$@P0LT$@^IMsMK ET$HMcA.E1:I-Dt$cItbMҹLL$cAIOA ZYH=" 1MK(eL\$@T$HLT$PL$XH[D$cLt$IIAGHyEANHLFH;DHH !H5=%HPHE1LLT$ LT$HIfHAHP0IKHH`H8VLKIH_LpT$@LH LT$HaL\$PLT$HH|$@Ht$XDd$HT$H|$@HLT$HL\$PDQHt$XhIC(D$cTHxH;_H;H5M$ AC D$cH/EIsH5xL\$@LT$LT$L\$@HqHxL\$ Dt$H;L$KL\$ L$DL$Is*HHwCHwH5#H84 H|$hHH/HGP0HqwH5H8 D$,L$ L\$Dt$P0L\$H3wDL$L$ IsL9t$HwH5`#H8 H|$0NfHvH5H8j 5AXAT$HpHvHQH5 "H81HvH5"H8 HPHnvH5!L\$H81L\$I+ICLP0mff.fATISHHHH5vH9t t6HsHuH=V{HL[A\fH{(f.HuHH[A\ff.fHGHu HuHHw1H AWIAVAUIATIUSLHXH|$Lt$ LL$LdH%(H$H1LLHHHD$MD$<HM94L4$AMM'fDHtxWEIHM9A<\uIHL9=APM`BfDM1M9vfDIM9A?xLL)LLIHLHHI,$IuHD$ID$LP0LD$MtvIHH<$IP HHl$0LD$WLD$HI(u I@LP0Ht:MM9L4$HL_H(f.LL)FDL4$L1H$HdH+%(HXH[]A\A]A^A_fDHD$H8E\HA@IT@BM9sAHQЀEMH9MxM9s8HvA@AH wIHˆUMH5LLD$LD${H5\LLD$LD$H5LLD$LD$bM9AHHxMHt\E'MHRE"MHBE MH2E MH"E MHE MHE MHEMHEMHE\MHE?H)MH(HpH5jL4$H8M`M9+AHQЀM` H0pLH5L4$H+T$H81sbHpMH5L4$LH81L;fATHdH%(HD$1IHtXIH$Ht$H sHH81x!HD$dH+%(u.HLA\I,$t E1@ID$LP0ffDAUATIUSH8dH%(H$(1HHLAD$ \$2Ml$ @DI\$0LHH?LHvHHJ<+H9r>_HyswXK<8HHˆVH9v# uSH tH9wfDHظBfDAT$ ID$HH)HHnH5H81nHF1H$(dH+%(H8[]A\A]I\$HfDL uAD$ Ml$ƒ @IH1҃M(`fDtsA<JHI9=uA<y,fAT$ u$ID$HH IL$0ID$H@HEIL$0ID$H@HEfDfAtHtfHt@Hftf.ufufufH1Hff.HOHHt HAH=eHP1zf.H= 1bfAUH5CEATHLoHpHt3H=EIHLLHA\H= 1A]mDH1A\A]ff.fAUH5DATUSHLgLoLHHHUu2Hmt{HLHS1[H= ]1A\A]1LHSHH= eHmItHL[]A\A]DHEHP0HL[]A\A]HR0zDHgH;t=H5CL)HH.H;t,E1mH5M#SHHt H{[RfH=|H%#HHu1[ÐH5#SHHt H{[fH=<Hݖ#HHu1[ÐAVAUIATIUHLwIHt;LL`HHt`H@HHt8IT$HLH]A\A]A^L踯yHH]A\A]A^DHEHH]A\A]A^@I|$HL]A\A]A^@AVAUIATIUHLwIHt;LLHHt`H@HHt8IT$HLH]A\A]A^LyHH]A\A]A^DHEHH]A\A]A^@I|$HL]A\A]A^ATL%ULHHH(dH%(HD$1`t|1LL$LD$LH+tWHl$Ht&Ht$Ht\H;5%dtSH+fHa_H5J H8f.1HT$dH+%(u(H(]A\fDH!_H5H81AUHGHHWHH HGHGHHWHBHGtH}H/uHGP0H}HtH/t2,#=9H&#H-##HU]HGP0#=~H]sBwdATHKbUHSH9GtH)^H[]A\IH9FuHvHӺct>xdt%t%H*`H@H]H@tH`H}It$HtHt 룐1H91jff.@Bw H_H9GtH`]HH9FuSHvӺHx&ttHi_H[tH_1[ff.@UHSHHHt2HHtH,$HRtHF&@H>H5H8jf.1HT$dH+%(uH]A\UHHSHHHGHx t4H{HEHkHtH/t 1H[]HGP0ߐATLfUHSHt*H{@HtHC@H/tM~$HEHHC@1[]A\DHGP0MHBff.ATLfUHSHt+Mt$H}@It%HH]@Ht H/uHGP01[]A\@HCHHE@Hu1ff.SHt@HHHt)H{HCHtH/t 1[HGP01[H=H5H8[fAWAVAUE1ATUSH(H_dH%(HD$1HxDL%6?IL5z#IlHEHl$L9tIH;?H;};HsHD$dH+%(H(D[]A\A]A^A_u @xH>Hl$u @@t=Xz#u*1H0 JAHu HE0tSHMHf.HA<GH9uH|$HD$H9*IDAHEHf.HHHtsHHD$vLD$uI(I@LP0@LتLD$HHD$t3IDAHmuHELD$HP0LD$뤐oLD$%DU fH~SfH~H2Ht%HV;HHhHPHXH[]@H[]͐ff.f~GOfWfWff.fH:HH9WtGODHOGfW zDAWAVAUATUSHH $L$L$DD$@$LM)H$H$H@H$H$H@MIFH$H$H@H$H$H@oH$`H$H@GH$8H$H@HHHH$ЈD$+H$H@LAH$x xH$H$HPL|HIx:IHcH u:H9HRLIIIuIFIIxHHGHt!Ht 龎fDH鯎H=2霆@HHHGHtHt t@H=d@HSHH@Ht&H{`HC`HtH/t1[@HGP01[ff.SHHHt&H{`HC`HtH/t1[@HGP01[ff.SHH蠅Ht&H{`HC`HtH/t1[@HGP01[ff.ATSH1H0HthH@IH@(H@0H@ @8HtHXHHL[A\fD1)ID$HuI,$u ID$LP0E1HL[A\ff.@H=tm#AUAATIUHH=Pm#H芄HHLIHHm#H1E1L m#111AQAUUATPPPPPlHPIHEHPHUHt,I,$t L]A\A]@ID$LP0L]A\A]@HEHP0I,$uDHmu HEHP0E1]A\LA]1Hjl#HH=*$HMl#HfAVAUATUHSLgL虿HIM~TL-01)DtO躲HHtzI|HI9t H|HGL9uHI|HI9u[L]A\A]A^HPH-H5H814I.tE1[]LA\A]A^I.uIFLE1P0[L]A\A]A^fATHHHHHWtMH@PH1HHHWHHH9~ HH/AuHGP0DA\@HHH/H5 H,AH81[DA\DHH5駭ATLg@MtIID$tI$LA\H,H{H5E1H81ލ@HY,H{H5H81蹍ATLg@MtIID$tI$LA\H,H){H5E1H81^@H+H{H5H819ATLgHMtIID$tI$LA\H+HH5E1H81ތ@HY+HH5H81蹌ATHHHHHWtMH@P1HHWHHHH9~#HH/AuHGP0DA\HHHH5H*AH81DA\DHH5ATLgHMtIID$tI$LA\HQ*HxH5{E1H81讋@H)*HPH5PH81艋ATLgHMtIID$tI$LA\H)HH5E1H81.@H)HH5H81 ATHHHHHWtMH@XHAHHHNHWH9HOHH/t DA\fDHGP0DA\H?H5H)AH81kDA\DHH5nATHHHHHWtMH@XHAHHNHWH9HOHH/tDA\fHGP0DA\HH5HC(AH81諉DA\DHOH5OATLg`MtIID$tI$LA\H'HQH5E1H81>@H'H)H5H81ATLg`MtIID$tI$LA\Ha'HуH5cE1H81辈@H9'HH5`H81虈ATLg`MtIID$tI$LA\H&HQH5E1H81>@H&H)H5H81AWHAVAUATUHpdH%(HD$h1HD$8HL$HD$@HD$8HT$PHc)PHt$PVPHt$@VHt$0VHt$XVHt$hVH$VPH$VPH$VH5UPH$PH$P1L$L$5H쀅?L$mT$D$H|$P;IHH|$H%IHyH|$@H IMzH|$8H<HE1HtLHt$(D$Pt$@t$PUATAUAV$L$DD$\L$`T$dt$h|$lGHPII.Imu IELP0MtI,$u ID$LP0Ht2Hmu+HEHP0fDH#H5JH8*E1HD$hdH+%(HpL]A\A]A^A_f1詵IHi#H5H8ڸHI#H5H8躸1YHI.lIFLP0]1E1IFLP0fAUATUHSHHtNL1II<$~$DIDHt IT$HH81|H1[]A\A]AVAUATIUHSLvHLoM9tLLst'HS(HBHtr[LHHR ]A\A]A^fDHSMNMEHtHBHDHH H5H81{[]A\A]A^fDHSMEHtHJHDHH ; H5H81{ATHtEHHt[11qHHtBH/AtDA\fHGP0DA\H Ht411>qHAH5"HAH8%H5f.ATH5UHͶHtWH1H1pHmIt/Mt9I|$H5H9t Đt0HL]A\DHEHP0MuE1HL]A\HH5H8zI,$uID$LP0fDUHHHH5IH9t ?tHEHUH]fHnfHnHHHt`H(@Ht fH~fH~HfHnfHn]fDH@D$ $P0 $D$fH~fH~ }fHuH $荗 $fDAWAVAUATIUSH8HwdH%(HD$(1H;=XtBH;=Wt9H;5NH;5 H;5P H;5u H;5u4HD$(dH+%(LH81[]A\A]A^A_LL9H;5H;54tnH;5 @fHH1LH‡HmuHD$HUHR0HD$HT$(dH+%(bH8[]A\A]A^A_LoLHH1M~I|Ht`HDHI9uoGff.zufTfVf/sHD$(dH+%(LLHD$Hm018HD$ H6HHtHXL|$Lt$Ll$ LLLLZtH|$HtHHf.+vff.z$u"~~%fTfVf/f.zufT fV f/HD$(dH+%(It$H资HmIu HEHP0M1LLƅImIUHD$LR0HD$HD$(dH+%(uaH [H8L1[]A\A]A^A_nHD$(dH+%(u-It$H f.ztHD$(dH+%(uIt$茙fTfVf/vHD$(dH+%(uIt$H rff.fAVBAUATUSHwHQIH9Gt(HHIHL[]A\A]A^f.HH9FuHvhHhӺ[EA9E6EA9E)EA9EE A9E E$A9E$Hu(I}(訧I}0IHH}0IHHLfI.uIVD$ LR0D$ I,$uIT$D$ LR0D$ Hu8I}8~vHu@I}@~`HuHI}H~JHuPI}Pئ~4uL%1tL%I$hftE1ZI.uIFLP0Eff.@AUATUGHf.z&u$f(fT gfV f. wz111rϪIHE11ɿr諪LLH5&HHtrHH=1aoIHVcLNcL]A\A]DG111rKHHtLyE1LL럐[g1E1E1룐KgE1fDUSHHGoHt3CHoHt HiCBHHH9HGH[]ÐHATUHSL'HHFI|$Hu.H5/H9t tQL1[]A\fDLwf.zu+uHtHEH HHEf.USHHHH-|H|$HH4$dH%(HD$81H9t HRtnoc)d$ H$H{H9t H/tkok)l$T$\$D$ L$(HT$8dH+%(uFHH[]Ht$ H|$yHD$fDHt$HsyH$D@USHHHH-H|$HH4$dH%(HD$81H9t Hbtnoc)d$ H$H{H9t H?tkok)l$T$\$D$ L$(tHT$8dH+%(uFHH[]Ht$ H|$yHD$fDHt$HyH$T@USHHHH-H|$HH4$dH%(HD$81H9t Hrtnoc)d$ H$H{H9t HOtkok)l$T$\$D$ L$(4fHT$8dH+%(uFHH[]Ht$ H|$yHD$fDHt$HyH$d@USHHHH- H|$HH4$dH%(HD$81H9t H肄t~oc)d$ H$H{H9t H_t{ok)l$lT$\$D$ HL$(;!taHT$8dH+%(ufHH[]DHt$ H|$uHD$fHt$HzH$DH)H5H8誠1AATIUSHH@H- H|$HH4$dH%(HD$81H9tH]5oc)d$ H$H{H9tH6.ok)l$L;%-o2fHT$f.\$HD$HD$zuH,fH*f.zD$ L$(fHnfHnVf.f.!f. t f./t3!2"t+hHT$8dH+%(WH@[]A\"HSH5dH8,1Ht$ H|$HD$fHt$HH$zfHOdHT$ HD$(HH~8fHnfHn!@H! H5H8蒞1#fHnfHnHf(f(6 69@"tC!fH H5H8*1fHnfHn豐V@蘎HGOyhD$D$8"tHjf.H H5H8蚝1HAVAUATUSHPH|$Ht$dH%(HD$H1BHL-P HAL9tL<loK)L$ Lt$IntXff.D$(z11A9H HHT$HdH+%(HP[]A\A]A^H5 H9HÅ~L9LH*fHD$ eiH1HoDLH}HmVHUHD$HR0HD$=DH\$ LfHnf.ff.D$(fDH @Ht$ H|$yHD$Ao^)\$0D$ f.D$0y1D$(f.D$8E[LHM~uHt$0H|$yHD$DNjHS|GOH=V顈HO(HWHwHtH=91}DHO1H=&ffDHWHwHtHO1H==DH=1*f.AUATE1UHHH5HPdH%(HD$H1HT$ht3Ll$LHT$L1HLB2~Lt*eVIHD$HdH+%(uHPL]A\A]Dkt@AWAVAUATUHSH8L- HT$H4$dH%(HD$(1AD,IfAT$IHADuE1<(Lt$ 1LLKf.>f(zH\$ L9PՁf߀JuCf(HfADtSHHADuEt0<)CHSHADtDCHADuL$H)D$H;$HD$1H0HtL$D$H@HT$(dH+%(H8[]A\A]A^A_Ð1LHL$If.L$z8HD$ H9}߀JuHX@HiH5rH8ڗ1oAT$ID$ADtDPHADuIA:f.D$gL$HH81O@1GsH=;ff.SHUHCtkHu^H=]HtGHPHHHHXHHHuQHHPHH2HpHvHpHHHJ[@HPHmH5~H81N1[H=脂@UHSHCHOH1iH}Ht H/uHGP0H}Ht H/uHGP0HBHt~H[]HH[]ffH[]_DUHCCH}HtH/tTH} HtH/t5H}(HtH/tHEH]H@DHGP0HGP0HGP0UHBH}HtH/tHEH]H@HGP0HH9GtHHH9FuHGHNH9tmH)ȃwrH ީHcH>fHxHAH@H~HHfHyfHvHaHZf1HAUATUHSHHHHSLkHB(L`@(uCHtHW tY]HuGHSHR0HHL[L]A\A]f.HR0HHL[L]A\A]HCH@(HHvH5H81KH1[]A\A]AUATUSHHHH;5ILoMQH-'#H'#HI$L1HLe8sIH'#HHEHUHHHHHEH#HHMHIHMHHHPHmtHL[]A\A]DHEHP0HL[]A\A]IHH[L]A\A]zHHH@HULkHHEHEHHUHBHEH}I,$H-&#PID$LP0@HH5H8R}"DE1H=1}@AWIAVIAUIATIUSHgHxHHMI9MI9MtzI9tkAW0tCIلtSID$ Ht$HD$dH+%(ueH LA\f.I,$u ID$LP0E1f GHIrHID$HD$ID$(Wgf.AUATUSHHLg HHGH-H{IHH9tn vHHHCI<$I|$I$H/uHGP0I|$ H/uHGP0Il$Ml$ HL[]A\A]fH{(Lc H5#Ht]Hk(H)\HtlI<$HC(x+rIHuHmu HEHP0ImuDIELP0u@jH_#HHuImu IELP0HE1[L]A\A]fDtHC(H=ff.SHHHt/VHt4H{[HH9HLtf.[Zjf.1[ff.USHHH+UHHtJH{Ht(DVHxAHHH9HOHHNHCH:HH[]sDHtH1[]DATUHSHHdH%(HD$1H;=1IH5sCH(t\H<$H5o|H;HHt*1H1n6HmIu$HEHP0CIHtCE1HD$dH+%(HL[]A\HH=!BHH,$H_HTHHt1H0IHtHHhH$HID$nfDH(t2H$H5H@HPHH81n?6fH@HP0@HEH5MHPHH810?bfDSHwHHHy;H{HCHtHCH/t 1[HGP01DkQHtHk[HYH8BuHH8Btmff.AWAVAUATUSH(L=dH%(HD$1H$L9tUHFHHLt$Ll$I u hHT$Ht$HbxBLLLH:uILHT$dH+%(u8H([]A\A]A^A_1@HAH5H8p1aaAUI1ATIUSHH(dH%(HD$1HD$HD$@1 mHHHLL$1LLD$H HKvHEHHEtyHD$HtH{HHHCHHt H/uHGP0HD$HtH{PHHCPHt H/uHGP0I|$t11HT$dH+%(ufH([]A\A]@HEHP0xID$H{@HHC@HtH/uHGP0HHEuHEHP0@_@AUATUSHHHHHoHH?HHHSHHtH5H gHSPHtH5cHfL-HSHsL9tH1JIHmtHL[]A\A]HEHP0HL[]A\A]HP5HWHt HEDL-YIE@Hs1LmJIxD{HHmu HEHP0HE1[L]A\A]ff.UHHSHHIH0WHHtH]`1H[]>HtAWAVIAUMATIUHSHHLMxMtEHpI9t9HTHH9GIELkPI9t MtILKXIIvZMtI$Lc@HtHEH{HkHLCHtH/tI1H[]A\A]A^A_HGP01LL$=IHL$I(u I@LP0M.Mhf.LLL$L$]L$LL$HmHLH0UL$HHC`PHD$@PHD$0P1LL$@LD$HH o][ff.fAUL-ATUHSHHHHt$HdH%(HD$81HD$(HD$ HD$HD$HEL9(tHH98tyH{29u6Hm E1HD$8dH+%(HHL[]A\A]fDHD$0HEHH=Ht$(HtHF1H0IHtH@H@(H@0H@ H@`L9(tHH98LL$LD$Ht$LHL$ HT$(Hl$u@HHm HEHP0DHEHP0fHI,$ID$LP0@H=#HHH9HHHfHHHD$H5;PHD$@PHD$0P1LL$@LD$HUH |&@1dID$HHm9HEHP0*|8HLXfATUHSHLf詔M~(HCH}@HHE@Ht H/uHGP0It 1[]A\@H{ ?\IHHxQH@H}HHHEHHt H/uHGP0ID$ H}PHHEPHt H/uHGP0ID$(H}XHHEXHt H/uHGP0ID$0H}`HHE`Ht H/uHGP0I,$u ID$LP0HHH9E$H}`HHGH_1A(H6H1Hv8xsH}`1AHپ:6H|NHH9HpH/8HH5AH8!fI,$u ID$LP0TDATUSHHHoHdH%(HD$1Ht HEuKH{PHtHH9GH{@HHD$dH+%( H[]A\.E  LEHH}H~611҃AHHE1 @H5H5Tf.DATIUHSHHHt HՅu=H{ Ht LՅu+H{0Ht LՅuH{81Ht[LH]A\f[]A\ff.HG0HHG8HHHHHt1DHHHHt1DAUIATIUHH@Ht HAԅuLLH]A\A]]A\A]f.ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.HG HfHHHHt1DATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.HuG HfH10Ht@Hff.@H%HHHHHf1f.GEDUHGHHWHHGHGHHWHBHGr#~HEH]H@DH#H-##HU]ff.UHGHHWHHGHGHHWHBHGHHtHEH/tH]~!fDHGP0H]h!UHGHHWHHGHGHHWHBHGHHtHEH/tH]!fDHGP0H] UHGHHWHHGHGHHWHBHGHHtHEH/t_H}HtHEH/t(Hc)#O/P#H #H,]fDHGP0Hc#O~H]L @HGP0ff.@UHGHHWHHGHGHHWHBHGHHtHEH/t'Hc#O.Pv#H #H,]DHGP0HcV#O~H]@UHGHHWHHGHGHHWHBHGHHtHEH/t7H}HtHEH/tH]7HGP0H] HGP0HGH;t@f#c%#H#H=#HGfXff.HH=a#Ht%@HGHM#HG@H=<#HuH=#HtH#H/t HDHGH@0HfHGHt5HpHHt*HP @xHR(HJ xHc1|Hu HFHf1ff.fHS$HtHfHYHHH#$HtHfH)HHHWHtKHzHtD~:HH IHf.H H9t8xt@1DATSH # #D$t6H* #f. #HcH< #u{ #Ht#tg #HH<V #uHD[A\7AVAUATUSHIHH+XCCMMt tkCI9thIHEH;EsnHPHUI] uAE HeZAEHEH;EHPHU8 ub1I9[]IEA\A]A^AE H#ZfDHuLfDKH1[]A\A]A^f.H)L릐HxzUHSHH{H{@HtHC@H/H{HHtHCHH/H{`HtHC`H/teH6HC`HK@HPHCXLKHRIH5gPHCPP1H tjH{H yPHC@HHC`HH1H[]HGP0HGP0h@HGP0=@{`|%H{HHC`HCHHC@HC@fUHSHH;tpH{HHtHCHH/twH{`HtHC`H/tPHHC`HKHHPLKXLCP1RH5MZYt@HCHHHC`H1H[]HGP0HGP0HC`HCH뻐Hw8H1H=݁ Hw8H1H=ف Hw8H1H= wH1H= HHAUATUSHHH`HHH{@IHtnH{HHSPHKXH;W} HBH9HIL1H=  IHmu HEHP0Imu IELP0HL[]A\A]@Hmu HEHP0HE1[L]A\A]fDH=r*@H:H=Ɇ=w HKPIL1Ic=H=ԆH HCHHAUATUSHHH`[HHH{@FIHtnHCHHSPHKXH;P} HrH9HIL1H=DIHmu HEHP0I,$u ID$LP0HL[]A\A]Hmu HEHP0HE1[L]A\A]fDH=2)@DL HILH=1DHIlHHATUSHH`QHHH{HHsPHSXH;w} HFH9tBHHH=41IHmt L[]A\HEHP0L[]A\fD8H=L=w3HSPH1IH=J(@E1[]LA\D=H=<HmHCH=]pHHAQIHH5;~APIHH81Hff.HHAQIHH5~APIHH81Hff.HHaIHAPIHH5}H81rHff.fH%IHIHH5H818AUATUHSHHhdH%(HD$X1|H{@HtHC@H/H{HHtHCHH/H{`HtHC`H/HHC`HK@HH?PHCXLKPLCHH5|RP1H FHC@H{HE1HHC`HHHGtVHD$XdH+%(-HhD[]A\A]@HGP0g@HGP0<@HGP0@H1H%AątlH{@HtHC@H/uHGP0H{HHtHCHH/uHGP0H{`HtHC`H/uHGP0A1Ht$H<$LkHDHCHMtImu IELP0HXH{HP@HC`AHCHHC@pAHH98ATL%#M1SMID$HID$-#IT$ID$H#ID$I$HHHuXHID$H HIL$HIIL$HHHPLA\A\9f+E1H=aPHcEAUATUHSHdH%(H$1azZ9[S}y2'Ik+ޖуd*v7wY{|~)o%Gi{az4L%ssfpY:q\~E>(Jl׹ pô8iZ|b[&H H*+HHHH5" HHHH5 HHdH}H5?HHCHH5lvHH"HH5ZHHaH*H5=vHH@HH5*vHHH`H5vHHHH5TtHH}HƶH5uHH\H-H5"HH;L%,HI<$HHt H/ H5uHI$_L%HI<$HHt H/V H5sHI$#HdH5OuHHHSH5HHHH5uHH`H1H5uHH?HH5tHH~HGH5tHH]HH5XHH<HH5HHHTH5tHHHH5tHHyHH5FvHHXHH5 HH7HȴH5%tHHvHGH5$HHUH.H5HH4HH5sHHHԳH5CHHHCH5sHHqHH5sHHPHH5HH/HH5^sHHnH׷H5HHMHH5qHH,HMH5HH HtH5rHHH#L-HLHfL%H54HI$DHLH.H϶H5rHH mHH5^rHHLHH5PrHH+HH5(rHH HKH5!rHHHH5rHHhHH5qHHGH8H5qHH&HH5qHHeHH5THHDHH5qHH#H="HH5qHHHEH5nHHs :IHHH=+"HQImr:IHHH="HPtImUsk:IHSHH="HP9ImJ 0:IHHH=z"HRPImHH5pHHf 9IHHH="HOIml9IHHH="HOgImHH5oHH/ =9IH%HH="H_O ImLHH5oHHsg8IHHH=+"HOImHɲH5joHHwo8IHmHH="HNSImHH5%oHHh)8IHHH=s"HKNImHHH5nHH_7IHHH="HMIm HmH5nHHcq7IHYHH="HM?ImHYH5HnHH7IHHH=_"H7MImHH5mHHK6IHHH="HLImHH5mHHO]6IHEHH="HL+ImHH5jmHH 6IHHH=K"H#LIm5IHHH="HKImEH֪H5lHH\j5IHRHH="HK8ImHH5lHHn5HH HH=X"H0K HmHH$II<$11+IEH IL9uDH}H/uHGP0HH9uH$dH+%( HĘ[]A\A]ÐH=yL HHHfIELP0qIELP0IELP0^IELP0IELP0IELP0iIELP0IELP0IELP0IELP0=IELP0IELP01IELP0IELP0mIELP0IELP0aIELP0IELP0HEHP0$HGP0HHGP0HOLH HHHu"H=2 HHHbLz HHHN_H=^K HtHHH=i H-HH`H=_e HHH!H=k6 HHHR`H= HHH>H=ͯ` HHHH=1 H2HHH=/z H{HHH=`K H̬HHgH=~ HթHHH=bu HHHIrH=F HHHZPH= HPHHK.H=`HHH| H=Ƣ1HRHHH=HkHHޟH=([HtHHH=Y,HHH@H=uHHHqbH=FHHH@H=HHHӖH=pHHHH=NAHrHH5H=HHHfH=[H$HHH=4HmHHbOH=aH.HHA-H=^HHH} H=<}/HHHHCH=xHHHtH=IHzHHH=H˧HHH= sHLHHaH=QDHHH?H=HnHH H=S^HHHH=/HHH H=UHqHH<H=YHHHmH=*HHHsH=sHHH/}QH=y|DHUHHj/H=JiHHHq H=nHHHH=?HHH[H==[H HHd]H=\YHHHuH=*H˟HHacH=0aH<HHWcAH=bTHHHHH=%HHHeH=dnHHHJH=?HHH{H=ŰHiHHH=iHRHH}uH=Ǯ:HHHSH= H\HH1H= THHHp^H=]%HHH!H=k~HϝHHH=akxXH)HHD+?H"HH=|d1H=Ad1H=z]1H= d1H=}d1!AVAUATIUHHt$XHT$`HL$hLD$pLL$xt@)$)$)$)$)$)$)$)$dH%(HD$H1Lt$Ll$ Hl$(LLHH|$(HUjHW H9tLH~ HH9t9HT$Ht$ E17HD$HdH+%(HL]A\A]A^ÐH\H9(uH)kH98uHiH9G(uHLLH|$ HGHx9uH@H H9H"eHtH8HtH_Ht$HtH|$ *H|$H/H$0LHt$0D$0HD$8HD$PD$40HD$@s IHLD$ H|$(LH5_\I@HH1H|$(H/uHGP0I,$u ID$LP0Ld$IHl$LLHLLHHt$ H|$XH$Ht$H|$Ld$THHT$H|$(E1s7fDHGP0@H|$(H/uHGP0H|$ H/HGP0HT$Ht$ E1H|$(f.AWAVAUATIUSHHLw`AF Mn@ IV0M~H@LEM90TDtCC<w*H<8u1IM9t{uC<'v @CIH[L]A\IT$ B!RHH5ZH8&I,$uhff.@HHɑH5:[H8R&HAUATUSHdH%(HD$1HIHH5<|HHL2H$H1HHH<$IH/uHGP0Hmu HEHP0MtZI,$Au ID$LP0HD$dH+%(uXHD[]A\A]fnHmu HEHP0AHH5RAH8!%f.ATUHHt]HIUHupHhHHt`LHHmAtHD]A\HEHP0HD]A\HuHbH5YH8$AATHUSH>H;HtHFHDuE1D[]A\D11HHt*H;HA^HmuHEHP0D[]A\Aff.fAUHATUSHH(dH%(HT$HAH:{HkH'HUHH}xH7HJHHMHHHGHtHHEHC&CH}IHtHEH/uHGP0MH}HHD$dH+%(H(L[]A\A]HwH;jHCH;wH5 XtH;'H5HXHyXHDHH8"fDE1vHCH;-H5OtH;ݒH5PHWHDH܌E1H8Q"2@HQ@L;%AcL$I,$u ID$LP0H}XLm`HEXLehHE`HEhHt H/uHGP0MtImu IELP0MtI,$u ID$LP0HCH@pHCHmHEHE1P0cDHSH;u HH; HE1H8A@HH8ituHC H@ HCH;HVtvH;HHWHWHD[@H)H9CtkHH8HH9C~HH8gH1WHjH5H81C@HQH8Q@H9E1H86HHt$H|$ HHK8HVH81twH|$Ht H/uHGP0H|$Ht H/uHGP0H<$HH/HGP0HH5UE1H8wXH$Ht$H|$OID11cATUSH HCIHxCI,$tcH- HHIHulHH8uH:H8 t HEIL[]A\ÐHH8ID$LP0tt@HCH; H-NUtH;H-^UHwUHDI,$u ID$LP0H*HE1H8L[]A\@ATUH(dH%(HD$HGHHxHtyHDHH9GHHt$H|$HE Ht@ tHExxH1VHHH/uHGP0H$Ht$H|$ZHD$dH+%(H(]A\fDLg@MlGLaHHt$H|$.L1H1HHyHyfDH|$t CH]HPDH)HM8H TH81@ ATUHHHGH;3tIH;jt@H5)sIHtt111HI,$Hu!ID$LP0H1HHthHmAtHD]A\fDHEHP0HD]A\HAH89tE1HD]A\fHAff.Hc111H111ff.fH11ff.@HH1HATIUSHtH H9Ft?L[]A\H`H-HtYH};t7CLfDH~oI,$u ID$LP0E1H!H8uH} SG tcHuH;5tCHt>C H{11zH{HHt [C [Hsf.HH8! 1[ff.fSG tKH1u G HwH{11H{HHt [C [HH8 1[DAWAVAUATUHSH8dH%(HD$(HFH8H\$L|$Lt$ HLLILl$M+IMLd$ L9t}HLHL$ HL$udH݂L; TLHLLd$HMl$H0I9LHT$H|$ LH;1H5mHrIH&HL$HT$E1HAD$Ht$1AD$ImuIUH$LR0H$HmuHUH$HR0H$HxID$HPHHzHJHHHH/$@xH|$ 1ɅHt$ 1L]H|$ H/#HWH$R0H$f.AD$HbAD$HmAEDHT$L-L9HH3H9BHt$HD$HHtHHHnHt @V@Ht(L9ImuIELP0Ht$HT$HnHt$Hl$HEH5H 1ɺLL+HT$(dH+%($H0]A\A]DHD$Ht$HD$HHtH1+H H81HmHEHP0f.HH5*LH8jH|$H/uHGP0H|$Ht H/uHGP0H|$Ht]H/uWHGP01HT$Ht$H|$HT$Ht$Hl$HQH5bKH81LD$HL$DHAD$HT$0AD$DHHUH5~KH81dHmuHEHP01UH5iLl<HGP0ID$HEHP0+fH51ɺLDHH4$!H4$HD$Hnff.UHHH5H(dH%(HD$ 1HD$HD$HD$P1LD$ LL$WAX1ZEtLD$H $HHT$HT$dH+%(uH ]DHSS t5HH9H{HHt[fDC [H{H81[ff.fSG tdtHHH{uHt HpH9Pt[H{H[3H(tRHSH5|HH8D1[H9H5FH8*1[fDHzH8!1[DHR0USH8HodH%(HD$(1HEHHxHG H}LH;5H{C HGHHD$ HD$HD$ H5P1LL$ LD$09ZYtULD$HL$1HHT$ H{HHu-HzH8Z:HCC H1HT$(dH+%(,H8[]ÐHyH81D11HH{u=HtH~H9PuH(uHR0H~H5FH8q~@HT$(dH+%(H{H8H[]fHE111ELHHHwfH ~H5ZDH81HD$ HxH:HD$DH9H8 GH5~ATIUHSHHHIT$ L`ID$pHHP @H@(HtrH HX0HQHHtgHUHHh8HHHUHPHHHuiHHPH~H2HpHvHpHHHJH[]A\HZhfHI,$uIT$HD$LR0HD$H=>ff.HHHH=dwHH=Jw11fHHHH=yHHHHH=}HtH@@H@HHfSHH=YzLHtGHPHHHHXHHHu-HHPH}H2HpHvHpHHHJ[H=" fSHH=~HtGHPHHHHXHHHu-HHPH}H2HpHvHpHHHJ[H= fUHSHH"H ""HHHHEHhHtHHPHXHH@ HHHuKHHPHn|H2HpHvHpHHHJH[]fDH={HuH=N j"SHtnHԹ"R"HHHHPHXHHHHHHuHHHPH{H2HpHvHpHHHJ[H=y4Hu[H=Q UHSHHH=tHt\HhHX@ HEHtHHPHHHHHu2HHPH({H2HpHvHpHHHJH[]H=! @ATHUHHzGHHHHtHHG@HHt7HE1H5H HmIt%Mt/I,$u ID$LP01H]A\@HEHP0MuѸf.UGHHtH1]VfD;t1]ATIUHHGHtHLH]A\fDtH1]A\ff.fUGHHtH1]6fDt1]ATIUHHGHtHLH]A\fD{tH1]A\ff.fAWIAVMAUMATAH=USHHtoHŋD$HDAH5MH5^HP1t$HAVAU.H IHEHPHUHtHL[]A\A]A^A_@HEHP0@E1ff.ATUSHdH%(HD$1HKH5]HH)H=>51IM 1LHPH$Hmu HEHP0I,$u ID$LP0H<$IHHWHu/H/.HorH5?H$H8H<$IHt`y\HWHOIt$HI,$HqH5Z4H$H8L$$HD$dH+%(JHL[]A\@1 IMHmuvHEHP0f.HwHugH/HqH53H$H8L$$MnIT$HR0E1D|7 LG t>AD$ ‰ ueNIL$/@IT$GHHD€<0 tr@H<$I@8H==E1<R0IL$,@IT$DHHDƒ< H<$uLHV1H<$IH/_HGP0SLR0DHH?tfLNH<$IH/uHGP0L$$t[IL$.@IT$FHHDf

HD$xfHiaH5!H81R~ff.AT11UHGrHt0HHHHBHIװHL]A\@H]A\ ff.USHHHH5l`H|$HdH%(HD$81H9t )KL$f.\f(fTf.Bff.zPuNfT fV f. ("H= 6HT$8dH+%(lHH[]H|$ $l$)H)HdfDD,DD$ $H|$/H2l2*HcHD$"D$!.T$ \YfH,*Hc H\H9uD$/+EfHt$ Df/wlH=1fH|$H=Ht$H|$L$UHD$H=r1袺DAغ-DD$XHdH%(HD$1H$f/61v 41f/wHD$dH+%(u,H5DHD$dH+%(uH,HrMff.fAWAVAUIATLcUSH8H^H5]dH%(HD$(1OH9tHL$UL$t)AEAHr/EJcH>DH)f(fT%f.Hff.'!LL$L$9ʼn#ff**cfD1f/@fDHD$(dH+%(RH8[]A\A]A^A_If1f/@@1f/@@1f/@@1f.ȸ@HE1f.ȸ@HEpfHHLZHIHD$(dH+%(H8L[]A\A]A^A_ff/FfDLL$L$HIH0uH^fW 9F$H|$f(L$ѢHcD$dL9[L$IEH|$ f(fH~D$ SHHfHnff.z E1HHHL詴IHImu IELP0HH聴IH^Hmu HEHP0HLHH(I.Mu IFLP0DLHE1x HcIHmu HEHP0Imu IELP0H H+HCHP0fD- xL$H:f*f(XJLL$L$1l ,LL$HI4E1XImuIELP0LME1Mff.@G"fUSHHHH-XH|$HHt$dH%(HD$81H9tH1CD$0H\$H{H9tH0[\$(ff.zET$0f(\$f($w$f\$f.f(f(\^zbu`f(fT f.ztlf(f: \f/%F+wlH=MHT$8dH+%(HH[]f/f/8tX\%^f(fTpfDXfDHt$0H|$HD$tHt$(H|$\$(HD$FfHWH56H8 1 ff.ATHt8H;9UHt"uf(l$fTf/- 覮M9tLHD$HD$HHD$HD$?D$e'D$HL$,HT$(LD$8oH1LXH1QH5JH8 1]HILl$@IH1IsAWAVAUIHATUSHHdH%(HD$81Ht$(NHLt$(HL%RIAtfCHAuHt$0HHl$0E1H9EAtEHAuI9uTEtfW  L;-#MHtNH'1HL1֢Hmu/HUH$HR0H$HAJH5zH81HT$8dH+%( HH[]A\A]A^A_D-+0JHހ6.HE1HH\$0H)sHH9GELAI)LLT$AAHHID$HH9~dLSL2fYHf(LH)H)L9HL 06wfA *HXH9uYHHعHH)HL9HM+ $DA0A63f*XL$f*XH+5Ht$LL$DD$ $舙 $DD$LL$Ht$f.HLH5^H81H1Hɀ<\SHJЀ6v.CCHkPH6+Ҁ<UHM06-II)HHEH}HpՁuEHU0< OBHj0< wEH0< v1 HL$D$Ht LՅu=IIsHCHHt(Lk@L9vI}Ht LՅu IL9kHw1[]A\A]A^fAUIATUSHƇLgHHGHHXHtIEXH/!I}`HtIE`H/I}hHtIEhH/I}PHtIEPH/IU IxHJPHcBHRHHAHRHlHx-H;HtHH/uHGP0HHsMt2I]@I9v)@H;HtHH/uHGP0HI9wH1[]A\A]fDHGP0T@HGP0)@HGP0@HGP0@HGHHG@HHGhHHG Ht HfDHaCHff.HG(Ht HfDH1CHff.ATIUHSHHHt HՅH{Ht LՅH{XHt LՅH{ Ht LՅH{(Ht LՅuuH{8Ht LՅucH{@Ht LՅuQH{HHt LՅu?H{0Ht LՅu-H{`Ht LՅuH{h1Ht[LH]A\@[]A\ff.UHGHHWHHGHGHHWHBHGHHtH/t7H}HtH/tHEH]H@HGP0HGP0ff.@ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.SHHHtHCH/t1H{HtHCH/t 1[fDHGP01[DHGP0ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.SHHHtHCH/t1H{HtHCH/t 1[fDHGP01[DHGP0HHHHt1DATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.HGHWH~-HGHTH9s@HH2HHHpHJH9rH^?HfAUATUSHH_Hx-IIHIEH7H9Gt(転fHmHD$t@1@s̹ff.GH=t 鶶fDHc&D@H@HDPH=/ ]ff.f~HH@HPH= ff.fATfAUHSHdH%(HD$1f.zdubfTfV2f.E11҉ HUEe1HT$dH+%(H[]A\Ðf(fTf.f.Lf/f(f(fWH|$f8f(| f/=sf/+|$GD$7|xX\ƒY4f,ȉ*\f/vQPf=t` HHHff/ȿ|1D11f.zuuf.|$ 1{fD H1fHn9D|fT9fVQf.AE#H1H5H8( H/6H5 H8虶fATUSHHdH%(HD$"t HfE1f/H*zf/ ff.$1YoXH,ȉY$=111AA Hc D#HӈH1@; ofZ(T.7vfTf.gL$uHD$HL$HHH9u1HT$dH+%(5H[]A\@ xf/<$XW$Ѓ}ŀYEXH,t1111ffWA[D1HH ff.Eфu:\G~.DHa.H5*H8H3H52H8bATUSHH D$dH%(HD$"t HHD$fE1f/<H|$zwf/2ff.D$1YfH,ȉH*\YXH,tT$!11E11E1E1E1ۉAA D H+D#HDHDHHDH@8@4(1@ f/|$GD$=X=D~1DfWAD$t HD$HL$HHH9u1HT$dH+%(H []A\HQ1H5"H8*H+H5H8 A11AE1AANHHCff.Eu\fAAAAIAAfDSHdH%(HD$'"ALLljÍȁ =f B  *YuMH|u4@HD$dH+%(H[fDHIcfWhfDXxx{tf.u+u'HD$HHHPH9uD$@uuZZf.H)H5H8-舯SHdH%(HD$"+H7Hljщ ʁ3LffM MMA A A  A *YY A *XY<uXzu?HD$dH+%(H[fDHHfWfDXztutu DuHD$HL$fHHPH9u$KH'H5JH8*%踭Uu*HHpHtpHH,H]@H+H5"H8¼1]ff.HHtCHFt6LG@HHw@MtI(t1HI@LP0@H'H5BH8JHHtCHFt6LGhHHwhMtI(t1HI@LP0@HQ'H5H8ڻHHt3H;5+t*HFt>LG HHw Mu@1HÐLG 1Hw MtI(uI@LP0H&H5H8YfHHt3H;5L+t*HF t>LG(HHw(Mu@1HÐLG(1Hw(MtI(uI@LP0HP&H5H8ٺfHHt3H;5*t*HF t>LG`HHw`Mu@1HÐLG`1Hw`MtI(uI@LP0H%H59H8YfHGHt HfDHH-)H5.HD$H:HD$Hff.@HGHHHH1H~WHHBTH9HHH)HD t4HuHH)H5H8蜹HHUHFHHHH5 Ht;H5HԪ| "t$u,H=]y"uH=]pyt,H=耹HPH=$H56H81褅1]H=|]3yH)#H5BH8蚸HHt[H<$H9FuNHFH1L@HG0HtHHL9uOLGHHwMtI(t 1H@I@LP0@H#H5H8H"HW@H5!H81τAUHH5ATUSH(dH%(HD$1HL$HT$iLd$H5QL-v"L&`"t$H5L ;"L-<"Hl$H5Hu01HG'A]HHT$dH+%(H([]A\A]H5H表tEH5H莨AEua9tHV!LH5H81袃1fDА1zfH!H5H8芶1TH H5 H8j14ff.fCAUATE1UHHH5HPdH%(HD$H1HT$Ʉt3Ll$L؝HT$L1HLBfLt*5rIHD$HdH+%(uHPL]A\A]D;D@H=,`"j"\"^"P"t @HH5QH=_"Hff.@_"H5%Dމ"H5D"(H5DSHOt HHH ‰% ȃtHf*YuptfWN[@X`zptfu [s[麴f.HPtG|ÐwxH 鄳@UHSHHlH;$E|tHtH}PHH]PHuH1[]H}P1H]PHtH/uHGP0H1[]ff.AUATIUSHuH $L(A1Il$@I$xAH9v)@H;HtHH/uHGP0HH9wID$HHt*H9v%@H}Ht H/uHGP0HI9l$HwI|$Ht H/uHGP0I|$(H/1I|$0H/8I|$8HtID$8H/uHGP0I|$PHtID$PH/uHGP0I|$XHtID$XH/uHGP0I|$`HtID$`H/uHGP0I|$hHtID$hH/uHGP0Il$ H}x"=І"H"L%"ID$Hmu HEHP0AIAt~}H[]A\A]f.HGP0I|$0H/HGP0I|$8HLexf.HL[]A\A]fDLrVH[]A\A] fUH3sH}HtH/t H]{rHGP0H]hrHW HBPHJHHIHHBBHH|/H钰fHGHW H@ HHmHEHP0$LinHmiHEHP0ZH=cAVEAUAATUSHxlIIHH%DEtHRHt!LŒuNHr9HTItHuL衤tH6H8|teHs[1]A\A]A^@[]A\A]A^fAWAVAUATUSHDL$ HIIHEI>fH9otHwHtHEHHEHu HEHP0IrgKtLtHHt?JH@[fDHH9Ht$(@HGP0@HGP0@HwhH1H=w`USHHtQHGHtAH_H襓Ht&HHuHx1ҐH HHLHH9uH[]PH=蟔H1[]fDAWAVIAUATIUSH8L Ht$dH%(HD$(1H$MtIGIGIH$MtID$ ujHD$HAv0E1IvAv(T$HHI~R1AWjD@^nH0IHD$(dH+%(H8L[]A\A]A^A_ÐE1LE1sH<dHD$HtHD$1Ll$ HD$ HHD$HHEHHHHEHHMHLL6_uHD$HAv0HIvAv(T$HHI~R1AWSLL$HD@zmH\$@IHHD$0HH0HHHCHP0肅fHtH;5t鹎fHHHHt#HHHt郎HpwHHuH5H8f1Hff.@ATL%yaUHպSHHLHdH%(HD$1IHt[HLctLH$H{HHCHtH/t!1HT$dH+%(u&H[]A\fDHGP0D@ATL%`UHպSHHLHdH%(HD$1IOHt[HLPbtLH$H{HHCHtH/t!1HT$dH+%(u&H[]A\fDHGP0蔃@HH_t*uHoHHfDHHH1ff.HHt*uHHHfDHHH1ff.SHC~tgH=mHtOHPH@HHHHHXHHuGHHPHH2HpHvHpHHHJ[DH=跏1[H=WATUSHoHtfHwHHH9HpIHtHCL[]A\HH8at%hHCHmt)E1[]LA\fDHH8iauHEHP0L[]A\fDH H5H8AUATHLgMt3LoH=HLH=HLA\1A]L~@H=HH=VHA\1A]#~AUATHLgMt;LoMt2H=覀HLLHA\H=Ƹ1A]}H=htHH=HA\1A]}ff.UHHSHpHHt*H}t 1HHHH]HHH[]@`I1MtSHH@pHt*HSHtHx2HRH9HOHCHfH[_I1MuH{t1fDUHHSHoHHtBHUHt HH|HBHH9HOHEHHH[]+_I1MuHUHufDATIUHS1H9]~*HELH4HAt[]A\[1]A\fAWAVIAUL,HATUHSH(I}HT$1HL$HHD$HHD$H+D$HD$HA?E1IH9D$~*HI|1H蔍HHx-/HDAuHL$HH\$LyfDHH(H[]A\A]A^A_HD$HHD$H?ALd$H9D$~2IJLHH)1H8LcMxudKD$uH\$L)L9oM|$I9YI1HM)IMK<蘌HH-uLfDHD$H\$MH+\$L9LNL)IHD$Ht$H9J &HOHHD$H\$E1WHL$ff.@AWAVIAUL,ATUHSH(IuHT$1HL$LcMHD$HHD$HHD$A?AfL|$H9D$~6IJLHH)1H0vHHx')KD?AuH\$E1L)fDHH(H[]A\A]A^A_HD$H+D$HD$HA?fIH9D$~&HIt1HHHxusHDAuLd$IH\$IL9mfDMeI9ZI1HM)IMK4聊HH.tLH|$HD$IH9HOHHD$f.HD$H\$LH+\$L9HNH)IdLd$JH\$E1MDUSHHH5H(H rdH%(HD$1HCHHHD$IHD$HD$P1LD$ XZYtvHl$HHD$Hx~H94@HCHHP"HtHHH8U1HHGHHH=t|1ff.HxH9wAHH&P"HuH=u>HP"HtHHgH8'U1HHGHHATUHS?H1L A$1LEA$Mt9H]Hx'IH$Lt$(MHHD$0LIHHD$H]E1LMMI_IMfLIGHtHL$HHHEHAHD$HD$Hl$tHL$0H9L$ME1IIuI>1I_sHHuIEIULIGHtHt$ HHHEHFHD$ Hl$(HD$(IH9L9d$0 HD$If.Lt$fDH$HL$0LxHEHMHl$E1Ht$H<$LT$LT$I,@L$$MoHLT$LI|$}ID$LT$HHD$(P H$IE1HD$HN,H@HD$@HD$0LMHD$H1HHLL"}E1IILIH\$LHL4LM0\MWHt$LLE1\IIEHD$ HI,Lt$8IIHLN,LL)L4K44J<3ML)[IHHt$J|5LLE1[IHHD$(HJD%LT$1@H$H@HD$@fDLt$(MIIHD$JHLL{Lt$MMDHt$ HL{3HILH|$HD$AHt$@I)L,ILJ<#|{HHt$HJ|%La{@Lt$(MIIJDDHLt$8LuIMHHD$0H\$(MHHD$0HL$01I<$HLHH)H$HL$0H1HD$HHD$HLL<LLzMHt$ LLMzOD=L|$ H+\$HHI$M\$LMHEMHD$M~HhHIHl$I8HT$1LLL$8L\$(LD$8LD$L\$(HLL$8HvL,LLLD$8LL\$HD$(YL\$HL$(ILD$8MMLLHLL$@L\$(MHL$XL\$(HL$LD$8LL$@O$+JD-HD$H)L$IMhIiE1IMtHT$ MwHIHBHD$ HHH|$HHD$0H\$(MMH$HHD$0HMvHl$MlHl$E1~H|$ OD=%f.O$+HHD$DMHMHD$ H\$MLl$8HHD$ @H|$ 1Ht$0IMLLD$HH)H$H|$ H8I8RIHLLD$L)HD$LL)HIHJHH|$M HD$LD$8HD$IqILL$L$LVHD$H}LLL$LD$8HpLL$8LD$VMLD$LL$8>I@M_MHD$IIHD$(LuLxHHEHkHHt$@I9HKHL\$(LL$89L\$(HHHLL$8H)?LD$H)LL$PL$HHL$IIL\$XI{IpLD$8MI1LMHDLIHD$(vI~IwLyvL\$XLL$PLD$8HL$H H0IMaM{1IMtH|$InHIHGHD$IRH|$HHD$ H\$MH$Ll$8HHLHD$ I@M_MHD$IIHpL|$(E1w@L|$(LD$HDfDH|$M HD$LD$8HD$IqILL$HTLL$LD$8MI@M_ME1HD$IIL|$(Mt[LLHD$( uHL$LD$8LL$PL\$XfLD$8)fDHLLE1tLD$8JLtHL$LD$8HD$(LL$PL\$X1fDIE1IEIE1HMIIHMGHHMIHIMHMM8MMMILH\$ILVMML|$(ML|$LLN,@HLLIHT$H\$MLH\$LMMIHD$HIMIMMLcMHMMHD$YMMMMLN,LHD$(E1HD$H[H\$H|$LHD$AHt$@E1I)L,ILJ<#rgf.AWIAVAUIATUHSHHdH%(H$1HH9^H5<HSIHLpH@Il$tIl$IEI9HIN1MHHH9xH9MHOI)ILHMUH)IHD$IiI@IL|$@L<$I4LLLL$(LT$ HL$L\$qLL$(L\$HL$LT$ M!IUML\$8LHL$0H)LLT$ IHLD$HHT$LL$(PHt$(LIuLD$HT$LT$ HL$0L\$8aMUfDHQ1H2IH.HHLH5I,$uIT$$LR0$H$dH+%(7HĘ[]A\A]A^A_@LL|$@MUMHHD$E1L<$M1I 1M~!fDHTHtHHHI9uH\$HxfINHL$ LT$fLHL\$LT$HL$NHL$LT$LHT$IL%KI7CHD$8Hl$@Hx L%4fDATHtEHGt811HHt@H(At DA\DH@P0DA\)H=TAOAff.@HGAVAUATIUSHFAHGHVHH9t AM1HCFfDID$L4H4HEH<-QxaHEIT$t^HH9}H9|A `H5Jc H>DHH[]A\A]A^@HqH@1@H9~H9~AAID$[DJ40HE]A\J<0A]A^2AtxHHH9t/HɾH[]A\A]A^H9H9H9tH H9H9H{HH۽HҽHfAUATUHHSH(dH%(HD$HFHP`HtaHtWHhH09IH+H2HD$dH+%(OH(LH[]A\A]yfH;Ll$Ld$HLL&H$H}LLHM>IHHH_XHHUHL$H$H4HPH<NDHHHHHJI9u%HPH=H5fH811HT$dH+%(uSH([]A\A]Ht1fLeHT$Ht$H@1W>f.AVAUATIUHHSH HVdH%(HD$1HB`HtbHtXHH0A7IHHHD$dH+%(H LLH[]A\A]A^DH; Lt$Ll$HLL%kH$H}LLHuHH<(IHtNHXH I$ID$HL[A\HH5E1H8=HL[A\@{fAUATUSHHLoLHIHHPMx.AH!II$HL[]A\A]DG؉D`McIvHsIHtHCID$MtHHsI|$&HL[]A\A]fWfHGATUSHH=AHxZH1HHtd@HuHcHt'DHPMcL`H?HJu[]A\fDH1IHHHu~HtL`XōGH!HHHH[]A\@HHHc1USHHoHt9HHuHGHH[]@HHt*H+CyH1[]w1HH[];f1ff.HGHt H@H+Gy 121fHH;UHH1SHH?vMDHuHcHLHt$HXHPH?HJuH[]@H[]0ff.fAUf(ATUSH(fT ddH%(HD$1f. df.f1f/v fWjdH|$ D$hD$IHH$}HckIHtJkDD$)ЍxDH,HcfɿADH*\sՅu!HD$dH+%(uzH(L[]A\A]I\$ؐHD$dH+%(uQH(1[]A\A]o/HH5E1H89HH5E1H8t9v *f.HAUHATUSH\7HAAADEȃA1 f.A8|HHH9uHE1E{IHI9|JHHHHHIHMjMc11A11#HH%?LADHI9t5tLIIHH AwHLI9u˅t ATHHH؅HEHIxHHHH@AtHPuHHH9tHHHHHI@HL[]A\A]HAHHHfE1E1n@II)L9EE11 -fHQH5҆H8*7HE1[L]A\A]1fHG@fLGHFI9tLH)1HҺH@LHIH@TL9u Hy1)HcHHMHHff.HGHHHtAHHHHID'fHHHH!H ‹DHHH)L9HGHsIHH9HGHf.GtHG@HIif1HÐff.ATSH/ ""D$t6H "f. "HcH< "u"H "tw"HH< 0f"uHD[A\ AUATIUSHHGHo H=H=~H9HHH~^I\0E1H;Ht H/uHGP0H{Ht H/uHGP0IHI9|IT$Hu Hc"O~)HL[]A\A]/HHfDP_"H "L$H[]A\A]fHH9GtfDAVAUATIUSHWHHHHw HNHID$(Ln HM~e1fID$(H,Ht|$-fNH4DHfHGr$G0HG$F0H/IEP t`HH0HH@HEIU HH4PD$A0HfDE t0H|$@HG0HwHHEHH@HHD$H@HHD$HpHپH=O^4H@HHH5kH8y ff.@AWAVAUATUSH8Ht$(H$HL$LD$ HHGIH ~HGIHD$ILHLLHLH?LHH)I|IHHXE1ISZ/DH\$HAtM~L;t$?L|$8H~=D$$H|$01҉DATHH Љ!HADHsI/uIt$HHHHHfELHPEuHHH9tHHHHHID$H|$HD$(HwL HHHHHDDHPEuHHH9HH\$HHHHHCfD11@ATЉ?HH9u߃EH\$L|$8HHD$HHtzI,$u ID$LP0I/u IGLP0HD$HD$(HHD$HH[]A\A]A^A_HD$0ADC9Dr1LIGLP0|HCHP0w3fAWIAVIAUATUSHdH%(HD$xHGHD$pHD$hHD$`HD$XHHHHHFIILHL9~HILIIM9FHEH9AHp1HHD$xdH+%(* HĈH[]A\A]A^A_DHD-L9"MHL$hHT$pLILwM9HL$XHT$`LLQyJ|%HHcHD$`Hl$pHHHD$IH$NI|$HpHCLD$HD$LHHHt$ HD$(LIL$LD$HHHD$8HCH)HD$hHt$XHHt$0HD$ IHLXH@H|$LT$HLL\$@H-LT$HHD$8L\$@IJHHHsJLLT$8L)Ll$(Ht$I)LB LT$8I*IL$HT$ LHt$ I,$[Ht$HIHHmsH|$HHD$HHMHD$hHD$pM9MHt$0H|$YIHrHt$HHD$HHu HFHP0Ht$0HHD$HHu HFHP0HD$XLLHD$`I,$Hu ID$LP0I/u IGLP0HHMHt$HUL} Hmu HEHP0HsHHHHHf|HPuHHH9HHHHHHCDIGHHHIHHD$IFIILHJ<&HHHhHH1HHeHM9nH|$IvH\$N,E1LLLIL)IHHHHD$fDElMLE1I9sIADIHILLAHA?DJIL9wHD$LMt A?DHIH9l$uH\$HkHHHHHDLHPEuHHH9CHHHHHHC-I,$u ID$LP0H+uHCHP0fH|$pHt H/H|$hHt H/H|$`Ht H/H|$XHt H/1fIGHHIFHHHIHHIHl$H|IHHtHxH@1H|$HkHHD$8HdI~HE1H|$ HD$(ML|$0Lt$8DHD$J H|$(HL$L9HHD$ IOH4Hq InH|$0L IHLHHL$HPHsHD$L)H<LI/u IGLP0I)IMhHt$8HHD$HHHsHHHHHDDHPErHHeHG1P0fHT$pHD$hHT$`HD$XHHvHGP0HGP0HGP0HD$HNMlLsI1IEH\$HLHD$MM@DeILAOLO$IHH%?AGI9vDAED IHILHȉH?JHM9wHD$H)HITHtHȉ?H tBHIHH9\$K^H\$H+HCH1P0ID$LP0IBLP0dH|$8HGP00HGP0HEHP0~I$MHHD$1LT$@L\$8H<\LT$@L\$8IJH+u HCHP0Ht$8HHD$HHOHFH1P0I<0[SЃI~HD$HJH#t AFHcNI.Hu IFLP0H=D$4HEH52lLl$Lt$IEHHD$ Ld$8HD$HLl$(MIHD$(HL$ ADD$Dd$DAADd$LLHD$HIHAMtImu IELP0HD$HH1LHL~$I,$u ID$LP0Ll$HHD$HHzL$uAIIKHl$ HD$ HMLd$8Ll$(MLcd$LJtP1HD$HIHtoMtImu IELP0HD$HHt]1LHLxZI,$u ID$LP0Ll$HHD$HCLd$Ll$8M7MLd$8Ll$(MIc~MLl$(Ld$8MHD$4LHIFHD$gHD$E1VLd$Ll$8MHD$HHD$lff.SHHHGHwHt4Ht{Hc[HHt HSHHP[fDHc{[VfDHx%HfKH9GtCHHkff.AWAVAUATUSHxHWH|$Ht$HJdH%(HD$h1HFHwHHiHHD$HJH9XH|$HD$H|$ H|$HHD$HJH9XH|$jHD$H|$Ht$H|$zyH|$`Ht$H|$HD$H\$H@LSHD$XLT$PHE1HMHD$ Lt$(f.HD$LH^N AQ1f.wH=0<MEQ<HAQ A)LfA)DIHL H 1M9 HL$T L9H|$DB|HH I9|H|$|HH HHyHHHH9hHE1AE1ADDHD)II)HIIHLIL)IILHL9 ILHILAN$H9uEAtHHLHHLHHIIHD$ HrHpHD$HD$(Hu!HD$H8H9t$PHHpIHD$1LHHD$MLL$ L@HD$L\$(M^KHHHHIHHOH|$HIHHHbH|$HHL$HH(H@HHHHHuHD$hdH+%(Hx[]A\A]A^A_fHEH\$Ht$1HL$`HHHD$HHu HCHP0HD$PLt$`HD$XIFHD$PHD$HD$gHL\$(Ht$ ~IH Ht$ L\$(Ht$PfDHD$Lt$(HD$ @HD$H8HHD$wLt$(H\$HHD$HHu HCHP0H\$HHD$HHu HCHP0H\$ HtHHD$HHMI.IFLP0f.1HL\$8Ht$0nHD$H@Ht$0L\$8Ht$X7HD$HJHCHP0iHOHT$HD$Q0HT$HD$INHT$LHD$Q0HT$HD${H0Lt$(H;t$X,HD$HD$`H\$H;HWH|$HHuHSHD$HR0HD$H\$ Ht(H;HWH|$HHuHSHD$HR0HD$MyI.oIVHD$LR0HD$VH\$ MLt$(HtHHD$HHtJMtI.tKHD$L|$HD$?H\$HHD$HHHCHP01HCHP0IFLP0HD$L|$HD$H\$H@H;HD$`HWH|$HHHSHD$HR0HD$H"HD$E1HD$ %ff.HGt?HFt2HAH9t6AwFH T'JcH>f.H<H@A*ALEtGAAv01HfAuH>HHf.t@H=t鐅xf.uff.uf.AWAVAUIATAUHSHHGIILHH?D[HIEHHHHH?IEI9|0A^tJA|A&!H1[]A\A]A^A_LIHDAHLIA^uA1t$ IcL^t$ HIb1HTA3TATHH9uI9D5?ADHI9uEaIFI\$CD?HFIT$KtfD H?ȉ?JH9u f.L舯HM~.1t??tHI9uH]@H߉t$ 4t$ HH~/1A|??|HH9uI&A!LDIcLԮIHHm1DTA#TATHH9uI9EHmu HEHP0Imu IELP0It$HHHHHfA|HPuHHH9tHHHHHID$HL[]A\A]A^A_fDA LEIcLIHu$HmtmIm9IELP0*1H~oTA TATHH9u@LH4H)I<4HHDHEHP0HmHEHP011@HGt HFuH[7HfDH&HGt HFuH7HfDH^HGt HFuH6HfDH|cAWAVAUATUSH8dH%(HD$(HGWHFHCHWHFHII1HHXIIIIIILHIHwH]I~ IHCDDDDDDLL)H9HH9H1HH)BDHɃvwL !A1HHBDvfDwAHHcH)H=H=mHH9HLLpMH7H)HHHH?L II)HL)I93KHL$HxL$HD$跪L$HL$L G HIH~6JHx1HL$L\$H$DL$L\$L  HL$H11HHH HH?HH)HHH)H)KM~%THH H?|HI9uHD$E1A|IrHHHHHE\HPEuHHH9tHHHHHIBHI_LHT$ HL$L$L I*uIRH$LR0H$L HkH|$ HADH/uHWH$R0H$L HPHHHHHWL1III)MvwA HL)HcLH9HL h6tEf!pLH*H~*YHfLH*XuH(uHP $HR0 $IH=~1 $H=~6 $f.z^Df(bDH12HHT$(dH+%([H8[]A\A]A^A_f.xMxfHD$(dH+%(H8[]A\A]A^A_hI~IE@BTfIGH*H~$AYHfɋTH*XuBTfID$H*H~(DYHfۋTH*Xu^M)fWHCDDDDDDIGH9H5H5H8z1GICfkfH*ȋCH*YX(DHLHLH?J42HH)I)H4$LIHqH4$LIL HHH)HH)MHA~IA1L<AAADHDH D!HADHsAE1I fu HDHE1AsH1H5#H8*1VHDEMZH1fAH1H HIAIH)HsHHHHHEDHGEuHHH9tHHHHHHIzHHIɽLADH3H5IH8i11fHf.3zuD$茓D$HuH1HfAUATH(dH%(HD$HGt HFu4H%.HIHD$dH+%(H(LA\A]fDHL$HT$ixe+HT$Ll$IHt!1HLLoDH*u HBHP0ImuIELP0dfE1Z賲HGt HFuHK-HfDAWAVAUATUSHHH臢HHjHkHsHHIHL$HHH?L II)LLL$HH)ILHH,AHO<(ILmIHAH{LpL$HL$H~JI|$1L$vL$1M~3K<11fDtHH H?tHI9uHu`LHIHHfAtHPuHHH9tHHMHHID$HL[]A\A]A^A_fDCD뙐ILp+@諐HuFH*H5H801H[]A\A]A^A_H1[]A\A]A^A_õ1ff.AWAVAUATUSH8dH%(HD$(1HGHD$ HD$HFHLwIH^BIH^HL$HT$ HLH|$Lff.AUATE1UHHH5HPdH%(HD$H1HT$ t3Ll$LHT$L1HLBLt*usIHD$HdH+%(uHPL]A\A]D{脧@AVAUATIHH5*UHdH%(HD$1HH$dLH<$Ht"HH2HxxKH(1HR&I9D$L'IHD$dH+%(/HL]A\A]A^ÐH8HmIM ǫIHH&LHI.Hu IFLP0Imu IELP0HtpHLHmIu HEHP0MtLIv L蠏I.I/IFLP0 @I$MI.tf.E1H@HP0H%I9D$fHEHP0謥ff.AUH RATUHSHHH HH0dH%(HD$ 1HD$HD$P1LL$ LD$(ZYHt H{H|$H5h AŅAH|$HtrwH4$H1ۧIHtcH$Hp ADHzx1HD$dH+%(H(L[]A\A]1@I,$uID$LP0fDE1H|$H5WCH(H5E1H8薳xH H5E1H8wYfHH5E1H8W9ff.fAVH 3PAUIATUHHH HH0dH%(HD$ 1HD$HD$P1LL$ LD$gZYHt H}H|$H5\AąAH|$H(vAEH<$nHHHpDHx D`HmIu HEHP0MtWL;-("tQ11LLuI,$HteI3H|$H5T诔\HH5H8E1HD$dH+%(uHH(L]A\A]A^fDE18ID$LIP0HH5ZE1H8藱0ATH=!nHtKI,ID$ID$ 賁HuLA\I,$u ID$LP0E1LA\DHub!H= HL 9fHxHHH0HH HL9t#x/H9xuH0E1HIHHH=!t HHH5cMH=܊!Hff.fUHHH5 H dH%(HD$H; LD$LL$HD$1eA1EtHT$Ht$HHT$dH+%(uH ]~ff.f!0H5ŵDHVUUUUUUUAVAUIATUSH?HHHH?H)L4RHIH~HJ|3((IHHMD$(HھLhLHhHID$ID$ eII<L1d[L]A\A]A^fDHm !~|H!!HL$HJI$MD$(ID$Il$ID$ID$ ID$(sH9HDJ|3(!IHHMl$MD$(I$Il$ID$ID$ HsCHtAt fADLHqI|$0LID$(IDHH)H HHH3oE1AADHATIUHH!tQHo!!HHHH =!Hh L`(HQH@H"!HPH]A\fDH=lHuHmtLHD$3jHD$HHD$wHD$HHtH1H+1HÐHHH=UU HT@HHH~ fHH9HHt 1H1HfAWIAVAUATUSH(H~5HH9~(HmAH(D[]A\A]A^A_fDH~IG(Mo HD$IG HHI9UIUIG(IM(H^HH|$IM H\$_HH\$H|$HHWLH0Ht HzHH2HHI9uL|$MW E1ALL$fIYHIJI)Iz(MyILAH~H_L$ LHH!#H4Ht1HHHDL!H~HH4GHuIR H4RI4HHHD$IR H@ HIR IM IL~H.H^IIL9L|$IGI)BH|$H~'H\$HIHCHTDHHH9uImH\$H~!E1H9H gL9~ H4fHc4H/fGL#HL$L9LO@L9~HLLDH?HHPkHIWH)PLE1ڣLs H4AH<L9HHO5IWH)PMo AHVUUUUUUUATUHSHGHHHHH?H)HHuI$LLD$ LT$L\$HL$H4$fI,$H4$HL$L\$LT$LD$ u4$ID$LLD$8Ht$ P0LD$8Ht$ LT$L\$HL$$HD$0H|$(H@ H9M;fHGH=PM,XIHD$HMHt ILDL8HD$@IHHXL[]A\A]A^A_@H9~M,DILDsMc,HELHLD$LT$HL$HmHL$LT$LD$AL$t?EHD$0H@ H;D$(t^HD$(L@(_O$XM@fHEL\$HLD$LT$H $P0L\$LD$LT$H $fDH;kEHD$(IH@rHD$HMMHtHHD$@IL(O$MHD$@IHI)IHD$HHXLPHD$@HHHD$HHILAff.@AWIIIAVAUATUSHHHw IH $HFLD$HV(HHH=H=~4AL9MH;=vu|IfHH H\ L!H=H HH4II4LnM9L9>uA} A~ IEI;F/HNAu A~ 1H@ M^H@ IE0I}H@HELHL$ LD$LT$LL$(xLT$LD$HL$ IR LL$(HBH(H=0H ZH MtIHD$IH\H9~fH DLHL$(LD$ LT$LL$茞LL$LT$LD$ HL$(IR HBH(WHc hIMtIIB(H|$JHLHL$(LD$ LT$LL$LL$LT$LD$ HL$(BzfH;=;HL LL!L$DIF0M^H@LE@ LI}HRfDA} A~ I}I;~H&AE Av 1uxH@ M^0@I~HLHD M]0I}H@IELD$(LT$ LL$HL$IHL$LL$LT$ LD$(DIR HBH(LLD$(LT$ LL$HL$諜HL$LL$LT$ LD$( LLD$(LT$ LL$HL$pHL$LL$LT$ LD$(vI}H3IvHff.AUATUSH(HW dH%(HD$1HgHD$H9Bt(HT$dH+%(uNH([]A\A]HLd$Hl$ILLHH]tHD$H@u1耄AWAVIAUATIUHSHH8dH%(HD$(1HHG HH(t)H pH9NtH@HWHH4PNHC LD$LHL|$ LD$HLPLD$HIrHCHHHH{(MHT$ Hh!H:HHNL"Hg!HCH/fHmE1HD$(dH+%(H8D[]A\A]A^A_HU@ID$@WHHHtLD$LLD$4ID$H; HCHKHHHTHH{(HCHHHSHRHSH HHHDHCHHLD$H4BpI,$u ID$LP0HmAHEHP0fDI&HT$ Hf!H:HHtL"HCHkf!HCHm|rfIuHC HxHP?HH HPHx(LD$H4IHHHAL9HB HDHEHP0HHHLD$HLD$H"H9EHHEHH7fHGP0Hm@HC HKH;H H@HLD$HH4HfLD$HuLLH{ NHC LD$BL(HC HHHH Hs(HjL2Ht]L$H5d!HHCE1HVHSHd!HhHH fHKL91HC Df.Lbf.HVfB GHrHuH{ LLLD$耔HC HJ H3ID$HHfH;HKHUHHRH=ՠxAUATUH0dH%(HD$(HG HuHIH9FLzIHcHHxPHT$Ht$H|$ [xHE HE1LLHL$PHT$Ht$H|$ H nHxwHD$HHT$(dH+%(ucH0]A\A]DLnIU͏Hj@HE E1HL$LLHPHyΉ1f.17~Hb!UIHW H)HK @HHoHHgb!LJ(HGHBH=~KH=H9HAH LH9Ju1DH5 HrD2(HHW LH zH9JtHxH@H/uHGP0Hmu HEHP01]fDHAfA qLDHILHGAVIAUATIUHSHG HPLh(H~(H~}H H4H9HOHIHX H H9PIF(HtEH~'E1IF(J9fD1DUHH EHtHH]@1]@ATIUHHHDHtHLHH]A\݅H]A\AVAUATUSH dH%(HD$HG HG H\$IHLt$IILPHHt|HtnHL$H9tcH}(t2HE HHp uPHE LLILHPHL$HHt$HHT$dH+%(u4H []A\A]A^L|cԾmH=9vxiATIUHHHH9Ft*HdHHt%HHL]A\gHVHuH]A\ff.@HtRf_ff.UHH CHt HH]_]AWAVAUATUSH8HT$dH%(HD$(HG HHIcIHHE H\$ LLL|$IHLPIHHHD$H8HH}(t5HE HHp0uvHE HILLLPIHD$H8HD$ЃtIE1~HL$Ht$ LHAHD$(dH+%(uAH8D[]A\A]A^A_LfaAfDH=tAZgf.AWAVAUIATUHSH8dH%(HD$(1H%HG LD$HIL|$ LD$LPLD$H7HHT$ L2MHK H{(LD$Hqt0HHC LLD$LLHPHT$ L2H5J!HH|$HkHVHJ!HSHS HJHr(HD:(HS Hr(HJHH@HH HH9JHxH@H/uHGP0Ht3HEIHD$(dH+%(H8L[]A\A]A^A_DL_E1H~7AL9~DHLHHZbAHfD~+DHH~!H9~HeHHff.AUATIUHHuHt]HH]A\A]HIH9Ft(H(`HHt7LHL]A\A]c@HVHu@H`^1@1@HG AUHH!ATUSHHo(Lo H9HG(HH!HHHHW HGHpH!HGHt_Me M~/1@H|HtHDH/uHGP0HI9uHo0ImtH[]A\A]DImuHL[]A\A]=H}HHHH}1Hff.UHSHH@/H]0HE@HEHHEPHE0HE8Ht*DHH[H}H/uHGP0H/HuH[]ff.UH|HkHH]ff.UHH`HtHE`H/tAH}hHtHEhH/tH|H 1]fDHGP0HGP0AWAVAUATUH1SHHHdH%(HD$81qZHL5IL9pHtcHL`DHtSHmuHEHP0LHHuI.4HH([]A\A]A^A_HL--IHyHHLpHmuHUD$HR0D$I,$uIT$D$LR0D$(I.tkH([]A\A]A^A_fDHEHP0fH9t HNHuIH(1[]A\A]A^A_ÐIFLP03HIFLP0H([]A\A]A^A_HHVUUUUUUUHDIE HpHHH?HH)H9IW HBH=HJ HL$HWLL(E1@J,HILL$HELT$LLLWLT$LL$HE1HmuHELL$HLT$P0LL$LT$I.uIFLL$LLT$P0LL$LT$E_IG Ht$H9p 5IIL9T$yIG(MqM!HIiI2LT$LL$HudLL$LT$LHLLLT$LL$A*DI.u IFLP0HmHEHP0HKHmHEHP0H=GHQHLHtIH "Z@ H=l_@H H4H9HHOHH5H8`LFrf_ff.@ATIHHUH1HdH%(HD$1IH$Fu"HT$dH+%(H]A\ÐH<$Ht/H5@(H4$LtK(1HttHtHL(zkkOPff.@HH A1At HHHÐH KLGMSHI@H9GHG MH Ix(Iq HtxH9|YH9~SHHH@H<tIAIq(H=~H=HHRHHDHHk0HK H[HCI(tR1[fDIIIQ(HOH<@H HH9|DHH9~HzHH@tHBI@LP01[f.HWHfH)H5BH8^HC1cH<ALL9HIOAH<L L9IOH,1DSHHHtRHGH9CHW Hw(HC HJ Hu:f.LHHMuaH9|HCH/tmE1L[DHr(HRH_L@JHH9|DHH9}LFHHMtHHk0LHS I[fHGP0E1@H7HfHH5ҴH8\E1HC[Lf.LAL L9LIO@HMuM9t(HH5ZH8\H1[]A\A]DHcM$;K$uυ~3H}0Hs01HtHH9tHH;tfDH[]A\A]G(uHG@u HH@HHH5H8f[1Hff.@AWAVAUATUSH(dH%(HD$HG WL5HHIL9vH GIHH{(HC t%L9utH@HSHHH4P蘮HC L|$LHLt$MHLPHH{(HxVHT$L MHD$dH+%(H(L[]A\A]A^A_LnIz0DHtZHT$L MuHCI$HHH$H/!L"MHCHH.!HCifDE1[HC HKH;H t1H@HHH4HxHuH{ MLL^HC HxHPHH HPHx(LD$H4IHH~0HH9L4B IBL(HL4HCHEI$HHHtrHC HS(InM.HH H^L$H=-!HHCMHWHSH-!HhHH Ef.H|HC DHU@t;HHHkHхt"HH9EuRHEHHuEID$@4HHHtL҅ID$H;HCHKHHH?HHCHHHSHRHSH HHH1 H= UE1:HKH9~HC fMfHCHHH4B=HuH{ MLL\HC fDL4VfB GI L4J IH;HKHUHHfHU@HHHHхtnH/H9EtMHCHKHHHHHCHWHHSHRHSH HHHHT$XHEHHuID$@tHHHtL҅tID$H;jID$HHXID$HHH;aHKFHUHH5y\FH=gPVUHHH57H dH%(HD$HLD$LL$HD$1U A1EtHT$Ht$HGHtHHT$dH+%(uH ]EDSHHHCH tWj0HtGHPHHHHXHHHunHHPHH2HpHvHpHHHJ[@HHHHVH5bH81h!1[@H=ī_R1[H=\fTff.@H5TH5UTH5TH55pTH5m`TH5PTAVAUATUSH[HGH GLo(MZHVUUUUUUUHG LpMLHLH?HH)HH<H<]IHH= .IH4L`(HE IE HEIEHA(!HH6(!IEHE HI~&HU(1fDH HtHI HH9HEHHtCIEIUHHHHIEHHIMHIIMHHHP[L]A\A]A^f.[]A\A]A^#E1O H=\P[L]A\A]A^ `IHtHH3tI,$uID$LP0MzLhmH=dR"AWAVAUATIHHUSHI,$tHLXHMt9H@HLe H]AM9tSHD[]A\A]A^A_ÐHHHtH[]A\A]A^A_\]@H[]A\A]A^A_8DLXMtLm M9tI$HE1HLXI$HXdR!HVAMHT$H4$^HHtHT$H4$I$AH88HXAHHǃXH/{fDIELH4$HL$躧H4$HT$HH\I$HǃXI$L!HH9EuH}(tIEI$IEHH9tHIuH9HVUUUUUUUIuL<6LHLH?HH)HHH9HHHHtHHHTL!I~II QH9u@II L[ HPIT$HPIT$ H@H@H!Is HHkHC[H!]LA\II9I H)H9H Hf.IJJI9HObfI9~ I fIc HBpI~wI9I HfH@HICKI QH)H9tH#HDI QfwH(u H@LP0HqE1H5H8BL[]A\H8u L[ ICI,$u ID$LP0E1[]LA\f.I Hc)H9tHtHfDI HDLOMATUHSHIAH9GHG MA Iy(Ip HH9|H9HHHH@HtI@Ip(H=HRHLdHE(HHm0HM I$HH8u[HxHh L`HX HH/HmH[]A\fDHEI)1H[]A\=HtL`HX H[]A\IHIP(HH<@H HH9|fHH9{HZHH@HtLbf.H=H@IALP0H1[]A\HUHD$HR0HD$H[]A\HWHD$R0HmHD$fH_H4HѮH5H8?HE1H<ALL9HIOAH<LL9IOH1ff.fAWAVAUATUSH(dH%(HD$HG tHFH u3HlHHT$dH+%(H([]A\A]A^A_DBAԃwHFHH9G<HO E1Hy }DN,MLxLU E1HL$IEHHILARHHD$H0HL>I/uD$ IGLP0L$ ImuIEL$ LP0L$ HK IL;q HAHQ(H=~H=}HK4vHHHS(H"LhI/u IGLP0Imu IELP0 I1M@11A9t9HaDH4AH<L9HHOaHi(@룸t-HHtsHV1tH~t@ATUHLf HvHHtDHHLxHIA.f.HH52HmAu HEHP0E~!LHHu7HDEImtHD[]A\A]fDIELP0HD[]A\A]AAWAVAUIATAUHSHLvL=M9tH5I9t LQtmL HHx-H Hx A?H DHcH>f1H[]A\A]A^A_H9AuvHtLLH5>I9xpLH5΢I9XPL@HHoDH9}HH HH[]A\A]A^A_fH9}HLfDH9H9~LHtH?DHLAuׅq@AVAUATUHSH9xLnIH5JI9tL5M9tLHE1HtHXLHH9HwIHu>f.HLu/Hmu HEHP0!LHHuImaHH!H[]A\A]A^@LL4H56I9$LH5ƠI9LDLIH f.Imu IELP0[1]A\A]A^@HGHKHx@HћH[]A\A]A^@IELP0qHfDImuIELP0ff.fAWAVAAUATUHSHHHL-JL9tLHE AFH(DHHIHH}L9tLTAAL;%ݚu EL=[M9u AI,$H[0Hm0HHHH ucDEA9LE=|IML%)I$HL[]A\A]A^A_ftNH[HmHHHH tu.u*HuH;9,yE1ID$LP0O1nL%MRfBfATHPoOodH%(HD$H1oW o_0)L$HD$)$)T$ )\$0HtHHD$0HtHH8H|$IHtH/tiH|$0HtH/tIMt#H=܎LH=q=H1$IHD$HdH+%(u*HPLA\HGP0HGP0fAUATUHHHt0AL]A\A]]H=A\A]oHE17IHt#HELH=Hp1 I,$ItH1L]A\A]ÐID$LP0H1ff.AUIATHL#HtaHI1LH5U1>)HHt.H(tHLA\A]@H@P0HLA\A]DI,$u ID$LP0E1HLA\A]AUIATH"HtaHI1LH51(HHt.H(tHLA\A]@H@P0HLA\A]DI,$u ID$LP0E1HLA\A]AUIATH,"HtaHI1LH51(HHt.H(tHLA\A]@H@P0HLA\A]DI,$u ID$LP0E1HLA\A]AUIATH!HtaHI1LH5E1'HHt.H(tHLA\A]@H@P0HLA\A]DI,$u ID$LP0E1HLA\A]UHSHHtYHHHtHH[]HEt+HXHtHNHHuH[]5HH5H8'1fDUH $HHHHH dH%(HD$HLD$LL$HD$1A1EtHT$Ht$H9HT$dH+%(uH ]ff.AVH5sAUATUSHHuHHAHOH1#IH31H5H1%IHt\LI,$Iu ID$LP0M*HsHL1MHLI.IHmu HEHP0Imu IELP0[L]A\A]A^fDHm1"IHt1H5=H1$IHt14@H 1MLII.ItIFLP0HP\Hmu HEHP0E1[]LA\A]A^HEHP0LE1ff.UH SHHHHH8dH%(HD$(1LL$LD$ D$HC0Hl$ H6T$tHC8H9(t}HHHHH HHS@H HD$tkH9K8t5HHHC8HAHAHHHHCXHK8@HiHHT$(dH+%(H8[]f.H9K0tHHHC0HAHAHHHHCXHK0KHt1fHHt$ HD$H:HD$hDHHHD$H:HD$BHK0HK8ufAW.AVAUATUHSHHGLhLHHPLEH}HHH9E1H5H1!IHH/I,$IMLLH=~1 II.ttH)HL[]A\A]A^A_f.A~HH=i[]A\A]A^A_fDHLH=~1[]A\A]A^A_fIFLP0H~)@ID$LP0MC@HE1U)TH}'+IHtH]0E1Hu fDIFN$H[IHtkH3HHt$Ht$HItfH¿1IHM9~HL I$xYHI$uID$LP0M9~}M~tDHt$HsHH8n_HI$uID$LE1P0BE1:@AUATUSHHoDoHOLg0HM0HG(H9EXHEH9G UH}0L HHLHHHU@HHHBAHDBLc0HHHC0HMCH{LHHHCLk8I}I}IEH/uHGP0I} H/uHGP0MeMIm HL[]A\A]HH5byH8HkHtHCHmtE1HL[]A\A]ÐHEHE1P0HL[]A\A]DHIH5*yH8:HC 뮿IHQI,$u ID$LP0HmuHEHP0H{0HtHC0H/uHGP0H{HCHCH/1HGE1P0%@HH{0HHC0H/뾐I,$u)ID$LIP0fDHC0IHtI,$+ID$LP0HLH8IHɉHs0H8-FAVAUATIUHSH0HHIHxtHU@H4HtgH}0tLLHxXHH9EtaLHx<Hu,HHI[L]A\A]A^fDHtVE1[]LA\A]A^LLHRIHtHLLH( yI.uIFLP0fHYH9EcIf.LHIH=LHCI.IFLP0@HALE1H8 ff.AUH 3ATUHHHHxH dH%(HD$1LL$LD$HD$ttHLd$Ll$LHHt-LLHHT$dH+%(uH ]A\A]D1? ff.@AUH sATUHHHHwHdH%(HD$1LD$D$Le0MD$umM,$IL$H1IELBHH~HL14ImItJHmt3HD$dH+%(uhHL]A\A]Le8f.HEHP0@IELP0HmuDE1HYH5vH8j ATUHSH֊L#fH1xH}`Ht H/uHGP0H}htHJHbHHA$P0A$Ht~[]A\Ð[H]A\@[]A\AWAVIAUIATUSHH/HVHAHLfHI$I9\$H-ֶLHS11HLHkHHD$LD$II(u I@LP0MbDLHHHLHpHHLHD$LD$I(u I@LP0Hmu HEHP0tI,$u ID$LP0I/u IGLP0urHuhMt LHLGIHL[]A\A]A^A_ÐLHHHt(HLHmu HEHP0uDE1H-ILHI9\$1HL1HI,$u ID$LP0HtHLgHmu HEHP0tM#LfDHmHEHP0HH5:qH81E11fLLI,$tID$LP0LHI,$HD$ID$LP0LD$XI,$ID$LP0AUIATIHUHHtkHJLLHHHtOH(AtD]A\A]H@P0D]A\A]HH^H5?pH81Aff.fAUIATIUHSH(dH%(HD$1HHHIE@H<tEHmAt(HD$dH+%(H(D[]A\A]fDHEHP0@ HIU8H(L`HPH@Ht!HBIU@IEXE1IE8H|@IE0MHtgHmu HEHP0HHt$H|$LHLH$Ht$AH|$.Hmu HEHP0#HZHH8AVAUIATUH-ۂSHH911$IMtlI]0I9mHu9ZH3HLBHmAu HEHP0EuH[Ht#H3LHHuI,$tfDE1[L]A\A]A^ÐID$LP0[IbHu&fLHLuH[HtH+LH7HHt/LsHLLtI,$nyf{HEH~HH8P.ff.AVIAUIHATUHHHtJHLHLIFtH]A\A]A^fDHLHL]A\A]A^fHtRfff.UH dHHHHnH dH%(HD$H+LL$LD$HD$1Ht$HHH9EtXxHt$t(HHT$dH+%(udH ]f.HT$Hx?HD$H@kHuHuHT$Ht$HZyfD1ATUHHH=H@IHPH@H@(H@HHHu|It$ HHID$HHIL$HIIL$HHHP#xHL]A\@I,$ID$(u ID$LP0E1HL]A\H=x"ff.G(uuHHW0Ht@HHH QHEH}H5jH811HDG(HHot'HHHHH@Gu҃HWH GHG؃HHGHGHHWHBHGH=7j2fUGHu<HWH GHG؃HHGHGHHWHBHGXEuH]H}HwH]ff.Gt1fHHWH GHG؃HHGHGHHWHBHG1Hff.G(HHW0HtHHH H HEH]{H5hH81DHf.G(HHot1HWЃD$ uHOH WHW؃HHWHWH HOHQHGD$ 1H=vhqUHGHHWHHGHGHHWHBHGH}HtHEH/t"HtHH]HGP0SHH{HtHCH/t 1[HGP01[DG(uuHHW0Ht@HHiH HEHyH5FgH811HDG(HHot'H|HHH|H@Gu҃HWH GHG؃HHGHGHHWHBHGPH=f fATUHSG\t'uE1H9HAH9tD@HE1H9ADt7~tRHHFHFHFHF ffoȶfoжHٶHF ^Dfofo HHF NDfo%&fo-nHHF ff.ft_t2tDooNHF )dH}) fDo&)%%on)-)HF H.Doo^HF )ԵH)ֵDSHH mH0dH%(HD$(HtHT$H؎HL$H9ĵHT$ HD$t H1HpH$H1HHH9CHD$H?HD$HH\$HD$ t&HHpH$^HH9t&HHpH$/HrHD$(dH+%(uH0[AUATUHdH%(H$1Ht ?H H-OL%OHwH5@1HD$`HD$hHyH BHD$pHHHD$xHH$H$Ht$8Ht$Ht$`HL$@HT$HHD$PHL$HT$HD$ HD$0H$qHt$0bHULHE1H$dH+%(HĐD]A\A]H5NAąu (fDH5FHL-NjH;Ld$`1HD$`HD$hH?LHD$pH`HD$xHtH$LzLmLHLHfH5NHL%N LHAff.foHHGDo)HGHDHtH1HH9rHHH=% 1ff.fHHxHH=%@1ff.fH#AVAUATUHH HHA ; r6HHIHt_HL]A\A]A^fH@HH HH)HwHtA$ID4I9r-H KvH9vHIL]A\A]A^I־1aIHmLHHHLHL]A\A]A^DHHH]A\A]A^f1@HHxH==%?1ff.fHtH1HH9rHHH=%1ff.fHHxHH=ʯ%ܯ@1ff.fHH=%ff.HtKUHH?Ht H/uHGP0H}Ht H/uHGP0H}CH]:f.ff.@ATUHHL`LqIHtLHH IHL]A\ff.fATUHHL`LIHtLHHIHL]A\ff.fHHxH=%1ff.fHtH1HH9rHHH=V%`1ff.fHHxHH=*%<@1ff.fH @HtH fHH9t?t1fSHHdH%(HD$1H<$H賸AEuH{蘸HT$dH+%(uH[ff.fG(u.HG@u$W\tHGhHHHVH5.DH8HHfG(uHG@uHG@Ht3HfDHHUH5CH8>1HH9[H@HH(@HA@oA8oIHNoQXV oYh^0oaxHFf@t DAXELAA8A8AAXAXAAAAAAt @UAAAt tdHF8uH~( F$HF0HNHHA0HAHF(A8A8O@ EHVH5MH8@ /HVH5MH8f@HgVH5MH8pYHGVH58MH8P9fDHSH5AH8*HVH5MH81HUH5MH8ff.HG0LcHJL IHHx=H9}8HG8HW@J HHtJHxHHf.HHUH5MH8191HfHHGH59EHPHSH81HHff.HHGH5HPHZSH81ȴ1HÐSH胪HtyHtWHS t'H8HHHtH/t1[HGP01HRHRH5LH81Y[HRH5zDH8\[HWH5CH8?[AWAVAUATUSHH(dH%(HD$1HD$G(HG@H1LL$HLD$H H*DEHD$H@WC( EHt$DC\HIcHHKh1HH9~gH<uHQH5RNE1H8GDHPH5>E1H8'HD$dH+%(H(L[]A\A]A^A_ÐHOHFHHnH@At HHADEH{Hs8DIHH|$aIHWx @@gL@ @f@K@B#M@H@IAxAfDIT$`<@uBHDPA/wIǔM^HA?LID$HHHIH@Ax?@2L`@IcL>f.NH5/@fHNH5JH8?Imu IELP0I,$uID$LP0@E1p!L@!@?uAxA?fF< H`HcH>AtIcH/fDAzƒ߀BHEQ@@H?H5HE6@@H?H5zHE@@H>H5HE@@H>H5>HE@@H>H5>HE@@H>H5@HE@@H>H5bHE@@H>H5/HEy@@He>H5HE^@@H/>H5)>HEC@@H5>H5/>HE(@@H=H5HE @@H=H5=HE@@H=H57bHE@@H=H5=HE@HKH5 FE1H8?f.AxAH5FHjKHcMl$hHbHCJfHHMHH5DH8111Hf.????@H?H?HH?鈖H?H?VfD駨fZfDH?f.Hc?H?H?HH?XUG(HG@HW`H<@t=}u7G\uGLG8HH81L"HHt"H]QHKH5:CH81訧1]@HKH5jCH81]fDBHjrH EH53H8z1]fDHEH5BH8ZG(uHG@u HcXHHDH52H81Hff.@G(uHWBu ǃ HHUDH5f2H81Hff.@G(uHWBu ǃ qHHDH52H8v1Hff.@G(uHWBu ǃ!HHCH51H8&1Hff.@AUATIUSH?<2w!HVHHHcH>HILH5AH81蝥H[]A\A]DHHGHHmII'A$H81UIvDsH;L1H5\>@f.KH;L1H5>UDD$]D$Hf;HD#H{A$H4$HT$HI?I~uE1L%}PfLHtHHxIHE?<2wWIcL>fH?HHtNIMJHD$IL0H$L98HL[]A\A]A^A_@H!CHH57:H81͞ImIELE1P0H?fDH?xsHc?H?ffZ蓞NfDf1H?f.H?xH?H?舖H??@???ؐE1AWIAVIAUATMUHSH8LL$HH:HIHI>~1MD$HsMLDIOIV1HMtI$HxHEHLL$LD$(HL$ HT$Ht$hHt$HT$HHL$ LD$(t/I}I/HHI9H8L[]A\A]A^A_fImu IELP0E1f.H8LLL[M]A\A]A^A_ATG(HG@u~HW`I<@t`tfHEH5&HH&H81@HELH5&HHx&H81AVAUE1UHSHHGXLp uLo㏃thHtHHt$Ht$HtWtTHZ%H5%H8{H1[]A]A^fDLAHHH1[]A]A^髜HN1HuMLAHfLFHHHL*HDHNHufHvLAHHEH5$HHC%H81豆Q@HEH5$HH%H81艆)@HEH5$HH$H81aff.AUATIUHHHtHyHHL1]A\A]KHHH9~II)IM9"HH[]A\A]A^A_D8f9f.9@HH5r H8ژHH[]A\A]A^A_fDH$LD$8L$0LL$(L\$ LT$HT$fHT$LT$HHD$L\$ LL$(L$0LD$8tH$HLD$0L$(LL$ L\$LT$LT$L\$HLL$ L$(HLD$0:H|$LD$8L$0LL$(L\$ LT$HD$赗H|$LT$L\$ LL$(H7L$0LD$8HVHt$Ht$HHuJHWD$8LD$0L$(LL$ L\$LT$Ht$R0D$8LD$0L$(LL$ L\$LT$Ht$H.HVD$0HLD$(L$ LL$L\$LT$R0LT$L\$LL$L$ LD$(D$0f1f.EfD1.EHt$HHD$HHHFHP0}fAWAVAUIATIUHSLHhH$HL$LD$L$HD$ H$$HD$(H$HD$0I H9HL$ 1HMIT$H81tYI,$u ID$LP0E1HLA\A]H=tp@AUATUHGHH@@Ht]A\A]HdIHt8HH%\I,$It L]A\A]fID$LP0L]A\A]@E1AWAVIAUIH=ATUHIH5H zI,$HH )IHHLH@H@H@voIHH1H1;NIHH57HyI$HL諔ID$HHMt$LbID$Ht~HmImID$LP0HE1]LA\A]A^A_@CLLAbHmuHEHP0LLA2Hmt;Imu IELP0MtI/uIGLP0]LA\A]A^A_HEHP0@AWAVAUATUSHxdH%(HD$h1B"HHC(HC@HH9FteLt$LM]HcS\A;U$襅E1E1HM9uWLeMF(uHFLn8Lt$@tH9E1E1҃*"H6LΚLƚHHD$hdH+%(HxH[]A\A]A^A_@1艚1肚H fH92@~0H{hIu0Lc1DHL9tH H; HuH{`I<@uGLG@HH5JH8貄E1E1xIH9E1E1uA8A9Af9fA.¸EE1E1A.1L$HHnL$E1E1trH+HCHP0u HwfATrHt(H(HAt DA\H@P0DA\E1DA\f.UHH`NHtHH]_S1]@ATUSHoHHt|LeH5qI9tlL$fu`A$H5GIDHUHHH@tSHCHH=H1#LHmItL[]A\ÐHC[]A\H80CHEHP0L[]A\fDHH5RH8肂Hmu HEHP0E1ff.ATH5EIUHTHtqHH@ uQLilIHtHHH5E1H81NHmu HEHP0HL]A\HWIE1HL]A\fATE1UHHt0H5D!THHt)H!EHmAu HEHP0HD]A\fHH8Qtx}HD]A\ADUHH LHt HH]H]AUIATUHHVLgHt$HHH|$UI$Ht@Ht$LHH|$AH/t HD]A\A]HGP0HD]A\A]@I|$HH|$t#ƊHHLHAT$HDH/tbMH PHRHEI|$@u I$tJIT$IH5sH|AH81LHD]A\A]HGP0H|$fIT$IH5H)HRH5AH81LAfDAUATUHHHGH@HHtH]A\A]HHT$WIHtCHT$HHpI,$AtHD]A\A]@ID$LP0HD]A\A]AH:AUIATIUSHHKLLHB`HHttH3HLoHEuTHHEu HEHP0H H;tVC0tH H5H8z~H[]A\A]f.HHEt&H[]A\A]fDH1[]A\A]HEHP01ff.AUIATIU,|Ht:HLLHHmAt D]A\A]HEHP0D]A\A]ADATIUHHHHHtHLHH]A\-oH]A\ATIHUH=Ht^LHH58AHpfAąu1HmtHD]A\HEHP0HD]A\Hmu HEHP0Aff.@AUATAUSHHYH@HxH}HLk(At AH{HMH-vLeMt'.LWHtH{(HpmL6IHH{8HHs@HtL,3Hs0HtL35I\$HL[]A\A]HLMAH1ATHH81{ZYHE1[L]A\A]fDID$ HHtvHS81c1AfDHEM I,$uID$LP0@HLH5E1H81GHL[]A\A]@I,$uAIHuHH5H8q2UHnH?HqHkLHgH;%H]rvfAVAUATIUH)\I1MtEL5X3LL;HHtUHUHML9$t&HyLHaH]A\A]A^fDH]A\A]A^1iyHHt1HLL3hxHmuHEHP0tffSHH dH%(HD$1HHt$H|$Y-[Ht@HH5^2:Ht,HPtHp HHH9t>HHyDH$Ht$H|$UOHD$dH+%(uH [1HN4_AWH [AVAUATUHSH(HGH;HL$t H@HD$HQ'tEAH(L[]A\A]A^A_Ht$H(H=1[]A\A]A^A_71E1wIHtOH]E1HHCDIHtH#VImttH+t^MtI.tCMtI,$tHuUf.ID$LP0Hmu3IFLP0@HCHP0@IELP0H+ufDLOIHY@Lh&IHt8I@t IxI(uI@LP0L0&IHuH=-IHLH,I/IuHD$IGLP0LD$E1MHt$L1LD$H=`a6LD$II(I@LP0LHLD$LLD$HH7L1H=U6LD$HItaHL6^I/LD$t+I(uIPD$LR0D$E1IWD$LR0D$LD$I(BATIUHSHZ@tIHH[]A\.nH=lfATIUHH@tHLH1]A\mH=flfDAWAVAUATUSHhdH%(HD$X1HDNILfA89HN fDH9'HAI9uAVLiL0HHH L9uIHT @8u,HH9uHD$XdH+%(Hh[]A\A]A^A_HfH$H=L1HH;d'ANH;1HI'AnA$HIH M9uH;HH"1'H;A1H'&IF8nHI9uH H=+fnM$.H;H1M&LIT$8HH9uH H=nAL$ID$ It$HHH H9uH;1HM8&HnH3 b:H;JwH;BL:H<$jH;1H9E1L= %G,H;DL1DD$%DL$AtH H=6mH3 I9Iu H;1HMnAU%L=WEEH;DL1DD$/%DL$AtH H=0lH3 I99AuH H=/zlHMnH$=H LH=E1L-;lM9r -@AzMH;L1HAl$I9wH3 8&H1ɾ1HH;6$H;1H  $HH$I9vLH)HfMH;L1H#I9wt@H\$R@W@LHߺMn>iD$_Y^H$WH H=Il$kwfDAUIATIUSHH?HHEHMHE ]@HHH H9uHIT$ I9I}HuAU HHPHpLD HHH9uLhHKL%HH,E HAH@HHH9uI9wHL[]A\A]fDLI|H)HL[]A\A]DHE1[L]A\A]HH1[]A\A]gff.AUIATIUH9tLLH]A\A]H=sefDHtoUHSHH?sSHCHsHHH H9uLCH uH}HE(HL[]LǾIfDATIUHH8tHLH]A\TH=8eIIHHfHHHtL!HHLH8t'LN M9wL fDL9tHH8uHHHÐHGAVL5c-AUIATIUHS1fIU HHIE(H9|@H8HL9tHuHH9}[1]A\A]A^HAԅt[]A\A]A^ff.fHG0HLW HW(1MIIr,A4?fHJHHHH1H5M[IH1I9sHWI)Au HUoH1HGH)ƒt H-l H1HHiMrH1HHH HH1H1Hi H6H=<ɸ8#HEHG0DHHHHt1DATIUHSHHHt HՅu-H{Ht LՅuH{ 1Ht[LH]A\@[]A\ff.AUIHATIUHLSHxdH%(HD$h1RELJ5"H 2#uH=2L IIDfL$AHH)Ѓ0I D$ McAB,DAHIcȅx HtH/H> tfDHG`0H== HtH= ff.@HHHHH9}]H HxmH9}H1Hx(H9|qHH?H)HHH1HyH9~HBHH)HHHDIHI?L)HH HyHyHH?H H)HAHHHII?HIHHEf.HTfDHDfDAVIIɾAUATIUH͉SHHdH%(H$1L$IL$L1HL$HcLLHH$dH+%(uH[]A\A]A^HLAWA@HAVIAUATUSHdH%(H$1H$1@H$H|$(HH$@H|$0H@HH=$: |$<H1: W1E1LRE1AILP0MLM9I0HHtHD`tHIHLHI9vf9t0q$DH1D<AH)HHI9wLM9vDH\$HHH Ll$PDd$H&HźHHHHmAAA!HMMILL׺LL$L$kHL$LL$I/u IGLP019>HHLH4LhL`HX Hh(H([]A\A]A^A_DI/u2IGLL$LP0LL$MtfI)u IALP0H $HH$HHu HAHP0f1H([]A\A]A^A_HEHP0fHhIHtMMDLL$LT$<=H$HH$Ht$H|$M5IHHHHD$15LL$HLHLL$HD$LT$LL$HHHLT$HD$-L\$LL$HLT$HI+uICLT$LLL$P0LT$LL$I*uIBLL$LP0LL$I/uIGLL$LP0LL$I)u IALP0H $HH$HHHAHP0@I/^IGLP0OHmH$9HUHR0H$(I/tQI+u(f.ICLT$LLL$P0LT$LL$I*IBLL$LP0LL$IGL\$LLT$LL$P0L\$LL$LT$I+uI/FI1MtVLHI,$uDIT$HD$LR0HD$-fDH;Yt?HPH\H5H811HT$(dH+%(H8]A\A]A^ÐHu(HL$HT$HD$HD$LD$ HD$ tH} Ht$ IHH|$ HtHD$ H/uHGP0Ht$HIHH|$HtHD$H/(Ht$HIHt8H|$HtHD$H/H}LLLHH|$Ht H/H|$Ht H/H|$ HtH/tsMtImtWMtI.ttƃuHHtHHvI|$(uHuI|$2up(IHQI|$(HR2ImuIUD$ LR0D$ SHu I|$ 2;fU7SHH 1mHtGHSHsHt!HK HSH=1Hs[NfDH=d1[9f;Ht1[fHOHW1HwLG H=F^ff.ATIHUSH dH%(HD$1ff.H(AVAUATUSHH&HH{(H{ HH{%IHH{ %IHtMH=ޞHLHIHt0LcH=DP [L]HLH=A\1A]A^HmtYI.u IFLP0MtI,$u ID$LP0[1]A\A]A^HmuHEHP0[1]A\A]A^@HEHP0@AUATUSHHHw H(HH{HHHmIt`MtjHsHK LH=ѝHHIHtTLcH=8DHLH=[H]L1A\A]sHEHP0MuH1[]A\A]@H{H/uHGP0I,$u ID$LP0H{ H/uHGP0f.SHHHt*Hx4HS(H9HOHCH?H[f{I1Mu1ff.fATIH5UHպH(dH%(HD$1HH8uPHH=t=1HL$HLLD$H5$OtHT$Ht1Ht$H<$#1HT$dH+%(u(H(]A\fDHɗH5H8:-1AUATUSHHHHHH{IHH{ IHHI9t>MHL9r-L9L1H)HIHHH=4IHH@ H@H@HC(ID$(H "HHI|$(H HmIu HEHP0MtgHs LImHHtHH{H|HmIMl$Mt$H{ ID$ Ht1z!ID$Hu I,$tE1HL[]A\A]ID$LP0Hi'H_HuHLHH)H9MyuL9~pHE1L)HHHwIHHLL)[H]H<A\A]@IELP0HEHP0Ml$M1ff.AUATUSHHHFIHt]H{4HHH{ IHLLHIHHL[]A\A]f{Ht1&H=IHt=HKHS 1HHHP HC(ID$(HHHID$HuI,$t`HE1[L]A\A]H3H1gDHH8tJID$LP0AWHAVAUATUSHH(H|$H II!HP(MIII<$IH:@IE H9HKDHLH!IIIII<$I9\$uM<$M9HI9GEILLH$U(I/uIWD$LR0D$4Ht$HV(H;$:M9<$0H~ IE H9DI$H$ L;$$+ID$IHu I<$H9uM<$M9H̕I9Gt^ILLHT$'I/uIWD$LR0D$xxHt$HV(H;T$}M9<$uwu]H~ bfI9FuLL_u=HD$HP(DI9FLL3uHD$HP(E1H(L[]A\A]A^A_@HD$Hx II!MIII<$fATSHHHtTH8HtdH -H@AHHkH/tHD[A\fDHGP0HD[A\fDAHD[A\E1HD[A\fATIUHHH4H9Ft6H^HHt?HLHt/H8H]A\HVHtHLHuH]A\fAWAVAUIATIUHSH8HHw HW(H|$ I!LHHH;5Hl$E1PMuHLDID$ H9EHl$H|$KHLH!HIHHH;HCH9uL;M9BHI9GILLHT$$I/uIWD$LR0D$LHD$ HP(H@ HH;T$u L9;?fIHI!LHHH;HD$ H@HL$ HHHQHAHT$HHQHRL+HkH9H=QHH|$ H4HMH8[]A\A]A^A_'HHD$H;FHL;M9 HڑI9GILLHT$#I/uIWD$,LR0D$,HD$ HP(H@ HH;T$L9;H;\$HCHHQH9[MuHLD̐I9E^LL+uGHD$ HP(AfI9ELLuHD$ HP(fImu IELP01H8[]A\A]A^A_fDHL$ HAHPMHQ1M.InH8[]A\A]A^A_IEHPIUHuIUD$LR0D$HGATIUHHH0H9Ft:HZHHtBHLFu3H;HH]A\HVHtHLtH1]A\DAVAUATIUSH_HYL(A1I$AtL Il$(H~4L5H}HtoL9tjHH/uHGP0HHuIl$(ID$@H9tHID$L@AIAt~$[]A\A]A^Hf[L]A\A]A^[]A\A]A^AVAUATUHH9t-HEH=HpH1]A\A]A^fDH}H-IHH,I,$IMtnIELHP9ImIu IELP0Mt@HEH;ōHpLH=1jII.uIFLP0DE1HE'HL]A\A]A^fDHE1]LA\A]A^fDID$LP0MFf&HEH=|HpLH=s1I`ATUSH1H@dH%(HD$81z(HooKHoS HC)$)L$)T$ HtHH!HHI$umHI$HWIHuH|$HH/Hm@E1HD$8dH+%(H@L[]A\DHI$u ID$LP0Hmu HEHP0H|$HtH/uHGP0뙐ID$LP0QHGP0H|$fH=uHH= 0H1 IPHEHP0APXH=ՠHzf.SHH=َ,Ht[HSHHHHXHPHP(HPH@ HHHu-HHPHMH2HpHvHpHHHJ[H=K/ff.HATIUHSHHHHMthI$HtoHEHtvHPHHHL` HHhHHXHuwHHPHH2HpHvHpHHHJ[]A\L%I$HuH-HEHuH~fH=HNH=J.ff.fAUATIUHt{LHIHtW1HH HmIt(I,$t L]A\A]ID$LP0L]A\A]@HEHP0I,$uDHmu HEHP0E1]A\LA]UH=HHHH dH%(HD$1H$HD$HD$[tgHHHD$H5/P1LL$LD$ ZYt2Ht$H|$Ht+H$ HT$dH+%(u'H ]@1@H|$H1HD$n ff.AVAUATUHSH9HFH;-IH;݄HIH<LIHLdHHLHIHL Imu IELP0MtI.[L%I$[L]A\A]A^HEI9E~ HLI1L%)fIU HHIE(H9|@H0HHtL9u'HH9}L%LJI$[L]A\A]A^fDHPH$Ht8H8tL%I$WImu IELP0I.u IFLP0E1[]LA\A]A^Imu IELP0I.uIFLP0hf.HGL%~I$I.t)H"IFLP0IFLP0HH~u)HHt HuHHHHɃH5BH8R1Hff.AWAVAUATIUSHH8HnL-qdH%(HD$(1L9tH5H9tHI9It$HHSHH @HC HH9Hk(M\$(ID$ H1L-Hy AfDM\$(HHLH0L9tHtHPHxHI;l$ ~1HT$(dH+%(H8[]A\A]A^A_LH%-H;-@LIHu?HHHHHH|$H/LiHD$HHHyH9EuHUHuLk IL$L9tZHKHKHXHL%fDIHtL9tHIKLH許IHufI|$H9uHx*I3HtHHuIsHuHHIH9}H{HKf.HD$LHxrHSH{ HH RH?H9L|$Lt$ Ll$Hl$f.MLLHL"HT$Ht$HbtfDfDHsHH uHS_@I,$t=lHfI,$t2H|$H/uHGP0DHGP0ID$LP0ID$LP0HCHH4U8H~~MATIUHS1HH9]~HtLt[1]A\fDHQH[]A\HAHff.ATUH1H0HtpH@IH@@H@H@ID$(ID$0ID$8IDŽ$HtHLwuHL]A\I,$tE1HL]A\ID$LP0ff.ATIUHSHdH%(HD$1H$HtaH}H9Hw11IL u%1HT$dH+%(FH[]A\fDH4$HfHw11ILtH }H9uH$Ht1H9Xt7HH~HtHx{H(u HPHR0HHtRHVfHH=aQ4Hs11IL!q@1H0HtGHP@H@H@H@ HP(H@0H@8HǀHVWHFT@HH=2}ff.fHH={]ff.fATIUHHdH%(HD$1H$HtHH=I3toHE1ILHp1tOH}u8H4$HE01HtHHT$dH+%(u$H]A\DHfDT@ATUHSHHHVHM(dH%(H$HGHWHVHFHGHWHV HFHG HW HU@HF Hw(HG@HO(H9tuH9U(HDHO(Hu(H9G(tqH9tlL%szH{LHHHS0HE0H$dH+%('HĐ[]A\fDH;U(HO(HU(DoE@o{@opoh o`0oX@)<$oPPoH`)t$o@pDC@DoJ)l$ DHDoR )d$0DP DoZ0)\$@DX0Dob@)T$PD`@DojP)L$`DhPDor`)D$pDp`DozpDxp}@rj b0Z@RPJ`BpfH}LHC0HU0HG(HU(VfDATL%3|UHSHL9t-HxH9t LuHH[]A\NfD[LH]A\9fUHSHHH;=xt.H{H9t H"t.HHH[]DHEHH[]fH=9xHH[]ff.AUATIUHSHHL-A{L9tlHwH9t LuTHLiIHtPH}~*1HtI9t Lu"HH9]HL[]A\A]fLImtHE1[L]A\A]IELE1P0HL[]A\A]DAWAVAUIATUHSHLgHmzI9L=wM9HL)MuI9tM9tHLM9tHL}LHMIHL9tLHHL[]A\A]A^A_LvI9tM9tHLuQLfI9t L5PvM9u H~HLuLLuL%+wI$xLLI,$u ID$LP0E1EfDLL}AUATUHSHHLfH5xI9tL-uM9t L8t$HHu5HHH[]A\A]LLuHZvH@H1[]A\A]AWAVAUATIUSHHI9H-KxIH9HtH9tHH1H0H$HMH $MwHA@HAHAHA HA(HA0HA8HǁI9tHytI9tHL ID$I9G~ LMI1L5D@IW HHIG(H9|@H(HHtL9u'HH9}H$H[]A\A]A^A_HLhHLL>HtIH8tH<$LHtH4$HH$HHu1HFHP0H$H4$HHD$HHt H$`H<$HGP0H$HHLLIHu nfDH8Hm+LkHHHIHtHHL@HuI/u IGLP0H4$HH$HHu HFHP0Hm'HEHP0H$}H-uH9t1HurH9t HuHHL[]A\A]A^A_HH<$LHOI/u IGLP0%HH<$HH$HHyHGP0mHEHP0fAUATIUSHHFHtnHH~QI1$fDHHEu HEHP0HI;]}&ItLLBIHEMuHHEtTHL[]A\A]fDHH-}tH9tH1qH9tLnL;-oIL5nM9tHqI9tHL"I$1H\@IL$ HHIT$(H9|fH2HHtH9u_HH9}HHD$I,$uID$LP0HsHHT$(dH+%(H8[]A\A]A^A_f.HRHHD$Ht$HT$ex"t HD$MHT$Ht$HStI,$1L|$Lt$ Ll$H\$f.H.taMLLHL66Ht$HT$HHHt$uHT$H|Ht$H.uHFHP0ID$LP01LL^H}H9tL9tdHbtXHL3IHD$M/1H|$H/HGP01nfHrHYLff.AUATIUHSHHL-aoL9ttHlH9t Lu\LHIHt\HHHHt^H(tHL[]A\A]f.H@P0HL[]A\A]LL-IHuHE1[L]A\A]@I,$uID$LP0ff.AWAVAUL-nATIULwHM9tL=6kM9tLLtjMt$M9tL=kM9tLLtLH]A\A]A^A_fLLuHkH]A\A]A^A_@LL]uAUATUHSHHLfL-jM9tH5mI9t LtHEI9EIE0HtHU0Ht H9HHL[]A\A]HEI9E~|HHL[]A\A]AHL0HHHHmu HEHP0xu@H[@]A\A]fDHEI9EeH_HH[]A\A]@H5Y\LHR]HH[]A\A]1ff.H#HcHx H钱f1HfAVAUL-i_ATIUHSL9ntAHHHt@HLeÅx/H`aH[]A\A]A^HVHu@H}H5^H9t toHx\H8Xt\H=H[HIHt@L9htJLHHtXLLI.u IFLP0M@1[]A\A]A^DHPHu@H1-I.uIFLP01DAVIAUATUH9HHHſ1nIHH5KLIHIv1LL1ImItGHmtQI,$tHL]A\A]A^f.ID$LP0HL]A\A]A^fDIELP0HmuHEHP0I,$t@Hmu HEHP0HE1]LA\A]A^DkL%T_I$3f.ATH5\USHoHH9tL%^YL9t Ht HC[]A\@LHuH=wHf.UH5D\HHH9t t H]H=wu]ff.AVAUATIUHHLoH5[I9tL5XM9t L7tHLH]A\A]A^DLL u־ H=wZ]A\A]A^ff.ATIUHHHH5T[H9t tBH[H9Et)HHHt5HHL]A\fDHUHu˾ H=pvSH]A\fDAUATIUHLoH5ZI9t L)t5HZH9EthH HHtGHL]A\A]H59WI9t LtI<$t H=u]A\A]DHUHtHL]A\A]fDAWAVAUIATIUHSHHLwH5YI9tL=VM9tLNHEHs H=HHHS(H9|!H HHtH9u'HH9~HHE1H[]A\A]A^A_DHEHBIMI$H[]A\A]A^A_@LLg6 H=tDUH5YHHH9t stH]FfDD H=\t?1]ff.ATIUHHHH5XH9t tHLH]A\N H=tH]A\fDHGtHGHH=sHHfATIHUHH=mH(dH%(HD$1H$HD$HD$VLfHHLHD$H5DP1LL$LD$ ZYH|$iHD$HH|$QHD$IHH<$H.IHBH L$$f1LD$LH5`tH|$HD$Hu0E1HD$dH+%(mH(L]A\fD1HD$IH0H$IHHT$Ht$LH豟IHuH|$H/uHGP0H|$H/uHGP0H<$H/WHGP0NHSH5 rH8I,$u ID$LP0H$H|$H/t=H|$H/HGP0fH$IH0@HGP0H|$H/u HGP0fDH|$H/=@H|$H/%gHHGt;HxH9w~HDHfDHUH5H8z1HH=pO1ff.HHOtCH?u=HxhH9w~bHDH8HHtH/t 1HDHGP0HtH*u HBHP0H=pHtH*u HBHP0H4TH5EpH8fDH=iH=iH=iAVIAUIATL%YVUHSHH L9tpH谠HEHHH{H9L9LsH{L9t9LZ[]A\A]A^@H{HL9u1H{IEL9uHH}[HHI]A\A]I1A^fDHHEL9fHDHxHOH5gH83QfDAVIAUMATILUHLSHLgx#H LHLIE1[]A\A]A^fATH5íUHSHGH辯HVH~)I1@H|Ht H/uHGP0HI9u[H]A\ܥff.ATH5SUHSHRHHHHlIHt9HH5!HID$H~HI|$1˙L[]A\ATSHHLHu'L%0MI$HL[A\H~2HH9HH=QIHu=fDHL$MIT$HHT,I$HtkHI|$1ID$IT$HHHHID$HSHIL$HIIL$HHHPHL[A\@L%*I$H[A\4@H= QHIHMQH=kE1LH=Hff.AUATUSHHHH{(HHHx8uBHRHHE HE(HIHmu HEHP0HL[]A\A]DHCHHE bIHt:H{(HII,$At/AtAt3HC H{fDIx@ID$LP0HIQHEIY@HmQH9GtHhLHAVAUATUHSHH9FtHDLHH[]A\A]A^HAH9gIH QIHHCDLLIEHCIE HC IE(HEIFHEIF HE IF(IEIE IE(IFIF IF(ImuIUHD$LR0HD$I."IVHD$LR0HD$ fHpMHuHMfImu IELP01AVH SAUATUHHHSHbH dH%(HD$1LL$LD$HD$HD$踳PH|$H5hHD$H1HT$HtHR HH5اHXH藿HH5٧IHyHH5[IéH[IM9L9L9HeIHdHHt$HFH1$fDHVHHITHH9HuHTfDHqIHUH5gH81ԪH|$H/u HGP0fE1HD$dH+%(#H L[]A\A]A^fL9*HIHUILH5'hH81e1fDI9~SHL)L4I.HJ40Ht HI(IDHI9tH|$HuH4MfH|$H/4HGP0(H|$H/HUHHUILH5fH81販H.HHUILH5 gH81苩AAWAVIAUATUSH8H<$L|$ dH%(H$(HGHhHD$H良dHLH9йL|$HFHHI~(HXH$E1HD$H$J|*IHNH6HH*LHIIDHH9D$HLLJ3H=HZHH踮, H,fUH]I/u IGLP0H$IL9`HL$KHHL(M-HEHILH5eH81H$(dH+%(umH8L[]A\A]A^A_fD...HkI/u IGLP0)H|$fE;IfDI/u IGLP0E1H1AWH5AVAUATUHSHHGH脥HH5H]IHEH^HHIHIIHH1HTHITHH9uI9~tHL)L4I@HI(I9tSHEHTLHJ40yI,$tdI/u IGLP0E1HL[]A\A]A^A_Hu1LLH=\I,$It&I/uIGLP0@ID$LP0ID$LP0I/uDI,$yID$LP0iD1fAWIAVAUIATUSHHVHHXL5I1E1I HH9HkIHHHHuHvI}LH5hH3333333HIEH)HԤH)΁IHFHIIIEIGIHCL)H9?HHN H5{#HHH H9u$Hx(H9}(uH H9 fDHIHtHs H=.#HJ H9L9H9t;INLCLH5TH-H81H1[]A\A]A^A_Lz L; L9ZtA$tHHI$HHt H`L9} lM;|$ aH[]A\A]A^A_Hr(I9t$(0H I9$ HI9$I$H3@It$0H9t H;r0LIMHLf.HNLGH5aS@HH9\HH3@EHU0H9t H;P02HHHtsHM;$IfM;$ kIbHHL$HL$HAMDAAHDItH|H[]A\A]A^A_鸜1L9|$fDtVH)HH[]A\A]A^A_1L9|$1L9|$1L9|$1L9|$1L9|$H(H.)HH(HDATIHHUSH0dH%(HD$(1L;%4)HD$LD$ H HD$ H(FH|$ H HHtqH]LHA$0HtZH~1HLHHLHH9uHmuHUHD$HR0HD$HT$(dH+%(ueH0[]A\D1@1LD$H HrENtH|$Ht [f[H=K4@AVAUATUSHHH dH%(HD$HFHP`HtOHtEL%&I4$腢HH(HCH.H9.HDH@H;a)Ld$Hl$HLH[L,$LsHLLLʧHHH|$It I9HIHt`HT$H $LDHtH<HPDHHHHHJI9u%HPH#H5KH811HT$dH+%(ukH []A\A]A^DkI1MuHCHI<$H51HY&H9C.HHfD1iRfHHW1H=HH18ATUHSHdH%(H$1HHIHt HӅusH`Ht LӅu^HXHt LӅuIHPHt LӅu4H1Ht&H$dH+%(uZHLH[]A\H$dH+%(u4H[]A\LGIH JLѶL@AVAUATUSH/HHUH;$IpLeIMHEHVI9HEHHHt&HUHHEHEHHUHBHELM9~0H|HtHDH/uHGP0HI9uLHTsHHHM9I]HCHSHHHHHCH2&HHKHIHKHHHP1[]A\A]A^fD1HtHmt"LʱHIE[]A\A]A^HR0M)J|1JjLHEHIEHEuHR0SH==藲^IEH vD1=H=mAUATHLgMt3LoH=諤HLH=*HLA\1A]ܡ@H=p|HH=HA\1A]鳡SHH谔Ht*HSHtHx2HRH9HOHCH#H[I1MuH{t1fDSHGtnHH=|!HtOHPH@HHHHHXHHuKHHPH$H2HpHvHpHHHJ[f&H=T<1[H=蟳ff.@UHt!HHfHtHpHH)]H"H]HH,ff.AUATUSH(dH%(HD$HtzHhIHt^HD$Ld$Hl$@1LHH|t,HD$HxH?~MH;=&"H|$tIH%IHD$dH+%(uH([]A\A]ÐH!HD$]ff.ff!ATUSH[D`HH{HtHCH/uHGP0HCHH9uH= !%D[]A\ff.fS覠H=t4HDH{0HtHC0H/uHGP0H8H;u~[ff.HAuHHt E1DAUATUSHHM!J >!tULPMeM~$1I|HI9uHH AHHD[]A\A]HH-' LH;HEHCH+Ht H/uHGP0HL9uH=c趂HA[D]A\A]HE1[D]A\A]ÐATUSHHWdH%(HD$1HHHFHHHxIHHtH;$H@LeAHH@H/t(HD$dH+%(HD[]A\HGP0H zH5N:H3AH81{fH yH5.:HHH5BH H5BAH8wZAOfATHdH%(HD$1u}Lg.L̈HtGL)LH9H$IHt H腸L$$HD$dH+%(ujHLA\H=YxIHtI$DHH5RxH$IHuHH5yH81iz"fATIu HHu:I$H5nxHt1HPHHt9L1HA\DHA\ݔDH!HA\f.HA\fATSHHWt0IHtXHHHL[H5RA\黤H H xH58H81iyH[A\@HH wH57H819yATSHHWt0IHtXHHHL[H5RA\HiH -wH5o7H81xH[A\@H9H vH5O7H81xH;=Ut"H-HHvHtH]ÐH-ٺHavHtHHH8誂1]fDATUSHHt@HInŅHLH5z%AątND[]A\fDHH-RHZcAąuCH}HE1[D]A\DH}tHD[]A\ÐHyH8z{HquHHtHH8躁f.AGDATSHt`u`HGHHtPIHtlH;utDHmI,$u ID$LP0xCt1L%H9tL%4I$HL[A\@L%E1ff.AUATUSH1H(dH%(HD$1訲HtqHhIHtlHD$Ld$Hl$1LHH stDHD$HpH>~]H;56Ht$tL觚yImu IELP0E1HD$dH+%(u)H(L[]A\A]f.HHD$oZf.HHtKHHff.IHHL`1tuHHHDHqHHIHHL z1tuHHHDH!HHAU1ATIUmHHPHuTH(uHR01LIHIt$H=>31pIImu IELP0L]A\A]f1LIHtnH5ǶHut+It$H=21xpIHmuHEHP0fLHH=2NpIf >fDHmu HEHP0E1]LA\A]AU1ATIUSHH_HAHHPHu`H(uHR01HIHHsLH=1oIImu IELP0HL[]A\A]1HIHtvH5Htt3HsLH=1>oIHmuHEHP0LLH=1H oIfDˡ*fDHmu HEHP0HE1[L]A\A]ff.ATUHSHHHFtHFHHHH11$vHH E1Hxt,HCHH98HH9(Hmt D[]A\HEHP0D[]A\fDHtHErHE[fHB OH跂HtHH58AH8XxHH5*9AH84MHH58AH83A(SH~H_u0Ht HB u1[f.HHtHH98tHH9(tHH5z8H8芣[AVAUATUHHH8HII1HH詅IHH;-VtDI|$H't ID$H(HtLLLЅxKHL]A\A]A^@IFtI~uMtIE tLHuI,$u ID$LP0HE1]LA\A]A^@H HWH57E1H81Qoiff.ATLfUHSLg(HLg II@LmIMLL1WIHtHEH}(u|IhI@t?I@IPHHHuqHI@HHIHHIIHHHHP[L]A\DcIMk[]A\cfDIXIhI@t{H=PAWHIAVAUATIUSHLwH4$ILt$H9t"MHIH9unMnMtIFHX LM~1fHH(I9t{uHCI<HtH$LЅtH[]A\A]A^A_Lt$HD$I H9 uDHD$tH|$H$LЅu1HtH4$HLLH[]A\A]A^A_LbHtH8HtH$LЅfHD$ufAVAUIATL%USLwILL9t5DHHL9uH{tLHfH I9 uHtA[LH]A\A]A^LbHtH8HtHH/uHGP0Hu[1]A\A]A^ff.@AWAVAUATUHSHL%M,$H_@Ht jxHxHt HH}~H[]A\A]A^A_DHC0L%L9uHHC0L9tLeHI,$uID$LH@0H[]A\A]A^A_@{`H H ABM4$A1 L%IAAL9c0ufDMM9g0tHHEHuHHHZHHEHH8H}HH}H7HHHp:iHEHuD$HHEHEH0HuHFHEHtIHxHt}HEH}IIIHHEH LLEM@LEI8HHxHH}IHEHuHHEHEH0HuHFHED$t?Ht5Iu+HELII?HtDӔI?HuHS0IL9tuff.UHHobHHt#H@HHtHUH]DHH]ff.@ATIUHHHHHu *DHH t tZHHHuHGHMtIT$ tcI$H8L HtH/tD1H]A\H5aHHtKHGHHt;HLH]A\HGP0HRH59HBH81PHEH56HPHH5H8袃cf.UHHHHu +fDHH t tHHHuH]"mfH5`HHtDHGHUHt2HHtH]HRHeH5nH81O1]HEHPff.AWAVAUATUSHHFH_YLIIMLH(HHHH@LMHt2HLHAHmIHL[]A\A]A^A_fDLL轉IHtIGILHmtoMMt1LLAI/IuIGLP0;0끐LLIRIHueDHEHP0QHEHP0LLIHtEHH@LZfHPHH5.E1H81N@HqIVLE1H5H81MAWAVAUIATIUSHHdH%(H$1H;=HD$hHT$pHL QH "HD$hH5 LP1LD$xFOAZA[zHt$hH^HHaH9t,H8HNH9tLLHI9fDH|$hHGHD$ HHpHD$HHH|$`PIHH5HJH D$0IHH $D$7HuH{(D$0MIGYL!tIMIGHD$(HHD$H@(HD$8HD$01Hl$@1Ll$HE1Ll$(̓Lt$D$ofLHWH5LMtH<$AAH5b Lsat l$HI9$ MtIFuLt$HPH5HH81`KE1I.u IFLP0H|$hHt H/yMtI/u IGLP0Mt?I,$u8ID$LE1P0+H|$hHtH/uHGP0fE1H$dH+%(E HĸL[]A\A]A^A_ÐHnHtH[HHutID$L`I$f.HHH5 E1H8m}kH5YHD$ HD$hHH 0L1aYIfHqH5k Lt$E1H8|pDD$71ۉ$HH0IHIH|$pHt$XHLHHǀH@HD$HHD$%@HHH%HFI$I$ID$PI$ID$`I$ID$hI$ID$pI$0I$DID$IHH AH81>=HL$HH$HHHAHP0fDAWAVAUIATUSH1HH=/yH8ImIH!H.JHHPAEHEHI$@0I$@HI$PHIEID$HHHHoI$I$PI]IT$PI$IT$`I$IT$hI$IT$pI$0I$HI$IcEID$ IcE ID$(L5fDCHPPЃvHcHkIVI,8uI|$H趞HHt )HHEHALxLNXH$LHHHxI$xI|$0Ll(xhI$ Im.HHHH)HH!rHHt)I$HH5}eHm6t I,$tE1HL[]A\A]A^A_@ID$LP0IUH5u71IHHtfD1uHZHBHt0uHrBHuHfH)H5H8mI,$FZf.HPH]H5nH819I,$$@HH5bH8lDHID$0[HEHP0ZI$XUH_HH8H81Nl-w1nDATUHHHt$Ht$IHFu;HLH=AąH|$H/uHGP0HD]A\@H;toH[HD$Ht=H|$vHt$F uHiH5H8zkH|$H/uHGP0AHt$HsgAj~ y H@HrtHt$HHWH5AH817.ff.fUHH HWdH%(HD$HGHt$HHGHGHHWHBHHGH|$THPHtHgH$Ht$H|$cJHVHHt H/uHHt H/OHPHt H/)HXHt H/H`Ht H/HhHt H/HdH@Ht H/HPHtH/tcHHHtH/tAHXHt`LHEH@HD$dH+%(H ]fHGP0HGP0HGP0o@HGP0=@HGP0@HGP0@HGP0@HGP0@HGP0oYff.@AWAVAUIATIH5wULSH;HHHL4HmLH5'u:IHH>JIH"t6HLGHHt_HL]HmAt;ExEHI9uI$HP1I$HH[]A\A]A^A_HEHP0EyI,$H[]A\A]A^A_f.HEHP0cfDcH1[]A\A]A^A_f.IT$D$ LR0D$ H[]A\A]A^A_fDID$LP0j;cfDAUE1ATIUtHt$LHH)u HImIHmpI.FH+I,$H(L[]A\A]A^A_IELP0fHR0KDH+FH5nLG4I/Iu IGLP0M#MI^H{E^HHID$HHEH~1DITHHHTH9uI.bIFLP0S1H5/mL1`IHt$H%CI/Iu IGLP0MH+u HCHP0Imu IELP0Hmu HEHP0I.u IFLP0E11IHuH5kL\iHH1HIHmIu HEHP0MtIFhIHeofDIGLP0kID$LP0HCHP0I,$fIFLP0H+f.HEHP0I.f.IELP0Hm[fHCHP0/IHIHfIGLP0HH8/D[tID$Hx(L!IHt H8Ht3=H~M6fL5MD$IH5jIL$L$HIHH9H@wIIGH=IHIHIGLP0DLP@HHKID$HZHH_ID$1HH"HEHPH=H5uE1H81*HHHIBH+HH ID$H tHHtHHp I9KIGHH9I/u IGLP0I.u IFLP0ID$HPHH5H81)Imt!HmOHEHE1P0@IELP0I.u IFLP0H+HCHP0I.u IFLP0ImIELE1P0mfDMHPH5OHH81>)I.u IFLP0H+HCHE1P0iHD$H,IG1H$HH|$LHLD$HD$gLD$LL$I(uIPD$LLL$R0D$LL$I)uIQD$LR0D$CH$I;GHH9$IGLLILLD$b+LD$HTI(u I@LP0HH8+HWL$}+H_HHtH$1H$H5f1YH<$IH/uHGP0MtNHI9IG1HH5WH8ZI/uIGLP0I.fIFLP0WHhH5AH817'I/u IGLP0HL$HH$HHuHAHP0IHH9HHIPH5rHcH81&dH|$"8H^HL$HH$HHUH|$HGP0DH,LH5BH81x&HRHH5HT$1L5I.Hu IFLP0IHoI/u IGLP0HL$HH$HH HAHP0@HPH5II/aKHPHAH5 H81%I.IFLP0ff.@AUIHH5eATUSHdH%(HD$1HT$D$#'H=8L%cLL*HHI}L*IHH(H8tRL9Hmt$LQWIHD$dH+%(HL[]A\A]@H@LP0L9tgH!L%bLH"H$8H-E1St$LmIhfD1HV@HmIJHEHP0;fHEHP0 HmuGfUHHH5HdH%(HD$1HT$D$x%A1Ett$H" VHT$dH+%(uH]KG@UHHH5~H dH%(HD$1HT$%tlHD$Hx@HHHtPHt$HAHmu>HUHD$HR0HD$(fDHEH5MHPHBH81"1HT$dH+%(uH ]SFHH@HIHAЅxHHH1HÐUHGHHWHHGHGHHWHBHGHHtH/tOH}HtH/t0H} HtH/tHEH]H@HGP0HGP0HGP0ATIUHSHHHt HՅu-H{Ht LՅuH{ 1Ht[LH]A\@[]A\ff.W u?Hy,HtHt HtPHmtHtHũ@HLHRHDfD@H)H/HDf.ATHHtBIH5X1HFJHHtE11HLLH5@H9uIL$H9MtH+trEuHt H9t2L5>HLLH[H5փ]1A\A]A^A_fDL('u,H}AL5=dHCHP0@L=LLLstL5=LLHL1uHH9H+HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`Ht H H9JtyHt HH9PtHHHH[]A\A]A^A_fHyL5<E11HLLH5-H9uIL$H9MtH+tjEuHtH9Ht-L5<HLLH[H5]1A\A]A^A_QL%u,HAL5C<lHCHP0@L=LLLtL5 <LLHL1HH9H+ HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`Ht H H9J tyHt HH9P tHHHH[]A\A]A^A_fHL5E;E11HLLH5]H9uIL$H9MtH+tjEuHtH9H t-L5:HLLH[H51]1A\A]A^A_L$u,H]AL5:lHCHP0@L=LLLStL5{:LLHL1UHH9H+ HCHP0ff.AWAVAUATIUHSHHwH;]HF`t7HtH H9H(HHH[]A\A]A^A_Ml$I9tVIU`HtMH H9J(u@Ht H9H(L59HHLL[H5u~]1A\A]A^A_eDHt H4H9P(tFHHHeHIL1[H/9H5=~]A\A]A^A_HL5 9E11LLHH5}H9HMI9L$H+u HCHP0E%cf.L!uH=AL58L=w}LHLItL5q8HLLL1KHH9eH+7HCHP0(fAWAVAUATIUHSHHwLmHF`L9tIU`Ht H H9JXtyHt HH9PXtHxHHH[]A\A]A^A_fHYL57E11HLLH5m{H9uIL$H9MtH+tjEuHtH9HXt-L5i7HLLH[H5A{]1A\A]A^A_1Lx u,HͨAL5#7lHCHP0@L=zLLLtL56LLHL1HnH9H+ HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`Ht H H9J`tyHt HH9P`tHHHH[]A\A]A^A_fHɧL5%6E11HLLH5yH9uIL$H9MtH+tjEuHtH9H`t-L55HLLH[H5qy]1A\A]A^A_Lu,H=AL55lHCHP0@L=!yLLL3tL5[5LLHL15HަH9H+ HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`Ht H H9JhtyHt HH9PhtHXHHH[]A\A]A^A_fH9L54E11HLLH5whH9uIL$H9MtH+tjEuHtH9Hht-L5I4HLLH[H5w]1A\A]A^A_LXu,HAL54lHCHP0@L=QwLLLtL53LLHL1HNH9H+ HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`Ht H H9JptyHt HH9PptHȤHHH[]A\A]A^A_fHL53E11HLLH5uH9uIL$H9MtH+tjEuHtH9Hpt-L52HLLH[H5u]1A\A]A^A_Lu,HAL5s2lHCHP0@L=uLLLtL5;2LLHL1HH9H+ HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`Ht H H9JxtyHt HH9PxtH8HHH[]A\A]A^A_fHL5u1E11HLLH5-tHH9uIL$H9MtH+tjEuHtH9Hxt-L5)1HLLH[H5t]1A\A]A^A_L8u,HAL50lHCHP0@L=sLLLtL50LLHL1H.H9H+ HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`HtH H9t~HtHH9t!HHHH[]A\A]A^A_@HL5/E11HLLH5pH9uIL$H9MtH+trEuHt H9t2L5/HLLH[H5p]1A\A]A^A_VfDLu,HAL5C/dHCHP0@L=1pLLLtL5 /LLHL1HH9H+HCHP0ff.AWAVAUATIUHSHHwLmHF`L9tIU`HtH H9t~HtHH9t!HHHH[]A\A]A^A_@HL5=.E11HLLH5nH9uIL$H9MtH+trEuHt H9t2L5-HLLH[H5n]1A\A]A^A_fDLu,HMAL5-dHCHP0@L=QnLLLCtL5k-LLHL1EHH9H+HCHP0ff.HHѡH9FuCHNHt)HH5H811HDHvHfDHѝH52H821Hff.HHQH9FuCHNHt)H"H5H811HDHvHfDHQH5H8r21Hff.HHѠH9FuKHNHt)HH5H811HDLFHHLHɜH5*H811HHHQH9Fu;HNHt"H#1H5"H811HÐHf.HYH5H8z11HATHUSH9Fu{HNHt)HH5H81[1]A\DHHHLfHHAtG1LHӅx9HH[]A\fHH5 H80[1]A\[1]A\fHH!H9FuCHNHt"H1H5H81X1HÐHwHHfDH!H5H8B01Hff.HH H9NuKHNHt)HrH5nH811HDHvHH1fHH5H8/1HHH !H9NuKHNHt)HH5H81T1HDHvHHfDHH5zH8:/1HHH H9NuKHNHt)HrH5nH811HDHvHHfDHH5H8.1HHH !H9NuKHNHt)HH5H81T1HDHvHHfDHH5zH8:.1HHH H9NuKHNHt)HrH5nH811HDHvHHfDHH5H8-1HHH !H9NuKHNHt)HH5H81T1HDHvHHfDHH5zH8:-1HHH H9Nu[HNHt)HrH5nH811HDHHv1Ѕx9HHHfHH5H8,1H1HfAVAUATIUHLhMLHHL1AjIHtHHL48I,$At:HmtHD]A\A]A^@HEHP0HD]A\A]A^ID$LP0Hmu@H9HhIHODAUH$H9FuFHNHt%H1H5H81[1]HHt-H]!@H!H5H8B+1]fDHuH] DHH H9Nu[HNHt)HbH5^H811HDHHv1Ѓt8HњHHHyH5H8*1HHt1fSHH9FuFHNHt%Hƕ1H5H81+1[҉Ãt/Hc[fDHH5RH8*1[fDcHuHc[DSHdH9Fu^HNHt$H5H51H811[Hv҉ÃuHt 1[DHc[gHIH5H8j)UHHSH5YHӺH(dH%(HD$H7LL$LD$HD$1t-HT$Ht$HHT$dH+%(uH([]1wUHHSH5HӺH(dH%(HD$HLL$LD$HD$1qt-HT$H|$HHT$dH+%(uH([]1UHHSH59HӺH(dH%(HD$1LL$LD$tCHT$Ht$HӃt%HHHT$dH+%(uH([]Ht1Mff.fUHHSH5HӺH(dH%(HD$1LL$LD$MtQH}HŵH7t:HT$Ht$HӅx'H8HHT$dH+%(uH([]D1ff.@UHHSH5HӺH8dH%(HD$(1LL$LD$ HD$HD$ H H9t3HT$H9t>HtBHHHT$(dH+%(uXH8[]DHD$ HT$1H9uHD$1HuHH5HD$H:&HD$띐1UHHSH5HӺH(dH%(HD$1LL$LD$t9HT$Ht$HӅx&HHHT$dH+%(uH([]@1UHHSH5iHӺH(dH%(HD$1LD$"tVH?H|$H0ZHHt!HHT$dH+%(u(H([]DHD$FHt$Ht@1off.@ATUHHHHĔH0 IHtHxHL]A\Hu-HEH@hHtHHtHHxIHL]A\IATUSHNHu.HvHH_IHtNLHH[]A\HyH9Fu;HTH5PH81[1]A\#Ht@HH5H8#[1]A\ff.UHHSH5HӺH8dH%(HD$(1LL$LD$ =taHt$ H|HHt3HT$HӃtDH-HHT$(dH+%(u7H8[]fHD$VHt$Ht@1@;Ht1mff.fUSHH/H9FuyHNHt/HH5H81bH1[]fHvHHHHtH1HӃt\HUHH[]f.HH5ZH8"H1[]ÐHD$fHt$Ht1KHt1fAT11H5bUHuHt`HHΑHH0 HmItMxHL]A\ÐHEHP0HuHH5HH8d!@IUHďH9FuFHNHt%H1H5H811]HHt-H] @HH5"H8 1]fD3HuH] DATH3H9Fu=HNHt$HE11H5H81gLA\ÐIHt&LA\H9E1H5H8W LA\ÐHuHH8GDAVAUATUSHHHGHHFHLvMLnIEHLIH hALEfH8H9udHHuHLxHH LHL8HmuHUHD$HR0HD$H[]A\A]A^DH;8tL@HH5uIMHSH811HYHSH5H81H1[]A\A]A^DHHHWH5HH81H1[]A\A]A^fHSHH5IMH8I1IJ1!1H=AVIAUIH5,ATIUHHtWHLLLHHmItHL]A\A]A^f.HEHP0HL]A\A]A^HE1]LA\A]A^ff.AUATIUHHt$H5$^H;HHtz1Ht$HHmIt,MLI,$At!HD]A\A]@HEHP0@ID$LP0HD]A\A][Hu&Ht$LdHA]A\DA]@AH(u H@HP0ID$H5<AHPHH81qKff.AUH5ZATIUȌH111HH~IHID$H;FHPHH5AH81I,$u ID$LP0Hmu HEHP0D]A\A]f;HuOH5\L'HHtO111HIHtL1A@Hmu HEHP0A]A\DA]HuApff.HW HGHt'HRH5WHtHpH= 1mDH54HtHpH=1Jf.ATHcHSUHRL$HHt$L&HtIH1Ht$HHmItHL]A\DHEHP0HL]A\HtL%…I$HL]A\fHIt$H8f.AUATUHSHHLfA$tHHHLtI$HL[]A\A]@H5$HIIHtyLhAtH9CtHHuI,$t?HH5E1H8~HL[]A\A]IHH[L]A\A]LAU0c몐ATH5CSIUH膉HtAH11HHmItHL]A\DHEHP0HL]A\;Ht&ID$LH=^zHpH1]A\HH5RH8ATH5sRUHوHtt MII@IHHc@H=wH=#IvpH-HAHH9PI8H9I8I8H$A9_fH$HtgEubHEHL[]A\A]A^A_@IFxH9]H,{H$WIH9DHQwH$4LmHL[]A\A]A^A_f.H=vxHopH-HLfH89XtH[]A\A]A^A_H=vIv`H-fLH=kIvPH-\fH=w(HH=.HoPH-f.Ho`H-MtKI9tFIGI9A4HqLHL$H$HL$HtH;A0tAMoHA0H$ff.fUSHHH6HtHHH4H3HuH1[]AWAVIAUIATUSHHG HD$Ht>HFuMHD$LXMt Mg1@IDI9FtEHL9|HLL[]A\A]A^A_H~ uH5"Lt@If.HI9~IDLHHHtHH@IHHt.IvHL$1HH9HDHHmIu HEHP0I/t8HL[]A\A]A^A_fDI/"IGLP0IGLP0ff.AWAVAUATUHHSHH=H(dH%(HD$1HD$HD$_1HL$LD$HHvH5Ƿm5HT$HHHl$H;-wHt"HEHHHD$H|$HLCHH{MtI(ttH{HD$HCHtH/tLH{ Hk HtH/t)1HT$dH+%(QH([]A\A]A^A_@HGP0HGP0I@LP0@HD$1UH1wHLpMMf MAD$IxHD$H ID$HHLhM1L=f@HI9ID$HH|LtIT$PIcD$HjHD(.IDH H uH9HHxH|$HhHG4HPHtH5H81@HT$HHHtH5H8yfOfDIL$XHtFID$PHpH~81 @HH9t'<uIcL$HD.IDH@HD$HH tH5jH8HsH5bH8HsH5H8MHsH5H8xHsH5H8yZHjsH5H8[<H=Ht=SHHC0Ht*@ t$H{8H8Hu[H=ff.AUATUHSHHhdH%(HD$X1QuXIH=]H VLt*H@H8H8tH9h0uHH8HH8uHH$LHPH9wfDH8H9v9PtHHFHHuH4$HtKMfDHIIuHuHhLHIHT$XdH+%(uHh[]A\A]1eDH~AVAUATIUHS1HH;]}]HDHPtLhMtLIHt@HLtlImuIELHP0H;]|[]A\A]A^;fff.@UG Hƒ,H}(Ht5y(ƒ @HM0H9{E ƒ` `t/H}8Ht&tCHM0@HUHHHDH9t@U u LEHMuHEH]H@LEHL9uLDHHH=a uaE (DHMHH9K^fDHMHf.``:qH=QH=EH=V9fATIUSΛHtQHLHA1HH5HmItL[]A\fDHEHP0L[]A\fDE1[]LA\ff.fAWHH5ŰAVAUATE1USHXdH%(HD$H1HL$ HT$(HD$ HD$LD$苿HD$Hl$ HD$@H\$(HD$A IHuHCH HSH;U%K E AAAAAA VL{H aHM0HH@HDH $HD$@1HAFA0IHBHT$8HLT I/uIW$LR0$LLHHHt$0HFHJHT$8LHs0L{H@LE HEHH$@<A>HgH5zH8J#DHgH5H8*DH|$HL$A  HQ0HiH@HEHD$@HD$Hx1m|~HD$0HHHkLH|$0AH/uHGP0E^HD$@HL$HHD$@H;AVu|H|$0H/HGP0D|EcHD$HhH+HyfH52H8HveH5߰H8}ff.fAUATIUSHB @ HJ0HH@HDIM9IL1II:AD=vJ=LIBHHH H9@HHCI9ttHLɸt߃uAD]=wLɸH9~DHjH5RH8E1HL[]A\A]fLjH.IHJH kCDA\=A@UH1APH1APH1APH1APH1 IpAPH9APH9LFHFID$I9Iă/CD%A\=v.A@uH9Ip APH9APA@xIpwfCDe1IH~E1vff.fAWIIAVAUIATUSHB @ HJ0HH@HDIM9HL1III}A4H vFLٸcv9Lv)L'vHwJfH9|kHHCI9HÃuA4@A4\{fDLbH @BHIHHBHH H9}@HgH5RE1H8HL[]A\A]A^A_DLLL5IHu9d@t;GLLH1HIIEI9tIŃuG,ʐGl1LLIHiE1aAVIAUATUSHHO Lk(ω@ @K#HA0HkHHHHL9Iv`HLƀ`t-H{8H9t$HtHt$HC8Ht$HC0HIHYHLp@ L9I|$(Ht5y IT$HH9t!)AD$ ID$(@Z twIL$0IT$H@HEBHL[]A\A]A^Hk0A0HHAHu\IT$H1fBrHL[]A\A]A^ÉƉ@ @IT$0IT$(tP0IL$0IT$H@HEfDHkHAHH IL$0IT$H@HEB2HL[]A\A]A^ID$@f.IT$HIT$(@tc<t<f.It$0IT$H@HE(IT$HofDIT$HnfDIT$HIT$(Mt$@@۴E1<HĴ(ff.@ATUSHHuL%[ Mt,I$L[]A\HH9HH=`pIHtHX@H,H@HHH@H@@ H@8H@0HID$(HtND(L[]A\[]A\H ]H5¨E1H8'/fI,$u ID$LP0詳E1AUATUSHHHu"HZ H:HH[]A\A]0A1AHHH)HHHH9H{HH?HH7_HHPEBHXHHHʠH@P ASH@8H@0AZHX@HH(DgHE1AwE1HA1DH[]A\A]AHXAH@D` D0H@(H[]A\A]þHE11AofDA1A0tHE11A/fDDHH@(H@@H@8H@0fDH@@H@(HQZH5jH8r11fY[H&ZH5H8G1jSHWHHu/H(X H9tH/HHH[HuW Hw0HOH@HEwH O HHH9tHH(HPHR0H[fDHWR0HrW TDHOHf11HPW H>H[Ð|dHH[fDH[ff.ATDUH-N JDSHtH[]A\f.@ HtH t"Hp0HPH@HEֈJDf.HPHf.AUATUHHtVILIHt@ uI|$HLHL]A\A]DIT$0I|$H@HEfD?]A\A] ff.AUATUHHIHH<7HHHH @H:x(H9H¨uH9w HH9vGHH#tLIHt!@ tRIU0I}H@HELHL]A\A]H9tKHL-9U Mt>IEL]A\A]fDI}Hf.?]A\A]l11MHT IHufAWAVAUATUSHHHHHL46HAMIJ\%H9/fDND5I9v0'AI9wDLD$LD$HI@ ƒ fA;IU0IMH@HEHHH9sKf.0HH@rp@rp@rp@rH9rIIIJlJ I9vf.EHHAI9w_f.t8tcAH9f Bf Bf BuHIHuNE1HL[]A\A]A^A_fAL-R MIEfAE uI}HLH(fDIU0I}H@HEH$}v\H[]A\A]A^A_AIMHb11H@R IHTH[]A\A]A^A_DAWAVAUATUSHHHHHL<HAMIJ\%H9+f.Nt=I9v/# AI9wDDD$ DD$ HIY@ ƒ AIU0IMH@HEHHH9sDf0HH@rp@rp@rp@rH9rIIILJ HHI9DEHHAI9wt8tcAH9 B B B uHf.IHt^AE u]I}HLH)@AL-)P M@IEHL[]A\A]A^A_fE1IU0I}H@HEH,} H[]A\A]A^A_.fDAIMHZIU0IMH@HEHHH9sIfD0HHfrpfrpfrpfrH9rIIID$HH HHI9@EHHfAI9wIMHv117HN IHH[]A\A]A^A_DHHxkHHփt.tIt4HEPH5^H8f1HHH?HHOH5H8ATIUSHO(H@H4H,1H9H1H9vH9wvWAD$ IL$HI|$ID$8ID$0AD$ t Il4H@EAL$ 1[]A\DH|?ID$HHHEL$ HEA tID$0It$HA@HEMD$(HL)LHII9sdHDHHfDZDXfDZDXfDZDXfDZH9wHHHAH4HLH9v@HHfVH9wEtID$0I|$HA@HEID$@1fGLID$AD$ ID$8ID$0AD$ #ID$(ID$@1f.HID$HHHAD$ HIL$(II)IN L9seHHf.8HH@zx@zx@zx@zI9wIII@H4HHH9v@HHFH9wAT$ ID$HIT$@AD$ IT$@IT$AL$ DAD$ ID$HID$8I|$(IT$0ID$(ID$@HqLH5H81[]A\fDIL$0ID$H@HEXf.IT$0It$H@HEIl40 11AL$ YUHH x^HG@Ht5HuHG(8viHAHEH]@H/t*HJ Ht^HH]@H]fDHGP0HI Hu+HmuHUHD$HR0HD$fD11HI HulfDHM1HQHUHOAUATUHHSHHHHuDEAL,J\-H9H1H9vH9wNIHtKP <<<RHL[]A\A]@L%H MI$HL[]A\A]HD[]A\A]{HIH5E1H81=HL[]A\A] ID$0I|$H@HELH\fD yID$0I|$H@HEIJt-H9sRHHf.HHfJHfJHfJHfJH9wIIIEHHHHtH@tHx H@H=HþzH=َtfHx'Ht11ifHHHHBH5~H861Hff.@UHCH11H]HE1AW AVAUATIUSHHHbHHHI|$I$PlHuM$MguH= H-uAfIT$hH-HHtH;tHu0LHtEH8H}H}tHcEH=wH=IT$pH-f.HH;EHLIHHu0HLINHImIFH8LP0H}cfI$8t L-I$LnH|I$HH3M$Hugo(HLHHH3HL+HmAu HEHP0EHs H H LuHCt@tۉƒ u1LHIHHgI.HhIFLP0YH=vIT$`H-H=v`IT$PH-Hu0H%DL DI$AHD[]A\A]A^A_@IHL譸HDI$HH3M$HuuDHs(H(HtcL3HuHLHHWH3HL艅HEHHEuHEH(HP0H3HuDI$HH3M$HuuDHs(H(HtcLHuHL HHH3HLHEcHHEuHEH(HP0H3HuD1LDnI$HI$@H;->&I$8{I|$ u HE ID$ I|$(u HE(ID$(I$uHI$I$ 6Hv;HH0ӴI$@M$XM~ItLHI9I\HCtID$`LHHK`HIU`H8HpIH(HWH.HxHxL5Hx Hx(Hx0LHx8Hx@HxHHxP`HxX%Hx`HxhHxptHxx9H H Hg H! H H HO H H H} H7 H H He H H H HM H ID$PHt:HSPHt1IMPH8HpHHWH.HxID$hHtwHShHtnIMhH8HpIHQHHHx\HxL.Hx(Hx8Hx@uHxHID$pHt:HSpHt1IMpH8HpHHRH)HxI$Ht5HHt)IH8HpHHH|I|$0I|$@I|$HXI|$XI$I$I$I$I$I$RI$I$ u(H HtMt I; tI$ fDI$(I$0"I$HSI$HttI$@H1@I$@eH@HUMt I;@CHI$@I9;fDI$u01fDITHJt JHI9؁DHDuI$@H@H;A=3H-I$H\HoI|$x"I$Ht?I|$PdI|$`mI|$hvI|$pI$I$P1LmM:fDHI9t+H|HGtL HI9uI$E1πI$fD@I$@H1<H9@He6UH0HMt I;0I$HI$0HHHMt I;HI$H~H(HOMt I;(=I$(0HHMt I;I$HHMt I;I$HH_Mt I;MI$@HH Mt I;I$I|$xI$LH|$ϔH|$L# L < HL諔L HHI$HCxID$xfDHHZMt I;HI$;fHHMt I;I$HCXHMt I;EXID$Xf.I$HCHID$HHI$|@I$]HC@ID$@HI$@@HC0H#Mt I;E0ID$0 f.D@HRHHYHtHIhH;QHFHPH=H H Hx]HRHPHPGDHHrHRHeHP\HE HT Hx0HRH#HPDHr@H~HtHyhH;w@kHp@bHr8HCHtHyhH;w80Hp8'Hr(HHtHyhH;w(Hp(H}HHx# HxHrHHpf.HHHtHR`H;HfDHHHtHz`H;HfDHH]HtHz`H;GH;fDHHHtHz`H;HfDHHHtHz`H;HfDHHHtHz`H;uHifDHHEHtHz`H;/H#fDHHHtHz`H;HfDHHHtHz`H;HfDHHsHtHz`H;]HQfDHH-HtHz`H;H fDHHHtHz`H;HfDHHHtHz`H;HfDHH[HtHz`H;EH9fDHHHtHz`H;HfDHHHtHz`H;HfDHHHtHz`H;sHgfDHHCHtHz`H;-H!fDHHHtHz`H;HfDHqxHHtHz`H;wxHpxHqpHHtHz`H;wplHppcHqhHDHtHz`H;wh1Hph(Hq`H HtHz`H;w`Hp`HqXHHtHz`H;wXHpXHqPHHtHz`H;wPHpPwHqHHXHtHz`H;wHEHpH<Hq@HHtHz`H;w@ Hp@Hq8HHtHz`H;w8Hp8Hq0HHtHz`H;w0Hp0Hq(HlHtHz`H;w(YHp(PHq H1HtHz`H;w Hp HH'HxHxHqHHpf.H-Q,H9HEHH I$ @BI$3I$$@I$HI$HI$H:HwH8HtHrHgHp^H HQHHIH9HH8HHqHHp1LH=(HHI$HL詶HEKHHE:HEHP0+H HuHHrHJHeHH\H HHHHJHHH@IHI${HP\1荺HI$P?HRHwH;Qh@H:HOH;9FH8>HRHH;Q@HrHH;qHpH:HH;9H8HQHI;RHPHQHI;RHPHHI;HHrHI;r@HJHI;JHHHJHlI;JbHHYH HDI; ;H3HRHH;Q@HrHH;qHpH:HH;9H8HqHI;rM$MI|$LHHt )HLEL |IH~I$HH{IEaHIEIELP0HHE4HEHP0%HUIT$HH1D"HHMt I;I$H5)HI$HPPI|$`IT$PHP`I|$hIT$`HPhI|$pIT$hI$HPpIT$pxHI$dH%HJH5rIT$H81A$H-I$HHI$H)HޱH)ID$xH8I$8qH@HrHHxHp~HqH_HpVHIDIFLP05I$IbI$H)H fDHa#H5zqH8ҸH5(H辛tI$H5'H蚛tI$H5V&Hvt.I$H*#H5pH81)DH5&H5tPI$aH#IT$H55qH81HIEIELP0H5#HҚtI$H5^#H讚I$ DHGHtfUSHHHoH蛊11HH\HCHtH{HK HD HHCH[]ff.AVIAUL-ATILUHHdH%(HD$1H$PHHH@HHHIT$LHHLH$IH1HH譠HmItKH<$H/t1fHD$dH+%(HL]A\A]A^DHGP0HEHP0H<$H/ufHE_fDHmt E1@HEHP0LE1ŀHH&H8^YfHHu H9WH9aG A@AAA HGHAHHHHHAAOHHE1HAu@ H:x,H9H¨uH9wHH9HH#tADÐHGHoG A@u݃A<t<ADEfH)AHHHH9sCf Hf Hf HɅtmAhAH9rH9RWAH9wfHoH)AHHHH9s: H H H tcAH9rfDH9#tItqAH9w~Hf.HHf.ADfDADfDADfDAAXH9tHA(ApLTHtiL $E1.tWHAtEAtH9tEt I9t8_HL9t,H#HHE1 Pu1DH4x@IHATHHLAttI1E1I9s?8xKHH9vBuH9wHH9vLH#tH9uL)IHL LA\L)IHDI9s+IHHHH9vHLtHH)HH9wHHWH9tyL)ILA\ff.fATUSHGG HHk@u<t<EHIHtxC Hը u,AD$ HsH t6IL$0I|$H@HEL[]A\Ð@AD$ HK0HsHHE uI|$HӐtC UDE1[]LA\DE H=lgE1fwv wHH]H5kH8ί1HAUAATUHSH RDe H]AAE9(AAt(HAH5Z`H8bE1HL[]A\A]ÐHH=H<ƸIHE ƒ AHU0HH@HEHtHH|H9HL@HHJHJHJHJH9wHHHCHlHLH98H)1fL HH9uf.HH>t7H[]A\A]oE1f.H<跷IHtE HU0HH@HEH|HHtH9HLHHfJHfJHfJHfJH9wHHHHlI4H97H)1HfDTfFHH9uHL[]A\A]H)H5>gH8JE1fHmH2HmHHHtHH|H9HL@HHJHJHJHJH9wHHHCHlHLH9XUHHPH9w8HmHHU0HH@HEIDLLLAWIAVAUIATIUSHG  AAA ImHMmLHML9AAKD-HtHLDHL9HL8HHzxzxzxzI9wHAHHHlHLH9vUHHPH9wtCHL[]A\A]A^A_fDIU0ImH@HED˲AE HH= HzHIALJ|-HLD L9HL@0HHrprprprI9wHHHQHlHLH1H)H9L HH9ufJHL蝴HH5eH81vt M~A$E1kfDL`LPHtHx ]DH H=`胧1Hff.11ff.HHGH;%tCtH9fHPHH5eH81u1HD xH|$訰H|$tHHHf1ff.HHt3Ht H$v@H|$`H|$HHvDHuH Ht'HHfD H=_O111详HH HuƐAVIAUIATIUHS~ I^IL9t L9L9LHNIMHEAF L9LM@u<t<EȋU9Hu HEH)L9} MuOHu H}L9}!I)ܹ LYHtHHt$D6pHHzHt$HaHIb~qD1H1yHD$HtjHPHHH=H<薩IHHD$HLHPyHHHD$0I9tL]8kHD$(HD$Ht@ILt$(Ll$ fHII)tLLLLUHuE1H|$Ht3Ht$ pIHt!Ht$ H`LIA}Mu@H=^_IHthID$AUHMPHo H(IH5 YH81aHIEHIEZYHu IELP0HtHHmE1@E1H H5'E1H8wfLl$0HLxHHL_IgL_IHD$0I9KLo[>f._I'HEHP0EH|$t(HE1H86I)M`D[_E1Nff.RfATIUHHpHLHH]A\ ATUSHG?Lg(HHMt8HtC `<`tHC@HEL[]A\HCf.G <9HHGH9H<蝆HC(HHC Hs``tHs@HL2t]IԀQ H{0HKH@HEHL99HHxI9wHI@ uLHKHHL9sh9HHxI9w裂E1]fDH{0HKH@HEHKHTHnH=ZLff.ATUSHdH%(HD$1Ht~HHHiHHt_L$$HtPL9;H$IHH败HD$dH+%(uMHL[]A\I\$fII뽾 H=ERI٘肋fAWAVAUATUSHdH%(HD$1HIHHLhIHtxH$LhHLH=N<LIHtuLHhHHH$I9EL,$LL覤H$HtlHtHHD$dH+%(uaHL[]A\A]A^A_fL<fD[E1fDE1 H=QE1贗fLE1WNff.AWAVAAUIHATIUSHXdH%(HD$H1JtKHLH5WE1H81%fHD$HdH+%(&HXL[]A\A]A^A_Ht$LvaHHrH"QH9D$tCDHt$H\IHWHVL|LIUb1H1账HHH1IHt#HSHx H腦HH9HUDHUH|$HHt$ hIHtHt$ HwYLH vHtoLD$H# HLUHu!H5RH8MH1YIHEHHEZYHu HEHP0MtLI,$u ID$LP0E1;1ffH|$DE18wH|$HD$D$,IL|$()fH|$0LD$(I^6HIAu1HHL$CTMDHD$nfHE1TH>H5PH8诖ef.H=VWH@HD$蚄8#vH|$HD$HSI,$ID$LP0LH)H)fWHE1`S覆fDRfUHdH%(HD$1HHdHHHMH;$ulHHH=uOH<"IHt:H$LHHIHD$dH+%(ueHL]VE1fDHH5UOH8*E1D H=dLE1f.E1薅fD15cDHGSt5H(Ht$C `<`t HC@[HC[f.+R4{H[ff.ATHdH%(HD$1HbIHtH~LH;$u HD$dH+%(u+HLA\fDHH5=NE1H8訄AWIAVAUATMULSHHXH$HL$L$L$HD$H$L$HD$dH%(HD$H1H>HD$@IuM.MHUM$MLLD$ `T(IImVIELP0I6H@H;11VIH(H@'1HL$@LD$8LHH5RRI>lIHH@MFIF H]I4$II$LHEI.HHT$8HpI9uLD$@Ax H)HEIpI$HH)IH)HL\$IS(HtIs(H9}H)HHD$HHp(HD$@4A@ ǃ@utEH\$HK 9SH9t@@u<t<EH|$H)9zLD$@H|$L.HD$8IHD$L IEHP1IUHIUD$LR0D$Ht$ LGHt$L.CM.Mf.5fHAH5PH8ʐImuIELP0HT$HdH+%(WHX[]A\A]A^A_ÐHT$ cLT$ HHLL$HL)LLʁIHIFLD$(LHL$ Ht$P0HT$8LD$(HL$ Ht$HLHT$8HH5PH81\HAH5OH81\ H[II)HH\$H)I9DLHL$ Ht$6HT$8LD$@HL$ Ht$DH9H|$Hw(@AWHAVL47AUIATUSHHLD$dH%(H$1H|$HHD$ HD$H|$0Lt$(H9|$H~@u<\I9D$L%H fI9dD\$EL%HHl$PHEvIuIIIH|$d~Ht$xvHD$hH+D$pH9~ HH|$0HD$P@ @u<t<ELH)HHD$pDT$HE1ۋL$`LL$XMFHEDE(AIƒElHHAL9lD*LPAA9uElIfE(AlIƒtTElHHAL9D*LPA9uElIffElAZDfElAI9 H|$H+|$HL+t$HH GH|$@Ht$ HLLt$@HUHD$@PHD$0PHD$XPHD$hPLL$XLD$xyH0Lt$(3EtHT$0A(LT$p=v{A0H|$0H+|$HH LLwb@AHT$0HLT$pAH+|$HH ;LLw(fEtHT$0HLT$p@H|$0ʐLl$ HLd$>MtImu IELP0MtI,$u ID$LP01H$dH+%(HĘ[]A\A]A^A_H HHD$0I9MD$L%YEI)D9l$dsPDHs'D$`LT$pHT$Xt@tOF,HD$0ILT$pHxH|$0HD$hL)H~D$`HT$XuF,LT$pffF,R뮺H s3HHHD$0I9tD$IHHD$0I9u=H|$tHD$L(H HH{HHD$0I9tD$IL%D\H|$t HD$H+|$HH8H|$ HtH/t&H|$HtH/t HE HGP0HGP011чHjH^L%Cyff.E1y@AWHAVAUATUHSH7HHT$(HLD$0dH %(H$1H|$xHD$PHD$HH|$`H\$H\$XH)H@ƅ@ @t$?H9|$ HBD$?HD$ H$HHHD$HpHH?HH$~H$vH$H+$H9~ HIH|$HD$`HH)HH$H$LGHHL$AH$HT$HHL9sDl$?EIHIhM9C@EH|$HHt H/,H|$@Ht H/Ln1fHʾLDT$ L$x`xH$DT$ L$DEEt]wXD;$RH$H$H)H6$Ht$xD,HH$E1E1-HH\$8DwHGP0Lm1f.HGP0@AH.HHT$hH 7H\$8DLLL$0DD$(D\$ LT$<_TH$LL$0DD$(D\$ LT$8DLLL$ DD$^H$LL$ DD$11tH HffDFnfDDH$WHX$*H\$8H$H$H)H$HL$x+HE1H$@DH$fD,A=fDD,H$&fD,A~fDD,H$g+LLL$]H$LL$*H|$Hl$HHt7EtbHD$`HHD$H9$t$HD$H$HtHmt3H|$@HtH/t/L0RHl$HHD$H+\$hHHEHP0HGP0DLLL$ L$\H$LL$ L$fD+fAjf.+H$OHHT$hH 4H\$8fD,F[D,H$JHt$x$HfHtHmuHUH$HR0H$H|$@HtH/uHWH$R0H$LH$iH$c1ODAWAVAUAATAUSHHdH%(HD$1G AAA HkHH[HHH9H41CfH$H&Lp H EL11E1E1H=y3L=6DDRA~AGEtEuAtAEtAHA)DH?F1у߃Av9vHLb-HNHqE11IL9tsAABTE=+DRA~AGEtEuAtEAIHL9ut!H)ʉH<2H?FEt-HL)HQH$HT$dH+%(H[]A\A]A^A_ÐHS0HkHH[@HEHHD$dH+%(OH11[]A\A]A^A_:df.+HAҁvJAHA AL Ѓv IHIA?FDVwDHL Ѓv!DHHH?VwA1fBT?DBTE/D{wtVC D+-HfVfDHD$dH+%(u.H[]A\A]A^A_1DH1e1J_ff.fAVMAUAATAUHfDHT$H|$LHH)ILH@HD$`^HH>L|$H|$@Ht H/uHGP0H|$8Ht H/uHGP0L1pDL9It7I<_H HA?HA ?ʀAɀD@HPH9uHL)H@HHT$H|$LHH)ILH@HD$`I[HH^HH?L)HT$ HT$H,L9 HL)H@HIUH9C gʁvHt$@HH HD$PHPSATLD$0LL$HH|$ eH IHiLH+D$HH@HD$`I@A@ @IHIP0 H|$HLD$GLD$HIHBHIHtNH\$H$kHHGP0H|$8HHGP0HL HyI@LP0H\$HIPHcLLD$\LD$A@ 'IHIP 2L|$MHIDICLP05H|$(HT$L$LL IL|$H5bH|$8L$Ht L$:CL$IL|$IM_Dff.@AWAVIAUIATUSHH|$L|$PHL$LdH%(H$x1HD$@HD$8JHI9J4Lj*HHM~pE1HD$8L|$E1MHD$(E@EIHI9~;KI\$v=ƒ?HIȀEUI9L|$H|$@Ht H/H|$8Ht H/HLHH$xdH+%(LHĈH[]A\A]A^A_(vj‰Ɖ? ?΀ʀ=w#UIHM@u f.?UH@uɀEMIEuH|$HT$ HT$ AI9DHI9tA-=v1I9D$lAH=DHcH>DHT$H|$LHH)ILHHD$`XHHRL|$H|$@Ht H/uHGP0H|$8Ht H/uHGP0L1>pIff.ATUHHGG HIƒ``H}8H u+LEHLMt5HLL]A\S HM0LEH@LMLEuHLHL]LA\! Ut[E ƒ``pHuHH}0]A\@Hu0H]A\@HLHL]LA\X3H1]A\ÐAVAUATUH(dH%(HD$HGHIIHLt$ LLkD|$ uh|$ asciHus_asciiH9D$ |$ latiHlatin_1H9D$ H5`L=Hiso8859_H9D$ 6fDLLH5IHHhuyH5ҷH9tH.}H.LH H81KtIuHI}(/?ImHIELIP0@HD$dH+%(H(L]A\A]A^Df|$n1|$LHXI밀|$t|$fD$HT$<_u D$HT$<8R<1z6zL1HaEIIfHD$dH+%(!H(H]A\A]A^ ff|$iLHyDI|$t@HHMLH5 H81Imu IELP0E10E1IH=P@f|$1<3z2zL1HOI.fDz~LH I :fDAUIATIUHt?HLLHvHmIt L]A\A]HEHP0L]A\A]DE1]LA\A]ff.H}HHPHOH0HtBTuHa1H0'HIHATUSHHtp&HHtTH@tvH} H;EuH+[]A\f.HٲH5ZH8JHHm1[]A\H>H/tWH[]A\fDHHmIu HEHP0MtLH} H;Ebt@HGP0HHEHP01jAUATUSHHGG HH`<`H{81H_ IHH@Hx1HC8IHIUIu HHS0H~QImC `Ht<`tIHC0HEC `<`t@Lc8HL[]A\A]fDsNt^C `<`KHt HC@HLc0L[]A\A]fDHu롐IELP0n -E1E1|ImuIELP0YD1DATIUH}Ht@HLH HmItHL]A\DHEHP0HL]A\E1HL]A\f.1DAWAVAUATUSHHL$H 7H|$dH%(H$1H|$HHL$@HD$(HD$ H HIHHu ?@* Ll$PHL$L,|$d~Lt$xHL$HD$hH+D$pL9HT$XHHHL$˒HL$HHD$pH\$H96IE1HDD$`HHt$XHAHA rHHH9wE1H)HH\$HD$pAL/E4H9E HD$HH)H|$H)L%H\$8HL$0EuHHL$HL$AAA&A Ht$(HLHAUH HD$(PHD$8PHD$PPHD$`PLL$pLD$x莯H0 H\$DHL$@H9 HT$pLLHL$+HL$MDL91H$dH+%(HĘ[]A\A]A^A_DH9W IwfDHH D@IIHAD@AAD@II AD@II(AD@IH8I0PAD@H9sHLtLI9 II)IDCEHA?0HHAPD|$d HD$pHT$hH)HT$`Ht$X HHD$pH)HL$HL$H$@II)I DCDKEPA?tXu ASEQA?% AHHAAD@fAL$D;d$dHL$hH)HL$`Ht$X{D$HHD$pAfHHT$PIB @DDEx.HL@L9 LDDEyHLH)Aw~A>LH)HSDJA? DHD:AЄtUDHHI9wLE1fALH)HS H\$H|$phfDH9w[ fDIЈHHIpD@IID@II D@II(D@IH8I0PD@H9sHLtI9JAЄ,Lف  H)HDCEHA?Z HEAD HfDII)I&DKDCDSEYA?+u AfEXA?8EZA?A HHA7ADAD@A#H\$H|$pH+\$HL%'HK@HVt#fHHH9wE1H)HTDH9) IDHHfD@IIfHfAfD@IIfAfD@II fAfD@II(fAfD@IH8I0fPfAfD@H9s HLuLI9>"wUII)IDCEHA?.HHAfPf.II)IbDCDKEPA?u AEQA? AHHAAfD@IfAH)H\$HHD$pH+\$HL%HL@|$`H9LD$HHT$pI4I'fHHHT$pI9DL$`H|$XAtAuf-$fWHT$pfDDL#GL$`HD$pHt$X5D$HD$p4LH)DLHL$q#T$`HD$pHL$Ht$XHD$pAPH)H\$HHD$pHH)HIDKEQA?WA>IwS€?g@H)H\$HHD$pHH)HII)I\IDKEQA?+AIS€?H)H\$HHD$pfDADfD$FfDA>fDHD$HtHHHHfDLHL$)HL$$H|$(Ht H/UH|$ HH/uHGP0iH9w[6fDIЈHHIpD@IID@II D@II(D@IH8I0PD@H9sHLtI9RDDEf.fFHfHD$Ht H;IfLH)HHHCp?=[AHC?H\$H|$pHGP0@SDJA?wRAt>Auw8DKEQA?wDH A9D$:wH\$H|$p@H|$H|$(tH\$H+\$HHD$HHt H/uHGP0H|$ Ht H/uHGP0LeA(DKAQ?vAAu ASSDRA?DSEZA?A DHA:7DD$:11`4HHCP?= AfDAXfDH94 fH)H\$HD$pLLE1jA_II)LH)H:eH\$LD$pAZHH)HIRDCEHA?dA&FfDHH)HIDCEHA?AH|$(H9I9zfA>(LH)HHDKEQA?AhHC?H\$LD$pI9AH\$H|$pHt$HHDCEHA?|u ADKEQA?DSEZA?wHA7D DD$:@{DOA?bJu BDKEQA? HEF$^{DOA?u DKEQA?pDSEZA? HE7DA<8D$:H\$LD$pBb1A?{DOA?1w7u@7>mH\$LD$pfD^!AVIAUIHATIUHHAHH8LH9HNHHD1"HtRHHLHL葈HmAtHD]A\A]A^HEHP0HD]A\A]A^Aff.@AWAVL5RCAUATUHSHHdH%(H$1Ll$ LHfD$ToHd$HD$HHCHH$Ep<%tyUIAT$I%yHJH5H81LA&1H$dH+%(s HĨ[]A\A]A^A_fDE<0dHME1H=vQHq0LcHIIgfffffff"DVKHL$AHMӃ0HcI)LI?IHL)L9}HWH5AH8. MI)LHLLELII<.runQLyl8z"1E11uD$Tc@~^A"H HcH>fDD$TLfDQ1f|$an12|$c'LHL*HT$hdH+%(Hp]A\A]A^A_HHHLH5sH81aImu IELP0Hmu HEHP01|$^tk|$_f`D$`HT$`<_u D$aHT$a<8<1z6z1LHLf/f|$aiLHLFHD$hdH+%(HpL1]A\A]A^A_D|$et@f|$e1<3z2z1LHLSfDz1LHL.g@AUATUSHhdH%(HD$X1H1HGHIIHunH1H&Ht$HH<$LLHI$HD$XdH+%(HhL[]A\A]@HwHuL%`MtkI$@HD$XdH+%(HhHH L[]A\A]#H($fDHqH5E1H8\f11GHIHy96 H= E1HCH5ME1HPHH81e ff.HHHHHHHtATuHх1HzHH!UHCH]H AUATUSHHHHGIHHH:HHHAU E LE CHM0LeH@LE<8<<H+AHD[]A\A]DLHHtiH@E1Hqu`ID$HHEH߈HH81t-DHmu HEHP0HE1[D]A\A]fDHHmIMtIt$I|$ I,$Hu ID$LP0HtU H"wU fDLeH<KDI9LfHH9f8uL)HfHEHP0MX!H>H/uHGP0HAH[D]A\A]DHX!3f.KI9'LfDHH9uL)H1@I RMLM9rfHI98uL)HHH57H8 /1LLHufHAHH5H81HmHEHP0Xff.1 DHw[E1tJ ttBHcL 8t%r0 HDD8Et DfDA+IW I t%Hw0HH@HE<t<tN<t2fHH<uJGJHH9sfHH9wLLzf.JJH9sHH9w@AWAVAUATUSHH|$(dH%(H$1H|$XHD$HHD$@HHu@H HHH$dH+%(8Hĸ[]A\A]A^A_L|$pIIHLH$~L$vH$H+$L9LLHT$(OL%LL$PI9L-L%fDD;$DLL$R$H|$xH$L$0D4HHT$(H$LL$PI9LHBHD$( \oL\$XHL)HNHL$hL9LBLD$(Jq@n@Ic4L>f.H$$LD$xLOW6L$HE4PH=KHT$ LL$LD$L\$!L\$LD$HLL$HT$ H_~HZH5 H8LH H|$HHt H/H|$@Ht H/1fH cI)Ht$`Ht$HLL$HHL$AWHD$8PHD$XPH$PH$PL$L$H0QHT$(5L$HfA xL$A 8HT$(ff G H$HGP01fL)HGP0@11Hp|HgffH;$H$DH|$xHB H$\D9$KH$$H|$xHP;H$ HT$(D0L$8}uHH)FL9=HD$H9D@A vD@AHLHT$uDHL`L)H)Ht$`HD$0LHt$hHt$HHHAWHD$PHD$(PHD$PPHD$`PLL$PLD$XnH0.HD$@D@AwNL!DL)D,HD$`HHD$`HD$q@(HL)6D9L$TsBʾLL$T$PHt$HHD$`L$thtZ Ht$`D$PH|$HLFt&tLD$`HЉ LD$`Hf wLD$` 7HD$f F HD$`.ff.ATHdH%(HD$1H.HtXIH$Ht$H+oHH81x!HD$dH+%(u.HLA\I,$t E1@ID$LP0fDAVEAUAATIUHS HLH HCH9HOL9{K HL) u1H{HEDIH舲HtL[]A\A]A^fDLC0H{H@IEoHHHmH5H8HAVEAUIATIUHS H;} QID$H9HMy IŸLHHU1H)I9HAD$  Md$HE @@  LE0HH@IEEIN݃$E DE1E9u@LBJE|FL1E9[]A\A]A^f.HHúHHfD;[]A\A]A^@HDIt$0IH@LE@EHmHIN݃E DE @DEfDE \fD9IM M\M/tCA<t*tET9HI9|uA<TfAH\$pSA} xLHL$HL$ILD$hHL$`LLLMeI7HH}11ٱHHH@t`1HT$HHH5̵臮tYHD$HPHt-HHxuI9|xHHmu>HEHP0HD$-@HYH5uH8ZHmu HEHP01HT$dH+%(ueH([]A\A]A^A_LHyH[H5*H81HmuHL$HL$HHEmff.fAWAVAAUATUSHH|$Ht$dH%(H$1H H՜HD$`HEH7HD$XHD$8HHEHD$0G UHt$Ln HD$LxHM!HD$pHHHD$(HL"HH{M\E1EE1E.@CMD$D9s7EMHM9uC'fCD9rIM9~uCD9sfD1M9$Eu!H|$LD$ D\$XLD$ D\$AAbH RDHcH>DHV0L~H@LEM11zCGSfDHT$H|$(LLHL)D\$ H$LD$SHLD$D\$ HMM9H|$`Ht H/uHGP0H|$XHt H/uHGP0H|$(HVLH?D\$DL)LD$ HT$HT$LD$ D\$DHMz@M97fDC#wIHEM97uHD$XD\$Ht$`HHD$(IHD$pPAPATLD$(HL$PHT$XH|$0H IHH@D\$H$AA II@IQ0 yH|$(HLL$ D\$D\$LL$ HHLD$hI)dIALD$ LD\$P0LD$ D\$MALL$0HT$H|$XLHt$8H|$XHtH|$(SH|$`Ht H/H|$XHt H/1H$dH+%(FHĨ[]A\A]A^A_HT$H|$(LLHL)D\$ H$LD$CkfDCgCfDCg fDoHD$@ HGP0UHGP05IQH~LLL$D\$DILL${AA D\$D8IIH|$(IQ HD\$ LL$.LL$D\$ HCH|$(HHLL$HD\$DHL$]LL$HHH HL$D\$DH 1MA0MQH6D@tU@te@LIDҋD9seHUHH9AQ ։׃ @u@t+@LID@t@LIDBIQHIQHIQHLL$H|$ MD$LLL$0HT$Ht$8@H|$XL\$HtL\$L\$I+ICLP0|MMATIUH]Ht@HLHHmIt HL]A\HEHP0HL]A\E1HL]A\f.ATUHHGG HIy&ƒt4HLH]A\DtKE ƒuHu uH}HH]A\HU0H}H@HEH]A\fDH1]A\Ð1UDATIUH-Ht@HL満HHmIt HL]A\HEHP0HL]A\E1HL]A\f.ATUHHGthG HIyJ@t&HuH}0 uH}HH]A\f.HLHﺀ]A\9ft E {H1]A\Ð1DAWAVAUATUSHH|$dH%(H$1H|$HHD$(HD$ HKIIHHu HD$PHH$(|$d~Ld$xHD$hH+D$pL9L|$XKt%LHt$0L1HD$pI9OIHD$0Dt$`E1HD$HD$HLl$HD$L;l$0fEu HӔAANALH+T$HHt$(HHT$@HHH HHT$@Hƒt$HD$(PHD$8PHD$XPHD$hPLL$8LD$@AOH0Dt$`L|$XLl$L9l$0vIAm@QHD$pAA8@fA GHIHD$pLl$L9l$0wH|$(Ht H/H|$ Ht H/H<$H$dH+%(MHĘ[]A\A]A^A_@H<$L:1AH|$0IEHD$IH9^H@xHD$pAA,HD$pf|$`vgL|$XHD$pAAt4@́A @A Af.H<$Dt$`L|$XHD$pDAtZAtA,HD$p[f.@f$fA G>DH!JHHjANAHD$pfAGfHGP0@HGP0H<$.H|$(HtH/tDH|$ H!H/HGP0111HXIH7HGP0ff.AWAVIAUIATUHSHdH%(H$1HHuAHHH!HH$dH+%( HĨ[]A\A]A^A_@L|$`HL|$t~L$HD$xH+$L9oHHMH9CND5Hl$(Hl$0HD$PHD$XLD$8L9gHD$8HD$HD$0HD$}IH|HHI.Iu IFLP0M7L;%NID$HsA|$ I|$AD$ ‰ IL$0@IT$HHHD‹%9T$t[H$HL$xH)HBL$pHt$hLLHKH9CxDc Hl$(HHl$0HD$PHD$XELSA HC0HHA@HEAIAILt$8AHt$hT$tI9H'H$HD$Hl$(H$I9YEA9vʋT$tH$HL$xH)HiHt$hf.ALL$8Hl$0!ˆT$I9LT$HLLEIM̀|$D$p1RC9T$tH$HL$xH)HL$pHt$hHH$HD$(HHHL$(Ht$8H9c@IH|$PHt H/uHGP0H|$XHtH/uHGP0L(LLƄ$]`I,$u ID$LP0H|$PHt H/H|$XHt H/uHGP0L1{LHH=fI,$H+l$0Ht$PHLHl$HHH HHl$PAWHD$8PHD$pPHD$hPHD$hPLL$8LD$@FH01Hl$(H9l$8fDH=A;D$t7H$HT$xH)HT$pHt$hT[ HH$I,$tHHl$(qID$HLP0Hl$(QID$LP0HGP0f@xID$HvLp fHiGH8jLT$tH$k@DʾLHL$H$HL$fH$dH+%(?HĨH[]A\A]A^A_LT$3H$T$fD11HAHfH[HH9D$HD$(H+D$0MMHD$@HHt$PHHD$PH >HULUHD$8PHD$pPHD$hPHD$hP,DH0I H$f FIL$0@IT$HHHDlDHpPDc HL$(ID$H3fDH$0fF'HL$(LfDIL$0@IT$HHHDuID$HaHD$(H|$hH9w1fH$Hf WHH$HD$(H9 Sfub@AtJAKGHT$OH$T$DfDfFCH$,HD$(LL$h|$tH9w4@H$HA HD$(H$H9S9sHhAH5yH8HHMAH5)H81询&eDW0G4HcHH|?aATIUHOHHLHxHmIt>MtHL;%rEtIT$HtJHL]A\HEHP0MuHBH8btD)L%EI$HY@HRH5ƜH81輡I,$u ID$LP0E1HL]A\@LpH=bH@H5NH8I,$uDAWHwAVAUATUHSHHL MiH9FIH~H;LDIT$HLuM|$MD$ II9}/IvHLD$HH9HLoHLuLD$I| LL;L;I$HP1I$HuMIT$D$LR0D$H[]A\A]A^A_HAHBAI9|rH1Ed H[]A\A]A^A_fHI9}IvHHH9HL豳uVLuLIHHPHED Bf.MHI9IMHku"HLMHBeI,$u ID$LP0H[]A\A]A^A_ÐH(tH[]A\A]A^A_fDH@LP0@ATIUSH/HHLHXHmIt6Mt@L;%RBtID$HuMt|L#1[]A\@HEHP0MuH?H8JtvH1[]A\L蘜H=vHI<H5H81蓞I,$u,H =H5H8I,$u ID$LP0fUfDAWAVAUATUSHXdH%(H$HHGLoMG  HoHAHT$@fv@M9HH)D$ HMN)D$0Ld$LcE@E1E1I ^fDGDPwU=t( | u DD A|@u Dd@AHcH;D$uDPvIH-E1E11D|LIIMHHLLI$HI$u ID$LP0Imu IELP0AIcIH;D$o|rDHW0HH@HDHFf.DEfD|E3fDHI$uID$LP0MtImu IELP0I/u IGLP0E1H$HdH+%(HXL[]A\A]A^A_fDAA @tSNIHtMk}@E1yf}@f.DEDD$AHcMcJ|2?HT$HT$DD$HI,H5 HDD$HT$DD$foL$ Eg4HT$IO8MgAOfoT$0HEG0LAW LD$HL$蟃H|$L1萃IIHL$1dtsDTAt@D ADHcH{D$$D$$qMI9|#LII9.LLH޿?7uYDO@HUH@HHED$0Bܲff.AUIATIU茏Ht?HLLHfHmIt L]A\A]HEHP0L]A\A]DE1]LA\A]ff.HGtHt 1H71HAWAVAUATUSH8H|$HT$0dH%(H$(1H H|$H_ 1 HD$LhHHD$L`MHD$`HHD$ |$t~vHD$xH+$L9}H|$ LzH|$0H|$0H5D TD$Lt$AF @HD$M HD$PL$$Lt$XHD$8HD$(HD$H@HD$E|LHDuJLD$XML;0IPHII(@H|$ ^HL$(HtHH$HH6H|$8HL$8HH$HHHAHP01H$(dH+%(- H8[]A\A]A^A_fDHL$@HA0LiHLEE|DE|EDtPHD$X DT$HH|$@H|$@DT$HH/uHGP0fH|$ F10LLD$@[;D$tLD$@IAwJH$HT$xH)H~5T$pHL$htaffDDHB,<L|$E1L~+1fAn fnHL$Hf8?f~f~L9LcH<$~}ADC|L}~9HL$1J4fDfAn fnf8?f~f~ H9MtIL9$$uHD$(dH+%(H8L[]A\A]A^A_>C|%pDC|eYH$LL}fn fnHD$f8?f~D$f~ fB~Ibf>裀AWAVAUATUSHHHT$HL$DL$dH%(HD$81H3IME11Ll$,Axff.AWAVAUATUSH(HHHxHHHGG LMA@HEHL!I|$IAE11Hf.I|$A@u'AAAAtAAAEEE9EBNMIEII)I9HHMtEt A2G E1AIL9JMHxIAD$ VLHT$HL$DD$L $ۍAD$ HT$HHL$DD$L $ f.L&I|$H;=tE11E1fL%MI$H(L[]A\A]A^A_fHHOLH5sNH81aRHtHmtE1HEHE1P0릐A<"<ADE fHT$H4$ҌuE HT$AH $LM@11THIH!!@HH5MH8„<DDHT$HL$DD$L $IHDD$L $HL$HT$E-HHL9HYE1H$:H9$tjL;Mt ML1HLLL$7LL$MHMoMtLM1LLLL$M7LL$HD$HHHmHEHP0D H4$A HT$tH $HT$AHH\ 1DHT$HL$L $ǁL $HL$HHT$IDA\$ I|$HM2E Hu0L}H@IDHt$H&L9HYIHD$HMH$^DIO0IwH@HELLL$-LL$HLH;$L;MtHt$LLL$LL$HLHIGHtHD$IAG uIwHID$0I|$H@HEHPHH5JH81 OHEHHD$fATIHH5 UHmHtVHH@HutHuHUL hHmItHL]A\DHEHP0HL]A\E1AWIAVAUATUSHHHt$@t2HH[]A\A]A^A_f.HD$HHtII)HHnLV1ALl6E$iLN*MLf MIL fD9LDHHsL1Ee,DALHHHH0HDHI9QH fE9$@uL, 1E4QfE9tUoHH9uHHD$HH[]A\A]A^A_fHD$HAB @A@ @HII)HHnLVED1LH<*AO$1Nt MIL MI)D8MDHI9uL1I'LMIH 0AHDHI9DD:u1H E4D84HH9uHT$HHHHI@HD$HHII)HHnLV1AL,E$LN*ML MIL D9LDHHsL1Ee.ALHHHH0HDHI9bH E9$uL, 1fDE4E9tQHH9u HII)HHnLVED11H<+Nt LAO$MIL MI)D8MDHI9uL1I'LMIH 0AHDHI9D:u1H E4D84)HH9u;uVE)L$H EL9s7AHfDHD;(HxI9vLH)M8HuHH[]A\A]A^A_fH9ALHHHH0LЃHDOfDH9ALHHHH0LЃHD/DA1H \H HH9rcHH9S@:0uH)&fDH9LLHHH0LЃHD}fD E)L$JH ~TEtOL9AHDHfD;(tQHxI9LH)7Huf.HL9rHI9fD;(uH)H\fHL9rkHI9[D;(uH)H,fH9LLHHH0LЃHDfDHHU6HA1H H HH9rHH9@:0ukUSHDO N DȉA tzLW0LGHA@ME tULV0LNH@MEHoH^H9ILN<tP<<1H9t DH[]LNHf.LGHf.w>uK PI9ufDIIL9tAA9tH[]ULLLsAEG+7fDtB KI9uIIL9AA9tZfLLLb:AE{@MM9uIIM9AA;tfKPI9ubfIIL9OAA;tK PI9u2fIIL9AA9tfDKI9u f.IIL9AA9tRMM9uIIM9AA9tff.HO1H9Nu#DW DN DEAAD8tHA u6HHA tBHF0HHA@HEHqHHG0HHA@HEA uHvH@AVAUATUHSG xQHw(11u%fD9H HЅDuA[D]A\A]A^AĉA AAHW0HwH@HE1 @ Dt9uHAu V9[]EADA\A]A^AH;W@aD[]EDA\A]A^fHwHHW0LwH@LELoH~IHLI9HHIF6pt2DH@AH;WDEI9I9DFLwHfAWAVAUATIU1SHHHIE1HLILH <HIHHH)H9HH)L9AD$ I˾@ty9LL$BLsIHP LL$ umIMHMxI|$IMk1LHL(HL[]A\A]A^A_fD<w<Ec@Iu0IMH@HEM~<D<<t`MD$fHH5?H8ztE1jfHAH9G x |tI$M:fDHHLL$D*LL$HMxI|$uHH9sH@HH9wI|$IMH/IHJH9@HH9w<tq<t<DHLDH{)MD$iH[]A\A]A^A_mcDHiH9sH@fHH9wI|$IM#H/IHAJxH9 fHH9wff.@U Hx ztHH5]1]ff.U HyH}t+HH5]kCzu1]f.HQH9Eu#} x HztHHE]fDH]GbUG Hy@u&HH5b]@ytE @tH]1]ff.UHSHH } HKH;Mt1H[]fHtC } 1uӉH@ tsHM0HuH@HE tpHK0H{H@HEMkH[]fDxx} dHxSXf.HuHf.H{Hf.AWAVAUATUSH(HGH|$t$HD$x yAHD$p <<h<t4E1H(L[]A\A]A^A_H|$xyHT$ @Lz[Lr0u HD$LpH1QyIHtE1H-<M~f.L|HL9}>A yHaHtqtI9~HCHD$t$t*H\$MuL9uHD$HeH9PH\$HK<&L)%IHHL`I$HI$u ID$LP0HD$L9I!HT$Lz@ _HB0HJH@HDI1$xIHd1H-;MUfDH|mHI9~=A<vH2HsHT$bpHT$tLcI9~ D$t&LHuI9uHD$H57H9pIHIA yHHt2ntI9~HCHD$L$t*H\$MuL9uHD$HH9PH\$HK<&L)IHtHL]I$HI$u ID$LP0HD$I9LI%HB0HJH@HDIHD$LpHHL%] DImIELP0HI$uID$LP0HHuHCHP0HIuIGLP0HPHH50E1H817I9]HCHD$ >L95A| )HCHD$I9eHCHD$f EI9HEIHĘL[]A\A]A^A_fDHĘH[]A\A]A^A_oVD$4D$0@u$D$0tD‰D$0@Nj|$E@D$@D$0Dt$89CljD$HH;\$ A9LDL\$XLD$PiLD$PL\$XHI]A AA< L"HGHHD$A@ AT$ MxH I\$HH\$(I AAtAcD$P@Ht$t A@ @H HHD$HH)Ht$XHHD$LkL|$h1HKLl$xA|AJ4(KD=H\$pHHD$`Ll$`LM @MIL MI)@8IDHI9uH\$`L|$hH1L\$hLl$xE1H\$pLL$X)DLIIH AHDHI9@:<uL\$HD$X1IAA8  HI9uHD$XIL9T$h\LHH54/H8cMH|$@@"l$PH|$("\$XHtDD$`Et @tL t H|$( E1DHHD$8L\$X9jHMSHL$HT$(|$HLD$`^_HHD$hLD$PL\$X2|$@9|$8Mt$HH|$L\$pLD$@5aIH\D$XLD$@D$PL\$pD$`AF jIV0INH@HDHT$@Lcl$8HT$L\$HHt$H|$@LD$pIlLd$hHT$ H|$@Ht$(LIIHT$ HlLHHl$HtvLt$hLt$p1f.HT$ Ht$(LHH|$@elHl$HJ#t4LHL$MMHHT$PHS|$HH)1_AXIHuLt$hD$49D$09D$AF @I^ IVHuIVHH4AH<2HHH9s8 B B B  <AH9rH9r7fFAH9 #uHLljLD$PdLD$PL\$XHI&L\$XIHjSHL$HT$(|$HLD$`ZYHHD$hLD$PL\$X|$@9|$8YLL\$8LD$}L\$8LD$D|$@HL\$PLD$8D dHD$HH|$8DcLD$8L\$PHIt$HH|$L\$PLD$8 ^LD$8L\$PHI-D$@D$XD$PD$8D$`DH|$D$PHsHt$HFI9LOD;t$@8D$XD$`HD$ HH)H9}HH+D$HIH95HIHD$HuTL5MD ID\$`ERDT$PE4DL$XEH|$(HLcd$8HIH9t$HL\$hLD$@\IH@ LD$@L\$h ^IV0INH@HDHT$pH" HD$ E1Hl$HMkHD$@LIL$LD$hH$Wf.Lt$ M~5Hl$@Ht$(HL$xH$HLIH|$p+hHl$@HL$xH, I+MHD$HL$ULSLD$xMHt$X|$HH)N4LZYHHH9hILLHD$xI)Hl$@ILD$@HIH|$pgLD$@HL$xLHl$@!DLL\$hLD$@`HD$(HD$XLD$@D$`L\$hfDH|$D$PHH|$HGI9LOCfDLH|$D$PM 5t$@HL\$XLD$8B`HD$Ht$PLD$8L\$X t$@LL\$PLD$8`LD$8L\$PHI D$@D$XD$PD$8D$`DG  E'HT$H|$DDAL\$ IH|$@HD$(L\$  |$@" t$HH|$L\$ YIHLD$1H1HAN L\$  ` Iv0IFH@HEInMK  JH,MHBH9Lt$ EML|$H‰IHBH9D;btHP(fHHH9ttD; tH9uLyHL)HHHxSH(EL9v;LfDHD;' HH9vHDH)HHu@L|$Lt$ D$XD$PD$`9fH|$(D$P[HD$HH)H|$` HHt$H{HKML|$hEHAHLH\$pHHD$XH1A MIL D9HDIHsHt$XL|$hLH\$hHD$XH\$pDL\$p1L\$`%BL IIH AHDHI9L D9uHL$LL$`N, 1fDE E9LHH9uHD$XHL$XH9L$ptNHr HH0 AHt$11fHH9t9uHI9uHL$X@Ht$X1HHHIM|$P\zfDLL$`H9bBL IIH Ht$hAHDHD$HH)Ht$` HHt$H{HKMHDL|$hEAHLH\$pHHD$XH1fA MIL fD9HDIHsHt$XL|$hLH\$hHD$XH\$pDL\$p1L\$`+fDBL IIH AHDHI9L 6fD9ruHL$LL$`N, 1E OfE9LMu+HH9uHD$XHL$XH9L$ptHLL$`H9tBL IIH Ht$hAHDl@H?L$H9l$HD$@H|$pHT$H\$IH)IHLHH4`~fDHD$XI9/LIIH HD$`AHDfIFHHD$pfH|$(D$P HH H|$AE1HHHfDHH9t8uIM9uf1MIII0MD$PLfDHHHD$HH)H|$XM HLkHD$L|$`1HsKL=H\$hETJ(M 7LH@AIL MI)D8IDHH9uL|$`H\$hL1Ht$`E1Ht$XL\$h+LIIH AHDHH9zD:uL\$HD$X1IAA8 $HI9uHD$XIL9L$h2LH\$ HD$pLt$HHl$L\$ IL|$@HIL,MMI݋\$8L\$8LfDHt$(HL(^MLMHIHHl$ tt1ƒA4@49rL\$8HH\$L|$@Lt$HICHIJ<*HT$H|$pH4HL)I]f.IFHHD$@HH9s,t&AH9rADH5QHHk11ILHwI.ID11PHIHE'L9OLf.HH93D; uL)HHIpDLL\$PcL\$PLD$8HHH|$AH wH1fDHH9tf9uHI9uHt$XgIFHAt$8LL\$PLD$@ULD$@L\$PHHD$( t$HH|$L\$XLD$@OIHD$PLD$@L\$XD$XD$`E'qH|$jHD$XI9LIIH HD$`AHDut$HH|$L\$PLD$@.OLD$@L\$PHIeD$XD$PD$`t$8LL\$PLD$@TLD$@L\$PHHD$(t$HH|$L\$XLD$@NIHD$PLD$@L\$XaHHMHt$AE1HHHfHH9t 8uIM9u1MIII+IFHHH<HHfDH:H9QH¨uH9w@HH9HH#tAI.IFLP0JhH,hAfM HBH9AL|$MELt$ EƉ\$8@fD2IHBH9rHA9tHpDIHH9A9H9uIYHH)HHH}H~ZEtUH9iDd$@HDd$8%f.HfD;8?HxH95HDH)7 HuH9HHH9fD;8uH)HHHCH9H,IVHuIVHH4H<2HHH9A,AH9af Bf Bf BuHJ(HA݈MHHBH9;L@D*H%HBH9JHA9tHp fDHHH9A9tkH9uHyHDH)HHu@IFLIP0AIFHHAHEH|$ L L)HH HD$XA^ALv HD$XHDd$@H)HHE1uIlAH9E1IfAWAVAUATUSHHF5~ HIxH9SHE!} u AN 1AAAEA9HUMfL9@ HmH IF0I~H@HEI9A9LDH$NH$HHtUACAA$$H[]A\A]A^A_H8RH[]A\A]A^A_@HPH5HH81,H[]A\A]A^A_HE0HH@HE I~H AvA AjMHL)IIL$MD$$1FT'INL1AHfD MIL II)D8MDHI9݋$L1/f.ALIIJ "AHDHH9kE:u1LtfDD<E8<u HI9L9ALIIJ "LAHDfDM HL)IMD$IL$\$ 1FIAHJLLHH$1fD MIL II)D9MDHI9H$\$ LD2$1$CLIIJ "AHDHH9LE94uN|1A9u HI9I9uCLIIJ "LAHDf1A9ONADHH@MtHL)I~HxKT$MD$\$ 1IL$LLHFGH$I1AHf WMIL II)fD9MDHI9H$\$ LD2$1&DCLIIJ "AHDHH9|wLfE94QuN|1DOfA9Ou HI9I9tCLIIJ "LAHDf$1H$1HPH5 ff.HAWAVAUATIUSHxHHI€ H|$HD$FMUA|$ Ht$AL$ I\$V HvAՃHt$HAD$8AA|$<9H9 Ht$HF0HH@HDHD$ ID$0Il$H@HEt$L)%IHL I IENAA@t AD$ @ H`HL$ H9HNHxH_|KIHH|$1 LT$HI)LT$@H M LsLl$0E1LD$ JD5MAHD$HD$XHCIHD$XK0M181DLMIL MI)@8MDHL9|MII 1'DL2LHHHHDHL9^@:<2uHT$(1I 0DT8u HL9|HT$(I9 L2LHHHLރHDHL9~fH|$Ll$0M HD$ J< fDIl$HfDHD$H@HHD$ SHL$Lq HD$LxHLd$ I9INHxIIH11MM@I9% fDH<8t#HI9&A<vu@IDHI9~A<j Hc<8tMuI9uHD$H ǭH9HHKIELL)KIHH IELHt$HH|$ H)H>IH@HHHL$(HD$cLL$HL$(I)cIAHL$LP0HL$JHD$ Ll$0MJ<bI/aIGLP0RLl$@I(@I@LP01HI$#ID$LP0IHl$HLHEHHEHEHP0E1IHL$Hl$Ht)Ht$HHD$ H)H

IHL1HD$H {H9HtnHD$Ll$0I(`IHL$Hl$HHD$H 1H9Ht$HD$HL$HHYHL$IEHHHD$=Ld$OIHL$Hl$HHD$H H9HtHD$HHIEIHHD$ Ll$0MJ<De2IH6H|$HAHD$LpHHl$L|$HL1HD$Lt$  @I9~ZHHsE:duH)I<IHHL$H qIEL HD$HI9~HEHBHH|$Hl$=H9T$HHt$HH|$ H)HhIHBHLHD$( LL$(I)pIALP0aHHE?HEHP00LLI$HI$ID$LP0MIHl$I/IGLP0I/LMHLeHE_HHEHEHP0H|$Hl$HD$H gH9HVHD$HD$H CH9H2Ht$HH|$ IH!1HD$H H9HHt$HH|$ H;IHHD$ J<HD$H ŔH9HHt$HH|$ 9IHj1Hl$I)MHD$H qH9H`Ht$HH|$ p=IHO1HAWAVIAUATUHSHHHHHH؀ :HD} AV M I~LEAՉAH|$AAD$t$9L9 (IF0M~H@LE HE0LeH@LEt$D$9aHLD$ )LD$ HItWAAAE1LHHL[]A\A]A^A_@H,E1>.IHtH@IL0f,tHAV <<)<uMf @M~0uM~H H9HNHx-IH]HD$ID$HD$HHLt$E1fDIHy3H<8tIC<7@yzuInMu$HQ<8uHAHl$f.HLLT$$HHu"I.IFLP0HHEHEHP0Hl$HLLT$HH(HHEHEHP0vHLHEuHHEHEHP0MLd$dHzI9^OIEIL0pJIZHyI9^tsA$T$0"IHHD$LD$ HkHLt$(1Dt$0Ld$MIHfDE:4,HsLLD$ MLt$(Ld$HHpLHL$HHHyHL$H HLHEJHHEnHEHP0_H)I|,HIHI .IEN IHEHt L9LMLd$FHLHD$0@LL$0I)uIALP0HbxI9^L5LLI$HI$ID$LP0Hl$HLL\$޿HHAL\$JI[I HLL\$L\$HEHI[HEMLd$I)IALP0Ld$MHIIBLP0HVwI9^@Ld$I)M|HI$AID$LP01HwI9FHt$LϾHHS-LMLd$HHvI9FHt$LHHLLd$MHvHvI9FtHt$LHHH[vI9^EHE1H8vI9^"H|1LMLd$HHvI9FHt$LHHL&HuI9^H|1[HuI9^H_11UH HHH54 H dH%(HD$1HT$LD$ D$ Lth} yRHEHt$H9}\HL$ HH)HH!H?HHHH)YHT$dH+%(u[H ]Hu1@HtH9Eu#} x HtHEHfDHifAUATUHSHHDg EyZA@tLkHL9tH1[]A\A]fDA H{0uH{HLH_uH[]A\A] tDc KLc@HOI9uHK(1MuD9tHI9tDy]ATUHSG HyR@u1[]A\HHHH9t?E uHEHtH;Fu[H]A\]D# tE fkLcH]@LkH9lHM(1HuD9QHH9tAy:HsH[]A\ff.HGATIUSHFtW HA|$ L9CLHw5`A1A9tHHrH[]A\HoH[]A\Kuo~HqHqoH@ R1fDL tL9G%tP[1_@7Duۅ#ffDW f.?fAVAUATUSHGh IIIEGA} HlI9I9I]Il$HH)H9AD$ H|@u<t<EAU @utE9BIHtEHIL11 ILHL1 [L]A\A]A^ÐL E1[L]A\A]A^Ð xfH!rH5z H8L[]A\A]A^頽LHPH8mH5g E1H81f.AWAVAUATUSHH]H/HIHHHEHF} A|$ +H;jH9:L9M|$LuHL)L9:M K<>΃@H}H}HnH9EI9D$AD$ AAAA8@@DHtvH;Ht HH/tH[]A\A]A^A_fHGH@0H[]A\A]A^A_HtA|$ L@,H=D tf.AD$ AA@@utEѾEu<t<E9BIH11HMH1MLLL Hmt=L+DHH,H=j []A\A]A^A_HEHP0@Hmu HEHP0I$L#yf.HnH5: H8?HH:!,H;HML[L]1A\A]A^A_AUHHtHmt]DHEH]H@0fH <UHHHtH/t H]HGP0H]UHHHtH/t H]HGP0H]fHG0G0GG ff.fLMt HI(tfDI@LH@0w LG(H``AA HxHPtHPHzHHPMt!@HP@LHI<`t0HP8Ht'@ L@0HHH@IEH9t H@0H|HWHzHHHfDLOIQ1HMt@xNyfDAA Eu4HPHL9^`BLHHDHHHeLH0HPH@@IEfD SHy HC[@uH[DUG Hy@u&HH5rm]q@tE @tH]Hh1]ff.UHHH5 H dH%(HD$1HL$HT$IH$0tD} x Ht1H $HT$HHt$#HT$dH+%(uH ]D1ff.@U Hx tHH5~l]p1]ff.UG Hy@u&HH5"l]lp@CtE @tH1] g1]@AW1fAVAUATUHHSHHXjdH%(HD$x1Ht$@HT$MHHD$(HL$0HT$HO|OO:HD$@LD$8HcountHD$E1HD$ H\$0H\$8HD$eD$mD$qD$U荹uH|$0H9tHt$ !YH|$8H9tHt$(=H|$HT$ Lt$(HG u G AAAEA9+HMLgL9 MHy HʹHHI)M9@ zLE0HH@LDŨ SHw0HoH@HEA9DHT$L$L$HT$HHtZAAA41UIH躵+HT$H<$H<$HT$E1HD$xdH+%(HĈL[]A\A]A^A_@IHD$xdH+%(HĈ1[]A\A]A^A_@AAAtnHD$xdH+%(mHĈ1[]A\A]A^A_jf.HoHLEHIAMH=fDMMHI9ILIA9M7MtMM)&IHHt6HxQHD$hdH+%(uwHp[]A\A]A^LHy@HD$hdH+%(uFHp1[]A\A]A^ÐHPH5 H8ZHPHQH5 H81DAWAVAUAATUSH(HFHFH\$`HHAHAHI@L_I@LgIAM9HIHMS H{HH<$H{0AA׃@H|$T$AA I{AAtdEHSHH|$B,HxUteHIL;d${HD$HL^HFAH(D[]A\A]A^A_fEgHSHB,rH|$HxUu}I9{{JI9iHL^H~AAIH0I@I@L`H1HpHqHpL9(HDS DDՃ @@"@IL[0HSHA@IEL^LX[{HNH59 E1H8Eu3HSHHxB,2H|$z@H$|$HET$U@H$|$HET$H$|$HET$@HMH5: E1H8_Ff.!t:uKHpH~Hy!a:X}HMH5i E1H8}tHpfI9'AAELcHA,}L$$L4$E$A9THHL^H~@L[0HSHA@IEL^LX2[MHpELs0LkHA@L9|JD@@EMMDA<]AEHHpL9@u@EMMDA<2]uLcHfA<|}H9LH5Z E1H8f@t;EMMDfALt$|$LD4$L4$I9sHH~J AˉA AAfHj0LZH@HxIHMDE$E!I9HIDHLHp}:uHpfDEt;LIDHPLQH0HMHHMHOHMHf.HWAHPHL^H~fHHH5 E1H8fEu[LcHfE|$Lt$fA<~}L4$L4$E$~fEukLcHL$$Lt$|$LD4$L4$+L4$A,}f.|;H}HIP9Lt$|$LD4$L4$hL4$fA<~}XcHJHHHxDEI96H;@HxL20A I9~HJ0HHp 9H=GH5 E1H8Hj0LZH@HxIH6MDE$tE!I9pHIDHLHpHJHHxD1EI9j7HFH5\ E1H8!HJHH6HxDqEI9L2HA I9HJH@ATHw L'Ht.5HuPLI;t$t rHHtbA\cMtHI,$u ID$LP0L%{DMtI$LA\11HXDIHufDI,$uID$LE1P0E1ff.ATUHHH5 HXdH%(HD$H1HT$辚tj} x HtWLd$LHT$1HLLBtt'LHT$HdH+%(uHX]A\L1AWH !AVAUIHHATH USH8dH%(HD$(1LD$$D$$E] EEMeAAAA ImHMLcL$$111I1MMM)/L9GH H HI9tTD uEHHILH)LH9HHHǺI9ufdA@u AAtAEhIH@ 0MJH1E1E13f/BD ILc|$$EKIM9t4uBD-< lCHI t uI1M9uLHHH5ݥ H8Z1HT$(dH+%(H8[]A\A]A^A_DIE0ImHA@HE-LtE] D xfD1LfDMXfD)fDIR0MJH@LEDBDmf fCAHf.CHHHII)LAu#KJH9s HH9wMyD$$lLcHK< HLT$ILD$L $I)LLHL$ߌLD$L $HL$LT$MHDI9Eu#ExLjWIELLL?Lc|$$EHHIKAI)JxLH91f. HfpH9wMUH $lHHH5 H dH%(HD$1HT$LD$ D$ ̕tP} y:HEHT$H9}DL$ H)1H_HT$dH+%(u]H ]DH`u1@HqCH9Eu#} x H5tHEHfDHhAWAVAUATUSHHMHIH HLeHII9/E M@LRIHE AV H]Aʼn׉A AHE@5@Iv0M~HHLEIՄ*HM0HuH@HELL9LLLLH)H9HOHHHLI9\<6<E"@f.E1L5<MHIHL[]A\A]A^A_fEAA@HEH@yIv0IFH@HEJfDHH9uHM~HIՄHuH@H)AH9G/ x3HEIBfDtrHM0HH@HHD0@IF0I~H@HEL؈HBH5o H8DHM0HH@HHDHEH@11H;IHt~HM0HH@HHD@t_Iv0IFH@HEJxfHH9uKIFHH[]A\A]A^A_I~H IFHHEHUH gHHH5 H dH%(HD$1HT$LD$ D$ |tP} y:HEHt$H9}DL$ H)1H[HT$dH+%(u]H ]DHu1@H!?H9Eu#} x HtHEHfDHUH>HH9Gu x tHHE]Ð]f.1]ff.UHHH5 SHdH%(HD$1Ha} HUH$H9H)й01HHHvZHp @ Hx0HHH@HEσH2~Ճ@HT$dH+%(H[]DHP1@H=H9EuS} x HUtHEHfDHHHdHrՁn0d@HXS10CHY2~f+f10f 趿fDUSHHG HHyqHH9k~zS  u)H[Ht4t{<v(H[]%DHK0HH@HEكu<+H[]}D#uH1[]DH;H5O H8JH1[]Ð1ALL蛇Hx&HH9l$tHD$u4(IrEuKHT$H|$H(H[]A\A]A^A_HO0LgH@IDHL$ 4hsHD$LpI9|HEHD$@t[B4IsA1ALLކHx)IFH;D$:IHD$uB40IrfIFHD$7fB4pfIGHJ4hE1H9HHHI H9uofDH|$趽H(1[]A\A]A^A_@L落tAW J4(H9fDHHHI H9ufDJ4E1H9HHHI H9uLt$fDAWAVAUAATIUSH_ xMt$ @M|$HuM|$H1AtZM4Jf.A<w%H/&<8t!HI9tuAAABAE1L _H`&E1H8L[]A\A]A^A_H HH1HH}H=c IH/uHGP0묐xfAAAz@t C @M豝IH%HT$IM)IHD$Ll$ MU1M}C|,O"J4OHHHLL)ȃLDIN<K >;17M@MDT$LL$ DT$HIHD$LL$ IM)IuIAIyHD$AHLEMHIL f9HDHuL\$)CL.HHHLL)ȃLDIO,?K .f;1MfDAD$ DHH5 DT$H8eDT$E111觐H@HH<~D}H ELl$AHl$LH\$(MƉLLL$ E-HH"tHtHHH)HD;8HHl$MEMH lD`L|$Hl$LMH\$(LLL$ E-@HDHsHtHHH)Hf;HHl$MEvf.MDT$LL$ 裍DT$HI`H|$LL$ IM)(IUIyIqH|$AHIHLLHHI 8HDHuH|$*@CL.LHHLL)ȃLDIK .:~MEH \LDT$(LD$ LL$RrLD$ DT$(HIHLL$M)M7LLLD$LL$ DT$(LD$LL$ Ht$I@MHL)K<.IX 藢LD$I@(LD$_LD$DT$(HI(I@DT$LP0DT$E1HT$L؋T9HuLLLD$LL$ DT$(LD$LL$ Ht$I@MHL)KHr[M)L HCD|D8<tMt=CL.HHu-M)9DI),I);I) HDD|D8<HuLLLD$LL$ DT$(8CLD$LL$ Ht$I@MHL)K<.IX CfHD$M,DIE;}M9rHD$MH;tNHHoHs H;I1L:Hk 1[]A\DHs HKH)H9}H;u{4uC5 I$L#@un<t<DȉKID$HuID$HHC1Hk CHCz@H[DCID$0tfDATIUHSHHu H1YIH;{~HK HCH)L9CMHCJ|%INLLHL9sMHLfD0HHfrpfrpfrpfrI9wIIIBHlMH9vEH)1HfTfA@HH9u&Mu3CHK tL1HK []A\LHmhHK fD{4LHs:H;C5P Hу @tDsHPHHKLHHΎHK @DMHCJ|%INT LL9sJHL@0HHrprprprI9wIIIJlIMH9H)1HTAHH9ufCHP0uHPHLc 1HSCHCsiDAUL,HATLIUHHHSHHH:x4I9FH¨uH9wHH9HH#tA9T$rIL$ ID$H)H9}HIL$ I$p @ uaH@HtlH4I9v1@THH9uH1I\$ H[]A\A]fI9H'Hx0HH@HEǀuH<HH襌IL$ fDH4HI9v1DfTfFHH9uyHLjjfDAVIAUIATIUHS~ MMu M;l$AD$ @u<t<EȋULL)9r.Hu HEH)H9~ELRHLXErMfLRHLZH_Eu[LRHLXErfLRHLRHILRHaMMDofMMDDH)H5I H8{E1fKE1HJf.AUHATUH0dH%(HD$(1HL$HT$Ht$v~Hc|$ ;HHtlH|$HzIMt81LH6WHmIt\I,$u0ID$LP0#HmuHEHP0E1HD$(dH+%(u^H0L]A\A]HEHP0@H|$HtHT$ Ht$GUIRL%aI$?jfAVHLVHAUHLh0LXHATMUSHl$0HHH9}TH AAAA AAEHHH .t[tHIfDIJHHsHKIyHIIIIII$HHCHSH9Ht)M EH9+HcEPUI$[]A\A]A^@LIDLfE@LID *@E@LID Q @;II1MuHCHSH9EI<$hDHZMu`EH9CH H5I H8zx1+HHHZDHHHZfHH5I H8x1AWAVAUATUSHHt$ HT$0L$LavHLTHI $HQHI$Hu IT$LR0ILLHLD$EtH$ HHH$0H$(OIHLLLD$DLD$HI(]IPLR0NfDH$H|$;H|$$k1fH$dH+%(,H[]A\A]A^A_tH|$0H$ HH$0H$( OIHt*LLLD$=.DHsIHuLd$I $HD$HH?H|$HGP0.@LILILd$LLl$XLd$PL|$`H\$hLt$pHl$xtH끋|$@t$H`L$HE1HD$H@H;H;iH;@~H;L\$@MMLBHrLLML\$@IMH|$LL\$HLD$@D^LD$@L\$HHH|$HL\$XLD$PHD$@EfLD$PLL$@L\$XI(D$H|I)uIAL\$@LP0L\$@DHt$HHD$@HHuH|$L\$@HGP0L\$@MtI+u ICLP0|$HaD$H\$HH$HHHCHP0HH5/? H8q1H$@HZH$PH$HKIH?H|$0LGH|$0LD$X9LD$XHD$I(H|$HHD$@=xL\$@Ht$HHD$@HHI+ICLP0@HHJLBL\$@LHt$H|$L\$@D$HD$HI@LP0HI@L\$PLP0L\$PLL$@fT$@H5A 1fw   x,GЃ T1Hi6 HcH>|wXhw0@Y!HV6 HcH>@w jy3H7 HcH>T9H7 HcH>fD IHj8 HcH>FwH8 HcH>fv !wpo v0p wH: HcH>Pv fH> HcH>Dv 'w@_$d2`$3wHE HcH>Du , 0u 3wHHjR HcH>u ÁLc gt o21-wHR HcH>0u   Xv4wH7W HcH>Dt !15"/)LvYx1fXH e HcH>Dt t F+f!Hg HcH>Y 9Hg HcH>1Hg HcH>Yw@Ϩ ШwHg HcH>DHs //'Hpm HcH>fDFQ _^NLS@SAS  H,m HcH>fDlr fD wHl HcH> r x w@e f wHp HcH>Dq  dH$H 8 . Áwhw8`-Ht HcH>DHq IHv HcH> g Hv HcH>t. CwHv HcH>p n$#QY-a,H+ HcH>wQ.Ho HcH>DkQmQu18s[xu ÁiQ, Ák,2fRwH HcH>Po wTv4P+HG HcH>o On H HcH>X$v[ڨ X5z^)n f^wH HcH>@Pn ÁS[VfD,0> NxsQ^m P1N)@$mH2 HcH>akOkPkH HcH>9(Q'H HcH>PwH HcH>k  ajH HcH>w@,u'aVHӑ HcH>Dt'C  )&vambu00!H HcH>; ' v#u Á Z"Á Di @ #|i D!* f&t ÁYw;wHN HcH>i  y%fuHW HcH>dXh h h (`h Ph @h p ` X g g 0x Pp fpp  xX  Pp p x P X H(0   Xx@ H 8xp  xh(H( x@    XxhHPp؄ (  x h8p P ȃ 0h0 fH 0H P Xxf  Hh88Pxp 0` X  @`H@`0fp  [ X[  p[ ~ @[ 0[ ff8 fffffZ Z Z Z xZ XZ  8Z f Z P} P Px@xP Hh{ x f0H8z p XHpHXHhy X 0y p0HXPX(x  fXfXh8w  P`v p fPv ( fp  f(P`0u f @p@xt P Ht X@Pfps H f8p0@xr P fPr (  `x8 pq f Hq  p f8`p@p G%p  3 Oo ho  HfDo # Y@f'^f_nBY}n n 7m [1xO@nm cQ&%+l 0WF5$VE4#rDQ7k Mk2~ ffa> @~}74Hv;rYi -b7B =J 7 Lh/\:g wma6U~-S } fC C fhC } HC 8C (C C hB B B B B B B B B B B B |B sB jB aB  w4wDtLD9LD>H~HH)IHB L)ƉHË9҉>LLff.wrH 9H !  AHH ZAA@t;~:H=`HcHH s(uXtf1Љ@H9H>LD9LD>H~HH)IHB L)ƉHË9҉>LLff.wrH Y~H A  AHH zA@t<~;H=HcHH s)uYtf.1Љ@H9H>LD9LD>H~HH)IHB L)ƉHË9҉>LLff.wFH{}Hc BHH@@tPAu)fHH HHcHsuVtDfDH H~HHHLHLH)HH)r˃1҉փL 1L 79r볋 TT1w9H|Hx BHH@f 1w9H9|H( BHH\@f 1w5H{H؂ BHH @ff.1HtDH0HHufff.@SHHHCHH9tBHHHH9tdHC(HSHtHS0HP0HS0HtHB(HC(HC0HtH/tHC[DHGP0HCHK0HHC(HSHuf.HC1Hff.USHHHoHGHkH[]HHHtHtÐHGH;tH;t H; uH:DH>H0HtHuHGff.@ATIUHSHHf.6 zt^uU}H1Ƀ>HHtLHHMtFHLxGH1H[]A\@D$D$HtHHHHfDHGH; tH;tHH?~ H;=/uHH*H5[H81Hff.AWAVAUATUSH8dH%(HD$(1HD$ AAՉ˃oȃ߃X 1HH|$ HHHPG HWHoHHEE1A<-AAE)EsDAփ wHHMcE9XeLd$ ID$AT$ sID$HH9M9t$H|$ LLd$ MHD$ I,$ID$LP0Ld$ qHW0HoH@HEHWHHGHE1P0HH5H8*(HLH|$ IH/uHGP0HD$(dH+%(DH8L[]A\A]A^A_f.FH.f&HfADMcE9|F4)1DL$McHT$LL$ L$HT$HDL$IcL@ Hc1@LAL HH9uHI A)EE~#McHϾ0LD$LLD$HLMcM~1fDTHL9uHH|$ H/uHGLD$P0LD$Ld$ LŃXMHI4.@Jw HH9uifIL$0ID$H@HE|f.AIHuDr<-tpHH7E1HH=Z HH5E1H8H|$ H/E1E-H@LCSHHHtHCH;G|%HCH/t1[HGP01DO  u'HHt2t9<HtHC[DHw0HH@HEu<fDDL$4H$L$4yf* HH$ HHD$8H$|$xL$IH$rf.AHHЉD$0H$ 5HcHLT$8H)HIHI9H$KHAHD$8uA0@L$4 @L$4@L$4@L$4HK0HSH@HE4C H$ fDAgfDAPWfDApfDL$H$M MMPI?f.<%t1HALH)H$H$L9 Huƀ<%uH$LHH$HH$HD$`H9D$h} H|$pT$XtH|$PH/uHGP0HH$dH+%(H[]A\A]A^A_fD4HHOiH52H8(+~HD$@u,IFHD0]PIV0IH@HIDIV0IH@HIDDHYH$.HdH;IFH;AHHHt]IV0IH@HIDD0fD4BHD$hH9D$`Hf.D4H$IFHHjcH5 H8HPHKcH5z H811zH,cH5 H8KHII@LP0ff.@SHt1H ʉ t2t@tXHp0HPH@HE։[D@uKHPHf[f@tHp0HPH@HEֈ[HPHHPHHp0HPH@HEff.@AWAVAUATIHHUSH8LvddH%(HD$(1HD$ HD$HD$M9HLHHsx AL1A$0IHLm] LhHEID$E ID$(ʀID$0@ID$8 AD$ ID$@ID$HAHH?@HE@H|?I9OM}T$ IFHH2EID$HT$ t Ml$0ID$8t Ml$@I|$(E Iר HuHHmHEHP0fDHHmuHEHP0fDE1`HH M?HHD$P1LL$(LD$0?ZYtH|$ HHt$HT$Hu H.IHD$(dH+%(H8L[]A\A]A^A_DHM0HuH@HEDӵHmu HEHP0I,$7ID$LE1P0Du 1ҿHAAMDL%\Mt,I$Gf;I8Hm11H\IHuff.H(H=a\dH%(HD$H H$H( ) HD$HHHPHHHH=`; 1HH|$DIHIL H9uH=4HU6H=Q6ܬx}H=7̬xaHD$dH+%(uL1H(ÐHGP0]@11H`[HH'H=H=H=ЈH=H=`USHH=ZHtHZH/tFHRHH;HtHH/uHGP0HH9uH[]HGP0f.AUATUSHH/HtHEt H;>_tH[]A\A]fE uH="RHL%aHHI$Dh%I$H=Q@%_I$Dj%HtgHH9t*H;HHHH/uHGH@0H[]A\A]E HHUE RfD[HQHbH[]A\A]ff.SHHB t HB [HdH%(HD$1賰H$Ht HH$HT$dH+%(uH@H=PHt HG ufAWAVAUATUSHIHt H@uH[]A\A]A^A_DInE1E1H`HKHH81HE1!HLkIc L9IFJ{ y)C <tV<tʄtH= f.HuHL`HkH81vC <uIHLcc L9xH`MLHH81,I.u IFLP0H=eO`H=YOHt,HIOH/uHGH@0H[]A\A]A^A_H[]A\A]A^A_fHGE1HtL@L+GLAUATHLgMt3LoH=?QKHLH= HLA\1A]<@11/IHt/H=P HLH= HA\1A]H1A\A]ff.fSHG Hx tgH=WHtVHPH@HHHHHXHHuOHHPH]H2HpHvHpHHHJ[D1[@<H= 1[H= WATUHdH%(HD$HGtzHҺHHtzHH$H9GL$LHt2LHHIHD$dH+%(u6HL]A\fD軭E1fDE1fDE1fDH=5ff.UHH;HEH]H@f.SH tUH1HHHA1EtHCHH~HH[fDHa[HHHDHG Hu2SHHHH?~!H;=)[t"HC H[H`VH5HD$H:HD$ff.fHOHH9H ZHAH=_HP1fAUATUHHH?~jL-ZL9t^H5W4IHHMIT$HuQHHAHPHH=1IPf.HH=]1A\A]Zf.HMH=HINHAHP1-II,$u ID$LP0L]A\A]HMH99IELHPHH=]1A\A]زIELHP0HAHPfDHOH VH9t$H; [tHNH9tJH; ZtAl@HH?~ H;='YuHH"UH5S~H81H@HvH>~H;5XtBAVAUL-TATAUHSLwHM9t?LLL;5UZL;5;U„tuHSH[]A\A]A^@LuM9t'LLLL;5TL;5Z„ttH{H?~.H/XH9t"HuH>~H9t[D]A\A]A^;At2H9u2HVH[]A\A]A^fH)SH@H9uHTUH[]A\A]A^AWAVAUATE1USHHH5s H8dH%(HD$(1LL$LD$HD$<HT$HJHHKHL$H; /WHH,L|$H}Ll$ LLvL5'SL9uJ1H0IHt{HT$HD$ID$ ID$(IT$ID$0HHHMID$LLHHD$HHP0ID$(IT$0HP0HtLb(L`0HD$(dH+%(H8L[]A\A]A^A_fDHD$DID$HML9kIL$0HtLa(LefDHAQHQH5>}H81褲kHD$ H7ID$(Ld$ MI$,ff.UH=J~HHHdH%(HD$1EtAI1MH5@F HHT$dH+%(uH]D@HWHQH9t$H;VtHVH9tJH;VtA鼴@HH?~ H;=TuHHPH5yH81H@HvH>~H;5TthLGH QI9ttH VI9thLFI9I9t~HtLBI9tI9t fDHRH:~ H;TuHH PH5;yH81H@HH?~H;=StH ULFI9~HvH>~H;5SkHH?~H;=St $@HH}OH5xH8VHff.HWHOH9t$H;TtHVH9tJH;TtA@HH?~ H;=SuHHOH53xH81H@HvH>~H;5RtHHWHYOH9t$H;]TtHVH9tJH;KTtAl@HH?~ H;=wRuHHrNH5wH8K1H@HvH>~H;5?RtHWHNH9t$H;StHVH9tJH;StAl@HH?~ H;=QuHHMH5wH81H@HvH>~H;5QtHWH9NH9t$H;=StHVH9tJH;+StA<@HH?~ H;=WQuHHRMH5vH8+1H@HvH>~H;5QtHWHMH9t$H;RtHVH9tJH;RtA<@HH?~ H;=PuHHLH5uH81H@HvH>~H;5PtHWHMH9t$H;RtHVH9tJH; RtA̙@HH?~ H;=7PuHH2LH5cuH8 1H@HvH>~H;5OtxHWHLH9t$H;QtHVH9tJH;{QtA霜@HH?~ H;=OuHHKH5tH8{1H@HvH>~H;5oOtHLGHKI9ttH PI9thLFI9I9t~HtLBI9tI9t ffDHRH:~ H;NuHHJH5+tH81H@HH?~H;=NtH vPLFI9~HvH>~H;5NkHGH;9PtH; Kt!HH?~ H;=_NuHHZJH5sH831Hff.HGH;OtH;Jt鑦HH?~ H;=MuHHIH5+sH81Hff.HGH;yOtH;`Jt1HH?~ H;=MuHHIH5rH8s1Hff.HGH;OtH;Jt!HH?~ H;=?MuHH:IH5krH81Hff.HWHIH9t$H;NtHVH9tJH;NtẠ@HH?~ H;=LuHHHH5qH81H@HvH>~H;5LtxHWHIH9t$H;NtHVH9tJH; NtA̾@HH?~ H;=7LuHH2HH5cqH8 1H@HvH>~H;5KtxHWHHH9t$H;MtHVH9tJH;{MtAL@HH?~ H;=KuHHGH5pH8{1H@HvH>~H;5oKtHWHGH9t$H;LtHVH9tJH;LtAl@HH?~ H;=KuHHGH5CpH81H@HvH>~H;5JtHWHiGH9t$H;mLtHVH9tJH;[LtA@HH?~ H;=JuHHFH5oH8[1H@HvH>~H;5OJtHGH;KtH;FtqHH?~ H;=JuHH FH5;oH81Hff.HWHyFH9t$H;}KtHVH9tJH;kKtĄ@HH?~ H;=IuHHEH5nH8k1H@HvH>~H;5_ItxHWHEH9t$H;JtHVH9tJH;JtA@HH?~ H;=IuHHEH53nH81H@HvH>~H;5HtxHWHYEH9t$H;]JtHVH9tJH;KJtA@HH?~ H;=wHuHHrDH5mH8K1H@HvH>~H;5?Ht队HWHDH9t$H;ItHVH9tJH;ItA@HH?~ H;=GuHHCH5mH81H@HvH>~H;5Gt阸HWH9DH9t$H;=ItHVH9tJH;+ItAܨ@HH?~ H;=WGuHHRCH5lH8+1H@HvH>~H;5Gt鈨HWHCH9t$H;HtHVH9tJH;HtA霗@HH?~ H;=FuHHBH5kH81H@HvH>~H;5FtHLGHCI9ttH HI9thLFI9I9t~HtLBI9tI9t fDHRH:~ H;FuHHBH5KkH81H@HH?~H;=EtH GLFI9~HvH>~H;5EkHWHIBH9t$H;MGtHVH9tJH;;GtAl@HH?~ H;=gEuHHbAH5jH8;1H@HvH>~H;5/EtHWHAH9t$H;FtHVH9tJH;FtAl@HH?~ H;=DuHH@H5jH81H@HvH>~H;5DtHWH)AH9t$H;-FtHVH9tJH;FtA<@HH?~ H;=GDuHHB@H5siH81H@HvH>~H;5DtHWH@H9t$H;EtHVH9tJH;EtA<@HH?~ H;=CuHH?H5hH81H@HvH>~H;5CtHWH @H9t$H; EtHVH9tJH;DtAL@HH?~ H;='CuHH"?H5ShH81H@HvH>~H;5BtHBHAHHHHHt1DLGMtHGI(t1fHI@LP01Hff.2HH?~H;=;Bt 鴕@HH->H5^gH8Hff.HH?~H;=At $@HH=H5gH8HHf.UHHt謓HH]ff.HH?~H;=kAt @HH]=H5fH86Hff.HWH=H9t$H;BtHVH9tJH;BtA@HH?~ H;=@uHH<H5fH81H@HvH>~H;5@t阙HH?~H;=@tHt4鯰HHu<H5eH8NH@{ff.HH?~H;=+@t $@HH<H5NeH81Hff.@HH?~H;=?t t@HH;H5dH81Hff.@HGH;IAtH;0<t1H5%1vfDHH?~ H;=_?uHHZ;H5dH831Hff.ATH1HUH5j#HHt9HH聒HmAtHD]A\@HEHP0HD]A\Aff.AWAVAUATUSH(HWdH%(HD$1HHzL,HLt$HL|$I}LL׳HH;W>H=r:襩IHH@ HHhH@(H@0HHXI]LLHkHD$HHP0ID$(IT$0HP0HtLb(L`0@Ld$Mt6I$HD$dH+%(H(L[]A\A]A^A_E1H=9ܨHHtHkHHC HC(HC0HC(ImLLH覲Ld$Mt|H+dHCHP0UHa8HRH5^dE1H813@HD$HID$(I\$0HtLc(Mef.HC(Hk0HtH](I]If.AWAVAUATUSH(HWdH%(HD$1HHL,HL|$HLt$I}LL藱HH;<H=28eIHH@ HHhH@(H@0HHXHuHn=ID$ImLLHHD$H1HP0ID$(IT$0HP0HtLb(L`0Ld$MtFI$HD$dH+%(7H(L[]A\A]A^A_H7v@E1H=A7tHHtHC HHkHC(HC0HCHL%<LcImLLH#LLd$MH+2HP0'DH5HRH5aE1H819@HD$HID$(Il$0HtLe(MefL%6[@HD$I衺USHHtQHoH56HH9t$H֬H;-;H;-}6„ttHCH8H9H[]f\H=gH1[]fDUH1H1H]Ht H(Ht]DH@]H@0DH]/ff.@AWAVAUATUSH8dH%(HD$(1HHGHHL'MHL3MTI~LHT$Ht$HH|$ H$跲HEH,$H|-?HD$HHXE1IH:DHHEI/IHEHIŬIEH9$tfILMv0HEH}HH/uHGP0DHD$(dH+%(=H8~H=e[]A\A]A^A_DIHsHtH;DID$HM9uHT$HH$HHu H|$HGP0HT$Ht$H|$ qHD$(dH+%(H8[]A\A]A^A_fDInIFLīHtI>QHmuHEHP0fDL蘫L3MtI~;L}L3Mp"@HL]HT$Ht$H|$ T>Zf.ATIUSHH=5tHR0H8H7HH@HxtrH5O5H'HHtVHLH0tHf|.t@H <2pvt@h<2y^DQS@LБLYHu1LeHHIrLY=LoI/HuHD$IGLP0HT$HWI@f|A.H<t9fH<2pt9f<2yf|9sDApfI/IGLP0IATHMt3LHHt/H(AtDA\ÐH@P0DA\HLAff.AUIATIHUnHt?H1LLHqHmAtD]A\A]fDHEHP0D]A\A]Aff.ffATHH HUHWSH0dH%(HD$(1HD$HD$HD$HD$PHD$P1LL$(LD$0ȁZYH'Ld$ Hl$H3LH3t1HH;-Hv[Hl$#@Il$Hv;Hl$HtQHL$HT$HH|$ HT$(dH+%(u>H0[]A\ÐHEH5mLHPHH81Py1@H9H(AUHH `HATHwVUH`dH%(HD$X1HD$ HD$8HD$0HD$(HD$ PHD$0PHD$@PHD$PPHD$ATUSHHHyIHHH5^LLSHSHjHH5LLSx_HHcHH5LL`Sx8H HL[]A\A]Hmu HEHP0HHE1[L]A\A]HHtHXHL-G LH81LHH H]H8LHCH H]H8H5*+HCH\HRH]H8LHCHP H]H8HC HEHP(H8HH9uH-HqfD諮HHH~H= TaHHH~@H5U IDEfDAWAVIAUATIUSHH5H8HdH%(HD$(1rIH9HAH}HSHH9HD$ 1J@HD$ HLHT軑HmAu HEHP0Ex.HD$ HpHt$ H;s LRHHuAImuvIELP0jE1MtE1HD$Hl$HD$ HD$H\$ fDHT$Ht$LADžxHL$HHL4iuMHD$(dH+%(H8D[]A\A]A^A_Ð;1H{L d H s ~DIT$IH] H5?AH8HR1kM"fE1M hL r H (IHtHHr L d HDff.@ATH5USHpHtLHsHH1H=HHmItL[]A\f.HEHP0L[]A\fDHQH8Int%HsH=yH[1]A\銋f.E1ff.AUIHcATIUSHHUHtgHŅt*I<$^HtKHEuI|$]Ht3HE HH5eL荆Hmt)H[]A\A]fDHmt11H[]A\A]@HUD$ HR0D$ H[]A\A]HEHP01f.UHSHHH H9GtCH;= u1H]1H[]HH5<H8袜H[]fDH;= tHH\NxHHEAVAUATUHD% EtAHD]A\A]A^L-)LQVx1L5还HHtHH5c L5NHH5FLNHmu HEHP0H=11LH0 HH]11LH5 HpH=FlH HH5 H9H=E=H HH5 HH=EHw HH5 HH=EH@ HH=11LH HHjH5mQH5HH=HEqHH"H5HH=EBHHH5H?H=DHTHH5\HH=DHHH5-HH=DHHfH5HH=DHH7H5HCH=QDWHxHH5HH=,D(HAHH5qHH= DH HH5BHVH=CHH{H5HH=CHHLH5HH=ElHeHH5HiH=_C=H.HH5H*H=+CHHH5WHH=CHHH5(HH=BHHaH5HMH=BHRH2H5HH=BRHHH5HH=bB#HHH5lHH=>BHHH5=HYH=BHvHvH5H"H=AH?HGH511H=AoHH H511H=AHHHH511H=A!HHH=11LHHHH5OH5[HH=&AH4HdH5,HH=@HH5H5HH=@UHHH5HRH=@&HHH5HH=@HXHH5pHH=a H!HyH5AHH=.@HHJH5HFH=@jHHH5HH=?;H|HH5HH=? HEHH5HyH=?HHH5VHBH=n?HH_H5'H H=E?HH0H5HH=?PHiHH5HH=>!H2HH5H>H=>HHH5kHH=yHHtH5<HH=yHHEH5 HH=H>eHVHH5HBH=(>6HHH5H H=yHHH5HH==HHH5Q11H= HHbH5*HvH==HKH3H5H/H=\=SHHH5HH=7=$HHH5HH==HHH5nHbH=i>HoHwH5?H#H=<H8HHH5HH=<hHHH=|<11LEHHH11iH5H=R<11 HHH11^CHoHH5oH=<11H@HHu11CHH\H5,H=;11HHH211BHHH5H=;11AHHH11BHvHH5H=K;11HGHH11RBH#HH5cH=;11HHHi11BHHPH=}11L|HHH*11H5HH=:9HZHH5RH^H=b: H#HH5#H'H=<:HHH=&:11LHHHf11UH5H=:11}H~HH+11@HZHH5ZH=911:H+HH11@HHH=&11LHHH11H5H=}911HHHn11@HuHUH5uH=?911}HFHH+11?H"HH52H=811:HHH11?HHH5H=i811HHH11K?H|HH5H=]811HMHHb11?H)HIH5iH=711qHHH11>HHH5&H=711.HHH11>HHH5H=m711HTHH11?>H0HH5H=1711HHHV11=HH=H5]H=611eHHH11=HHH5H=611"H[HH11v=H7HH5H=|611HHH113=HHtH5H=@611HHHJ11H5H=411HHH113;HtHtH5tH=h411HEHHJ11:H!H1H51H=+411YHHH11:HHH5H=311HHH11j:H{HH5H=311HLHH11':H(HhH5hH=l311HHH>119HH%H5%H=-311MHHH119HHH5H=211 HSHH11^9H/HH5H=211HHHu119HH\H5\H=m211HHH2118HHH=nHeL=HVHH11aH=111LHHHH5"H5HH=1HHlH= HXLHHH>11-H="2HLQHJHHH5mH=6mHL HHH11.H=0HCLHHHy11hH=0HLHmHH:11)AHmHEHP0fDSHH;UHt HX[f.SHH UHt HX[f.SHHt#HTHt HX[DHH5 #H8节1[fDSHHTHt HX[f.AWAVAUATUSHHHHt]HH|$H8IIME/THt%T$@HXHhLpLx Lh(D`0P4H[]A\A]A^A_fDHIH5"H8躁1fDH)H5B"H8蚁1fDAWAVAUATUSHHHHt]HH|$H8IIMEoSHt%T$@HXHhLpLx Lh(D`0P4H[]A\A]A^A_fDHH5""H81fDHiH5!H8ڀ1fDAWAVAUATUSHHtYHH|$HI8IIMDRHt$T$@HXLhLpLx L`(h0P4H[]A\A]A^A_HH5!H8J1fDATIHU8SDRHtL`h0X4[]A\f.ATIHU8SRHtL`h0X4[]A\f.AUATUSHHt=IHLǾ8AՉQHtL`HXDh0h4H[]A\A]HH5 H8Z1fDAVAUATUSHHtBIHtZLϾ8AE7QHtHXhL`Dp0Dh4[]A\A]A^HiH5 H8~1fDHIH5 H8~1fDH)H5B H8~1fDAWAVAUATUSHHtyHHtQHH|$@8IAEEsPHtHXHhLpDx Dh0D`4H[]A\A]A^A_ÐHH5R H8 ~1fDHyH5 H8}1fDAWAVAUATUSHHtyHHtQHH|$@8IIEEOHt HXHhLpLx Dh0D`4H[]A\A]A^A_ÐHH5H8Z}1fDHH5H8:}1fDAWAVAUATUSHHtyHHtQHH|$@8IIEEOHt HXHhLpLx Dh0D`4H[]A\A]A^A_ÐH9H5H8|1fDHH5JH8|1fDAVAUATUSHHtDILϾ8IADsNHt HXL`LhDp0h4[]A\A]A^@HH5"H8|1ff.AVAUATUSHHtDILϾ8IADMHt HXL`LhDp0h4[]A\A]A^@H!H5(H8{1ff.AUILATI8USH{MHt LhL`h0X4H[]A\A]AUILATI8USH+MHtLhL`h0X4H[]A\A]AUILATI8USHLHtLhL`h0X4H[]A\A]AWIAVI8AUIATIUDSDHH|$@}LHtLxLpLhL` h0X4H[]A\A]A^A_ff.fAUATUSHHHt:ILǾ8AՉLHtHXL`Dh0h4H[]A\A]HIH5H8y1fDATIHU8SKHtL`h0X4[]A\f.AVILAUI8ATAUSDiKHtLpLhD`h0X4[]A\A]A^ATIHU8S$KHtL`h0X4[]A\f.ATIHU8SJHtL`h0X4[]A\f.ATUSHHt0AHϾ8JHtHXD`0h4[]A\HH5H8Jx1fDU8SHHEJHt X0h4H[]ff.fU8SHHJHt X0h4H[]ff.fU8SHHIHt X0h4H[]ff.fAUATUSHtHtHXHhD`Dp Dh$[]A\A]A^fDHH5H8Rl[1]A\A]A^HH5BH8*l1fDHH5JH8 l1fDAVAUATUSHHt|HHAԅtALϾ(AE=HtHXHhD`Dp Dh$[]A\A]A^fDHH5bH8k[1]A\A]A^HH5H8Zk1fDHH5H8:k1fDAUATUSHHHtjtILǾ(AՉ;HtL`XDh h$H[]A\A]HH5H8iH1[]A\A]ff.fAUATUSHt>ILǾ(AՉg;HtL`XDh h$H[]A\A]HH5H8 iH1[]A\A]ff.fATIHUH SH:HtL`HhHX[]A\fDSHH :Ht HX[f.SHHt#H :Ht HX[DHH5H8:h1[fDAUATUSHHHtZHHt2LǾ IA:HtHHhLhD`H[]A\A]HYH5H8g1fDH9H5H8g1fDAVILAUI(ATIUSD9HtLpLhL`h X$[]A\A]A^AWIAVI0AUIATIULSLHH|$@=9HtL8LpLhL`Hh HX(H[]A\A]A^A_fAUATUSHHHt:ILǾAՉ8HtHL`DhhH[]A\A]HH55H8f1fDUSHHt)HHH׾~8HtH(HXH[]HH5rH82f1ff.USHHHt&HH׾8HtHHhH[]HaH5:H8e1ff.USHHHt&HH׾7HtHHhH[]HH5H8re1f.@AT11USHH=>HH+IHHEHH5LJNt}Hmt>HkHtHHEHH5LNtQHmt2L[]A\f.HEHP0HkHuH-@HEHP0L[]A\fDHmtAI,$t"E1L[]A\H-;@ID$LE1P0HEHP0I,$uff.fwwHHcH>HAH@HH@HaH@HAH@H!H@HHHHyH5H81x01HÐ HPHcH>@HH@H1H@HH@HH@HH@HH@HH@HqH@HQH@H1H@HH@HH@HHHHiH5H81h/1HÐAWAVAUATUSHHt%?HH`HcH>fDL%QI$HL[]A\A]A^A_f.H=11IHL{MoM/LkHHzMbE1fHUJIM9FK|1Hu@Hm7HEHP0(fDH=)11IHlL{MM/LjHHME1f.HUJIM9K|Hu_H=11`IHHkHqHEHH5LI7Hmu HEHP0{nHH,HH5LIHmu HEHP0Hc{ VHHHH5pLhI@Hmu HEHP0Hc{$UHHHH5лL(IHmHEHP0fDH=110IHH{+HHt=HH5LHHmuHEHP0MfI,$[ID$LE1P0 H=11IH$H{HHtHH5YL1HxHmu HEHP0H{>HHlHH5xLG7Hmu HEHP0{nHH'DH=I11IHlH{HHHH5LuGHmu HEHP0HkHrHEHH5߶L7GGyfH=11PIHHkHHEHH5LF7"fH=11IHL{M M/LfHHM E1fHUJIM9 K|HuH=11IH0@E1H=11PIHtHkH HEHH5LE;&fDH=11IHufDH=Q11IH_H=I11IHH=11 IH4H{HHHH5L=?Hmu HEHP0H{jHHxHH5$L>CHmu HEHP0LkMUMuL^HH'MGE1*7HHUJIM9K|HuHTHfDH=11IHL{M^M/L4^HHMQE1f.HUJIM9-K|AHuH=11IHH{ HHHH5L=Hmu HEHP0LkMMuLj]HHME1#6HjHUJIM9K|HuHHfDH=Y11@IHH{;HHIHH5uL<Hmu HEHP0{HH HH55L<Hmu HEHP0H{HHHH5ԭLL<fDH=i11hIHH{cHHqHH5ݰL;fDL%I$HHL[]A\A]A^A_f.H=Q11 IH@Hc{0W7IHTLH5L*I/u IGLP0Hc{47IH HH5Lj*BI/LIGLP0=fH=11pIHT@E1 H=11@IHtHkHLmLIIHlMIO1fHHHI9HDHuHzH=!11IHTL{MILH5yLQ)I/u IGLP0HkHMLmLIIHM?E1(DkHIWJIM9J|HuHHfDH=Y11IHHkHLmLHIHM~E1$H)IWJIM9UJ|HuHHfDH=٬11`IHLsMlI.HGIHH_E1fIWJIL9CK|qHuI/KIGLP0<H=Q11IHdH{IHHH5řL]'I/u IGLP0H{IHHH5eL'@I/6IGLP0'H=11 IHHkH"LmLFIHHME1$KH'IWJIM9 J|HuHLHfDH=!11IH$HkH| LmL+FIHMn E1$HIWJIM9E J|HuHHfDH=I11IHH{IHtIHHE E1f.IWJIL9! K|HuI/IGLP0|H=11IHH{ IHHHH5eLI/u IGLP0H{IHHH5L]I/u IGLP0LsMlI.H,=IHH_E1fIWJIL9CK|HuI/{IGLP0lH=11IHH{IH8HH5ULI/u IGLP0H{IHHH5LMI/u IGLP0LsMI.HH='11~HH+I}yIHLHH5H dI,$u ID$LP0MeM I$LH54H%I,$u ID$LP0IuHHHt$(HI5IHLME1Ll$0MHl$8MHl$(I@IUJIM9J|HuImLd$IuIEH\$LP0LD$I(u I@LP0I/IGLP0MILd$I.uIFLD$LP0LD$Mu@Ld$IfDHyH 14IHLH5LkI/u IGLP0HkH~LmL94IHMpE1*HIWJIM9AJ|HuHĚH13IHdLH5L0I/u IGLP0Hc{' IH$HH5ALy`I/IGLP0I/IGLP0I/IGLP0I/IGLP0Ld$12IHLH5LOI/u IGLP0LsMt_I.H2IH8H~ZE1DIWJIL9t?K|%HuI/IGLP01P2IH@LH56L.Ld$H\$ LH5,L{I/u IGLP0LsMcI.H1IH`HVE1fIWJIL93K|AHuI/IGLP0 1l1IHLH5VLNI/u IGLP0LsMjI.H1IHHE1IWJIL9K|HuI/kIGLP0\L=10IH=LH5L I/u IGLP0Ls MI.Ha0IHH~TE1IWJIL9t;K|}HuI/IGLP010IHLH5LaI/u IGLP0H{(IHUHH5RL1/IH"LH5LwI/u IGLP0Ls MBI.HF/IHH5E1@IWJIL9K|YHuI/IGLP0L=ĕHL=L=`1.IHMLH5 LI/u IGLP0Ls MaI.Hq.IHHTE1IWJIL93K|HuI/IGLP01 .IH1-IHy1-IHuZLd$ILIMWLIM,MILd$I.yMHl$8Ll$0LH5mHe tI,$EID$LP05I/IGLP01%-IHLH5L ~I/u IGLP0Ls MqI.H,IHcHE1@IWJIL9cK|IHuI/#IGLP01t,IHLH5^LV I/u IGLP0Ls M I.H%,IHHE1IWJIL9K|HuI/sIGLP0d1+IHQLH5L I/u IGLP0Ls MI.Hu+IHH E1IWJIL9K|HuI/IGLP01+IHLH5L mI/u IGLP0Ls(MI.H*IHRHE1IWJIL9K|پHuI/IGLP01d*IH`1I*IH'L% A1*IHLH5|L q1)IHwLH5~L >1)IHk?fD1)IH!1)IH5 1i)IHAVAUATUSH謃H+1H=I118IH|LsMM.L(HHtIM1HUHHI9lI|IHuHmu HEHP0I,$u ID$LP0E1[L]A\A]A^ÐuH=11IHtLsMVM.L+(HHtM1fDHUHHI9I|HuSH=)11IHTLsMM.L'HHM~d1HUHHI9tHI|%HuH=11IHH{蓻HHHH5-|L%HmHEHP0fL%ٍI$L[]A\A]A^1&HHuIff.AW11AVAUATUSHHH=HH;IۺHHHH55zLmHmu HEHP0H{蚺HHt}HH5xyL0t_HmL{MM/L&HHt;ME1fHUJIM9K|!HuHmt5I,$tE1HL[]A\A]A^A_fID$LP0HEHP0I,$uDHEHP0L{MN1Z%HHtHH5(tL@kHmu HEHP0Hc{HHLHH5sL*Hm0HEHP0!ff.H;=AUATIUtSH5xHI9tLLH]A\A]ifHH5j H8J]A\A]H1]A\A]fH;=%AUATIUtSH54xHItLLH]A\A]'fHAH5 H8]A\A]H1]A\A]fUH3~tHH5f]_ ]ÐAWAVAUATUSHH8dH%(HD$(1H;=TH5_HI 3[H54HAăL%!rHLNLHSIHH@MfLLHD$H1L|$ M~9IFLLH< uvM9f:HD$ HL$HDHI9uI.u IFLP0H|$LE1HHA>HPH}H5 H81@I.u IFLP0AHD$(dH+%(H8D[]A\A]A^A_@L%IqHLnTVHD$ L%qHLKTHD$L%pHL(THD$1Ht$H|$ LE1#HHJ?HE1/fH5!HL59uHLnLHKIHH;ȇH5tHcHt$ LLk$I.u IFLP0H|$ LHHpeDLHIHIH;B\H5UtHeHt$ LL#I.VIFLP0G@LHUIHH;҆H5sHmHt$LLu#I. IFLP0@LHIHiH;b H5usHHt$LL#I.u IFLP0HT$HaHH57 AH81f.HD$ fHD$%fHH5 H8DHH5j AH8tHɀH5r AH8L]HD$H+H5 H8HD$ @AWAVAUL-qATILUHSHH8dH%(HD$(1LH3IHH;:H5qHK{Ht$HLS!yI.L-pHLLHIHNH;9H5LqHHt$HL I.L-kHLLHEIHH@MnHLHD$HE1MZfDH5pH<$(t\H<$Ht$ H3 u]M;nHD$ HL$JDIM9JIFJHjH5 H HjH5 HHSjH5u HH%jH5Z HƱHiH5@ H許xHiH5% H花ZHiH5 Hl<HmiH5 HNH?iH5۫ H0HiH5 HHhH5R HHhH5 HְHhH5t H踰HqhH5 H蚰xnHOhH5 H耰xTH-hH5F Hfx:H hH5 HLx HgH5 H2y fDE1HL]A\f.AWAVAUATIUHSHcHhdH%(HD$XHI HD$ HP HD$(H8 HD$0HkHD$@HkHD$HHkHD$P`RHt@H%<\H;-=m'H5kH/L-0[HL=HLbHHH@5LmLLIH1L=YMT7LH|$CtWH|$Ht$LJuWL;m?HD$IDHI9HEHbItXAątE1D[A\A]H5bLt(t8D[A\A]ÐH5aLuDA[DA\A]DH5aLAătՅtE1{tefH59aLAăttE13H5aLXct  H5`L1VLLIHH@M~LL菞HD$HM~|HD$@1HD$(IFHLDT$H1HL޶IHH@DT$}INLDT$HHL$sHHHL$DT$E1Ht$@NIFLDT$HL$J:LHHL谲IHHt$8LHI.u IFLP0H-E=LH誨zHLWIHXHt$0LHA…I.uD$IFLP0DT$H-9LDT$H@HLIHH@DT$@INLDT$HHL$肐IHHL$DT$1Ht$@NIFLDT$HL$HeL;5?tNLL聁ILI.u IFLP0T$LDHE1HHA1H:H5| H8DAH5*<L H-b,LHǗHLtIHHt$@LH踳A…I.uD$IFLP0DT$H-'LDT$H] DT$D$0H-q'LDT$H1 DT$=HD$8DD$HT$8MDt$0H|$@DT$DT$HHAH}9H5f H8AH<H5 H8HA9H5 H8AeHPH9H5 H81胚H8H5 H8A#Hv<H5 H8gMH8H5 H8LAHPH8H5 H81 H8H5b H8 AH;H5 H8HPHA8H5 H81訙H$8H5 H8AHH;H5 H8rH;H5 H8qWI.u IFLP0T$LDH*E1HHAHPH7H5^ H81H;H5ن H8I.u IFLP0L$MDLH'E1HHAkHPH"7H5K H81艘H7H5 H8A)H|:H5 H8mSHPH6H5 H81,2H6H5 H81AH58LbH-%LH贓'HLaIHuH@INLHHL$|HHHL$E1Ht$@L9~xIFLHL$Ht$Ju IFLP0T$LDLE1HHAH1H5/ H8GAH52L H-e#LHʎwHLwIHHt$@LH軪I.u IFLP0H-LHqHLIHHt$8LH(eI.u IFLP0H-LHHLŗIHteHt$0H0e A…I.uD$IFLP0DT$DD$T$0MDHt$8H|$@DT$ɀDT$HH~AsH.0H5/ H8ARH 0H5މ H8A1H/H5 H8uAH5#1L;H-!LHwHL襖IHHt$@LHI.u IFLP0H-LH蟌HLLIHHt$8LH@I.u IFLP0H-LHFHLIHteHt$0H^c A…>I.uD$IFLP0DT$DD$T$0MDHt$8H|$@DT$藹DT$HHAH\.H5 H8AH;.H5 H8A_H.H5K H8A>H5I/Li .H-LH&HLӔIHHt$@LHI.u IFLP0H-LH͊t}HL~IHt_Ht$8Ha A…I.uD$IFLP0DT$L$t$8MDH|$@DT$hDT$HH=A2H,H5އ H8vAH,H5 H8UAH5-L.H-LH؉HL腓IHHt$@LH#I.u IFLP0H-:LHt}HL0IHt_Ht$8H` A…{I.uD$IFLP0DT$L$t$8MDH|$@DT$zDT$HHAH+H5 H8(AH~+H5 H8AH5,LͮH-LH芈HL7IHsH@MNLLLL$pHHeLL$1Ht$@I9IFLLL$HL$H~ H81>H#H5a~ H8#I.u IFLP0L55 H|$LHD$0H\$L5 LH`|LH IHH@I^HHdIHH HU#1HD$(ZH5eLHL${Ht$@HLHL$:I;^HD$@IDHH9IFL$L;d$(uHD$@H)H5~ H8貲H|$L IHH5] HE{Ht$0HLI.IFLP0H@!H5Q} H81cI.u IFLP0PLMUHT$ LD$@Ht$HH|$HT$0H1ZY,HPHGH5| H81~fAWAVAUATIUHSHHHt$HdH%(H$1HIH@L D$,I.u IFLP0L- HLyLH藃IHvH@L袬D$UI.u IFLP0H5&H覟(L->HLcyLHIHH$LHI.u IFLP0L-HLyLH贂IHLHx" H$LLBADžRI.u IFLP0L-HLx' LHBIH!H@ IFLHHD$ `HD$HH|$ H$Hl$81L-qHD$(Hl$ D|$0IIFJH5jH L-"HLoLHtyIHSH@ M~LLXHHMo L-H$1Ld$ HD$(LMLl$IIHQHL7oHT$ Ht$(L=M;wS H$IDHI9 IGL$L;d$uHDŽ$HuH5u AH8dHTH5^ H8ݥ3H9H5s AH8輥(HDŽ$HH5(r AH8芥HH5V H8oHH5tV H8TH5xH 6L-8HLmLHwIHiH@ M~LL.VHD$H+M 1H$Hl$(L-HD$ HXHH|$0ZmOHt$ H|$0L`M;~9 H$HL$HDHI9u IFHLHpIHH$LH)I.u IFLP0L-HLfLHpIHkH$LH͂@I.u IFLP0L-HL#HDŽ$L-8HL]f?LH pIHHt$|H ADžI.u IFLP0SAT$DL$$DD$ H$H$H$蕦HL$H]A\HwHmH5Fj AH8\H5 H輋> L-HLyeLH&oIHH$LHgI.u IFLP0L-HLeDLHnIHH$LH ADž{I.u IFLP0L-9HLd LHknIHJH@MFLLLD$ MIH Hl$Hl$ 1H$H9IFLHHL$ H<I;nHL$ rH$IDHLd$ MLI.u IFLP0T$t$LHA[HL$E1HAH{Hl$8I.u IFLP0L-HLHDŽ$ATD$PHL$8DL$ L$HT$(H$H$iHL$H^_HHPHH52g H81HgHH5i AH8GHPHH5m H81g|ItHzH5m AH8iHH5jl MH8ߙ5Hl$(I.u IFLP0L-HLsbLH lIHH$LHa~ADžI.u IFLP0L$T$MH$H|$9JHL$HHHH5i AH8HPHoH5Pi H81eLHH5ki H8ۘ1H7H5Pl AH8躘&HH5l AH8虘H$L[HH5Ql AH8[HH5l AH8:H.H5Gk H8uLHjIHnH$LH|CI.IFLP0HH5h H8蹗I.Hl$(u IFLP0L5HLM`LHiIHH@?MFLLLD$0HHD|$(H\$0M1MH$I@IFLHHL$0H<{\I;^HL$0H$IDHH9I.LMMD|$(u IFLP0ATD$LIPHL$0DL$ Ht$(H$_HL$HA]A^HHPHH5Yg H81?cHH5g AH8>H2H5g H8#yHPH{H5g H81bXH^H5g AH8MHPH9H5zd H81bHH5b H8襕MLH hIHH$LHNzI.IFLP0HH5i AH81H%H5d H8lHrH5j AH8aHH5Jj H8ڔ0I.Hl$u IFLP0L5HLn]LHgIHH@9InLHEHD|$1MH$MIH9IFLHt$ Hi AH8tH5 HԁVL-HL[LH>eIHH$LHwI.u IFLP0L-HL5[LHdIHH$LH#wADžI.u IFLP0L-QHLZLHdIHbH@MFLLLD$ "CIH!Hl$Hl$ 1H$H9IFLHHL$ HHD|$1MH$MIH9IFLHHL$ HHDH5Ec AH8Lj3H5HwxL-KHLPQ=LHZIHH@gM~LL9IHH$Hl$1H6IFLHH<~zqM;~H$IDHI9I.Hl$u IFLP0L5 HLP[LHIFLP0/H"H5C^ H8iI.Hl$u IFLP0L5BHLI2LHTSIH3H@.IFLHHD$01HD$8HH$Hl$`MHD$HD$XHL$H9L$0"IGHL$H,HcHD$HH9HHHHHRIHH@uL{D$PMI.u IFLP0LHH LHGRIHjH@LR{D$TRI.u IFLP0H5HVntH5HHDŽ$H5HNHDŽ$H5HHGH51HyQIHH@InLH0HD$@H1L|$ MMIHI9IGHLHHIHH$LH[I.~IFLP0oH H5W H8uTHPHVH5V H81B3H9H5W AH8u(H5xHd UL-HLE HDŽ$L-HL>9LHGIHH@INLHHL$(k&HD$HhHl$ 1Hl$(L$;IFLLHHH5T AH8qH5<Hd`L-HL!:tsLHCIHH$LHVADžI.u IFLP0T$t$LH$QHL$HH`UHKH54T AH8p:H5jH_t$|$LUsHPHH5Q H81X=LHBIHH$LHYI.IFLP0LHBIH|H$H1 TI.rIFLP0cHH5R H8o H5^H^tt$|$LWsH5%He^tt$|$LVBHHH5R AH81"HI$tZHI$u ID$LP01H]A\I,$uIT$D$ LR0D$ HmD$ uHUHR0D$ HI$u ID$LP0H]A\fDAUL-U ATL%NU USHHP1IcL>C9MDRH U HcH>fDC9uH[E11IcHtHH9H|H_A1IcHuC9uH[HC9eH{ H{E1AH[D]A\A]C9H[@C9DAHD[]A\A]ÃhIcDL>H{7cHE1[D]A\A]fDH[11HcHtHH9}H|H(t1HcHuDH{tH[H4@HCH H9HHH5vR E1H8kDHCH@H;H;O„H;UHH5 R E1H86kH{RHkE11IcHtHUH9H|H~A1IcHu@HkHHEHHSHH;E11HH|H +AIcH;U||H{AąHCH5O H@HPHH816H{H+vfDH{H{ H{HCH H9H#H H5P E1H8i DH[11HcHtHH9H|H 1HcHuDHkHCHOHM1HtHH9HHH5jM E1H8hpfH{H{H{H{cH[HS11H;EH|H&HcH;|DH{if.H[tH g H8P HcH>HF HqH5K E1H814VH H  H  H H H H  vH  jH  ^H  RfHH5K E1H8WgHD[]A\A]fH[E11IcHtHH9H|HtBA1IcHuHH5M H8f1HDE1#H|HteAIc1HtHUH9|H[11HcHtHH9H|H1HcHufHH5RJ E1H8'ffHH5L E1H8ffHyH5J E1H8e`Hk1(f.HDHxvHc1HtHUH9|wtHM HcH>H HH5I E1H81B2H H H Hw HK 5H K HK AUATUSHHH?IAI\H;H{H[11HcHtHH9}0H|HtNtV1HcHuH9|fDAIcI;EwH[]A\A]HH5jH H8"dH1[]A\A]DHH5 I H8cH1[]A\A]ff.fUSHHtwt"HH5J H8c1H[]HHttH{HttH{H말HH[]l@HGHtH8u9HH n HK H53J H81/H1[]f.11HcHt@HH9}(H|HC1HcHuH[]@ATIUS1H/%fHDHxHt Hc1HtHUH9|ID$HtHxHtmIl$1'@HDHxHt@Hc1HtHUH9|ID$ HtHxHt}I\$(I$HH 1HtHH9ID$IT$HtMH1HtHH9tDHH5F H8na[1]A\HH5E H8Qa1[]A\1Huf11HcHtHH9}QH|HtHtă1HcHu1HIPHnH5F H8`1Il$1!fH|HtdHc1HtHUH9|θF@AWAVAUL-H ATE1UHSHDIc1HtHUH9H\H;TIcDL>DH{RtNALsMt I>H H HaH5G H81,1H[]A\A]A^A_HCHtH8uH HfHCHt H8_H HDCHCHt H8,H } HPOHCHt H8H I H#"f.H{"H{HAd@H{HuH{H5H5~D H8^1HCHt H8H H* fH{Ht H?H ~ aHCHt H8H S H* Bf.H[Ht H;H  H f.H{ H{H{Ht H?sH  DH{Ht H?eH X H{ Ht H?H D t@H{zH{Ht H?H B >fDH{HAfH{Ht H?EH  fDH @H{H{H{H{Ht H?H fDH{H{H{Ht H? H K MDH{?t S JBH{Ht/'H{HH5BC H8[H1[]A\A]A^A_H[]A\A]A^A_@H!H5A H8[DLsE11IcMtIH9wI|HwvnA1IcMufDKH{r:Ls E11IcMtIH9I|HA1IcMuD#H{Ls E11IcMtIH9-I|HA1IcMuDkHCHtH8u3HS HH:HHSHt H:E1fDIc1HtHH9RL|IHtIHt H?H  E1@L|I?IHtHCAIc1HtHH9|H{Ht H?H ? 2fAH|Ht,+#AIcH;H|HuHRH5 = H8XH1[]A\A]A^A_fE1@L|I?IHtHCAIc1HtHH9|H{Ht H?H \ Jf.A(I|H87/AIcI;|fDS HCAfDHAH5? H8W1H{oH{ Hu|H{HTH?J=HH5@= H8@W1kH8#1f.HH5< H8 W15H?zdmL{E1%fDIDHxAIc1MtIH9|H[(E11IcHtHH9lH|HA1IcHuf.H{(H aH{ KHH55< H8V10ff.HtIwtuUHH8u;H4H5%< H8U1HfDHHfDHIH5< H8jU1HAWAAVAUATUSHHGW~9Lo A1E1HcŋSHI|t;WELDD9kD{H[]A\A]A^A_fDATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.SHH?HtH/t.H{HtHC H9t2HCHC[DHGP0HR@UHSHH8dH%(HD$(1O'1HH2\HD$H$@ @uxH{H=lHHD$H{1Ht$HD$HD$=H|$HH/uHGP0HHEHl$H|$]Ht$H;OAHD$EHT$(dH+%(H8[]H=< HHt4H5; HmAHCHmuHEHP0HCHH|$H/u HGP0fD1{fH(uHPHR01[fHPH H5? H81tHmuHEHP01CAUATIUHSHHvH4IHMUH=; 1Hs?HHtfLIHteHH1C.I,$Iu ID$LP0Hmu HEHP0MtHLH8)Imt?H1[]A\A]fHmuHEHP0H1[]A\A]fLI;IELP0H1[]A\A]fATHJ USHHdH%(H$1DfA',fAAf'HcH>ffA0CH[ fCAAAAH$dH+%(HĐD[]A\f.CE11~HcHHC H@LH fAIH"] ,H ' H7 LHE1LLHH$8dH+%(H@[]A\A]A^@LvDfMt-I>~'11ItLDH t4HcI;|޸HIK H5?; H81E1kfDL6 @L6 @LI6 @L|6 @L @L66 @L6 @L`6 @L=6 @Lm6 @L5 |@ADcDfHvLD}DfAHvLQ@LX @Df/fL@5 Hv1L6`1H$HKLh ~@E1HS IcLAHHLpL?LL.LhD9cAEH<$1HwH RH<$HH/uHGP0HtUHH$TH4$H}$H<$H/u*HGE1P0!fDHH53 H81E1HD$dH+%(nHL[]A\A]A^A_H= \"H$HHtH}sHUH<$1PICH[ 1HHIHgH{XH#ID$HHJ1HSPHt7/H[ HH{XH$HHE1HSPH)@Ls HI~IHEt1LHHHD$dH+%(uHUHL1[]A\A]A^A_39ff.AU1IATIH=D2 USHH~H'E1E1HAMIT$HH;Rx6HmAtHD[]A\A]HEHP0HD[]A\A]H;0uHmu HEHP0ACHRHHtLL0ff.AWAVAUATUSHhH|$@Ht$HdH%(HD$XH*H9H4I1HIH:HD$8HHI*HD$0I95IHL=1 LIxLIHM9A<\uI~\HSL9AFIHLM9@IM9A>xLH)1NHD$HiHT$B @ H֨@HR0HNHHDHD$H@HD$HHE1H\$HLl$ ILt$(MI6t;GLLH1II &FL9t!uG4DGtfHD$H\$Ll$ Lt$(HHCHL$HHD$HHHAHP0M9~HH+t$0H|$0HL$P1)HD$Ht HD$PHtHt$HH|$@x{HL$8HHD$HHHAHP0@cu005HfJAFIIM9-LH).DHD$HPH_HL$8HHD$HHu HAHP0HT$HHD$HHu HBHP0fHD$HD$XdH+%(ugHD$Hh[]A\A]A^A_cLKu005LfBH+t$01HT$8HHD$HHuHBHP01{4ff.ATUHSHWHH7HH9|)HCL$6HH9t5HHt\HCHSL#HBHC1H,[]A\f.H(HCHHt6HSH~1HLH HH9uH{C!HC맃뢐ATUHSHL'HH;LxUuLH []A\XI,$t [1]A\fID$LP0[1]A\ff.SHH~t4H?HtH;H[f.H7H1[DHHP1HHuHVD$ HR0D$ H[AVAUIATIUHH Hu'HHLLH]A\A]A^DHt%LHHH}H}I4$IHHEH}H1fH ILHH9uHE H9tHEHEAULAuI $H]A\A]A^(11gEHEH$HH1]A\A]A^@H}HtHE H9tfHEHEfDHgLf.AVAUATMULH8dH%(H$(1HD$ IH$DŽ$ HHD$@HD$HD$ AQMAȉHHL[Lx4LHLH$(dH+%(uH8]A\A]A^@Lx10ff.@AWAVAUATIUSHHXL$L$DD$,LL$dH%(HD$H1Lt$ILJ H9I.I9uE1T$HL)L11r1IMA<1I<$LLHT$ HT$ pAHHI<$Ht$HT$LHH1Ml$LHL M.L9it$LD8HhA\uAWHtIM\HT$HdH+%([HX[]A\A]A^A_f.H}}EH9uIDM,$A:M.L9Lt$D$,HI91tMl$HfDI.1H9}}|$,ZLEML9L1E11\tp8(IHIH9wLt$MH|$H& LLT$(LT$MI*IBLP0f'"փ@[(H@])#I6HFIH9Lt$MLl$dLT$*LLl$LT$Lt$H|$Ll$H$ LLT$H|$H% LLLt$Lm&fAWH 0 IAVAUATUHSHdH%(H$1Af#wHcH>fH5 HH81E1H$dH+%(lHĘL[]A\A]A^A_fAIw IzfAGM [f.Mg A$f-3fAG~LHIHQIG HHpPIH5IG HHHHH$dH+%(AOLMLLEGHĘ[]A\A]A^A_(AG(HuHc@IHAGHuHcIH}AIW HcHHD@A_A.H@ f8LP0lA:i?Azn4AzA #CHHHH4HڃHcEtIDA9_`Iw HYHHH$dH+%($AOLMLLEGHĘ[]A\A]A^A_.'fDAIG %I"AIO HQ@BHH4HAHH4 LHHH$dH+%(AWAwHMHĘ[]A\A]A^A_8IG HHp(`HHH$dH+%(+AOAWLEHĘ[]A\A]A^A_%fDIG XHD$H@ \$0f6f\$6D$5HL,I] f4H , HcH>AIG Hp(HHHIG f ffH5, D1fH5A AuA}HU`IM|D$0u |$5dL$5t$0A9HHL|$H)HHDH$HHHD$HD$L,$Lh fA}FM} Aff AG@}HuHcIHAW@~aA1fHcHHIGHH49Hx1ڃ8DEڃHcIDA;_@|LME I}HucHH/Iu11H~#f.ILHIHLHcH9|AO@E Hl$(H\$`H= D+@H|$HHt H/uHGP0HHH8rHL5g H8T$HT$XHt$PH|$HH|$P^IHXH7IHqH\$`L1Hk H@I,$u ID$LP0HHLH|$HH/uHGP0H|$PHt H/uHGP0H|$XHqH/gHGP0[H E~AdJH>fDJH0f{( Hs( {@tHCHfx( / HHHAMAULEI(f{(Ls(v HKHC@1 ~Q(f fQ+1f#@)9lHcHf L H56 L H56 L* LHHHAMAULE4IWLc_L3LHHx3IH A$Lt<_tHAD$IuL LIMaH}L AUAuLHM"IfA}Iw(LH6qL|$f|$66u#HD$HMLPpLIHAGHHIG H4f>AH?HHH$dH+%( AOLMLEGHĘ[]A\A]A^A_fIwHHHH@AO8LMLEG<f.E'11LLIMID|$ E1At E# HT$PHtOHt$PH\$`HAULL$8HLE1z^_hAE;eDt$ I] |@E'E>LD$HI0HHH@AMLMLEEf.L|$PE1#AMLM11EELSADLL@IDBA9IDDLzA9uLXD9)&Hl$(H\$`H= 7$fH|$(LLHIUDH\$`LH`Hl$(fD@E1LL$X11LLIHHD$XHt H|$(HL$?L$1IDEGIM>\DHII,$ID$LE1P0HuHcIHYC@E1~DIcHHHCHH4H(DDAHcIDD;s@|ËSLpHpLH5 E1H81iAAA}ArLpH5"!H$LH$H5S LH$sA)AAfDH5f \ IHIHIG HHpPpHHIG @(f#H( 4AOLMLEGIHAGAxAAAAD,$AD9,$VIW J 2HL$f#6DEDT$ AHCD-HH4HHHL$LMLIPt$DYDAD_IHnfDA|$ID$ HHp(;IHID$ HpxHHHzH$dH+%(AL$AT$LLEHĘ[]A\A]A^A_dHp(HHH$H$dH+%(AOAWLEHĘ[]A\A]A^A_H|$`LHnI Hl$(H\$`H=8 {6Hl$(LL$H\$`H HL$M I(I@LP0AMAU1LEHIAUAuHMH=IAMAU11LE;&IAMAU1LE;IfL@A8iuAxsuAxuAL@HeLLE1H5 H81[AUAuHMH=NIHIHl$(H\$`H= H7Hl$(H\$`H5 H8I(Hl$(I@LH\$`P0yI1Hg IbAUAuHMH=LIBHuE1E11111AZA[IHID$ HpPH LHE1xH$dH+%(AOAWLLE*LHI_H$dH+%(AOAWLEH$dH+%(usAOAWLEH$dH+%(uJAOAWLEL5 ~H\$`L1HT H hH\$`L1H' HA 4f.AUIATUSHHFH3Hc6HtGIAE~?1fHcIDA9m~HcHHIE H4_HuE1HL[]A\A]fAUIATUSHHLf LI|$Htf1LHLHwuO{u-HC 1fx( t(KSHMEH[]A\A]@1@HpPLHHuH1[]A\A]AVMAUIATIUHSHHcHN HHH4f>#tYlHt?IEHHHID$ H4GHtI[]A\A]A^fD[1]A\A]A^DHHH4HtIEI[]A\A]A^DAVAUATIUSHn FUHE1f1E1f tW~ f}P1HHHDf8Iuaxt[Hp 1f~(1I $[LL]A\A]A^$f~f}(1Hu(uL7IHHk Cf1@E1E1f1qHHHt_I4$[]A\A]A^fDHIHt8UCE1Hk f cH(LHH/[1]A\A]A^DHuP@ff.@UHSHH~t.HHt1KSLEH[]Hv H[]!H1[]AWAVAUAATUHSHHFHuHcnHtnIċC~gE1=f.DHK HDLHcIDDKt,AD9{~%IcHs HL4ILsHHuE1HL[]A\A]A^A_fDAWAVIAUATUSHH(HN f97<9FD$ ҍBHHHD fQu#YfxuzH@ H@pfQt8fRtHڀH5{ H8H$H$H([]A\A]A^A_HH D$ f97@@9pdD|$ AH3IcH$HE~E1rO$W LLD$HD${LD$1Ht$HIMm|$A9FH$NlID9d$ IV Hf:7@D$@EHHL,ºLIHEHHHIF H4vHA}IL#1HIEIV HcHDHIH@ f8Q1H@ H@pf8Qt xuL$taH3HcrHD$HtL~lL$LxHl DA~IuMN MqPIL9t=Mv HIF Hp(HuH$H31HD$HtfA>PuMv HD$IEiH7D$ H$Hf.AVAUATAUHSLn HLHt`8ItFHC HHp(HHt@LEKLSEtHH1[]A\A]A^A_Dt$LHAH;fDT$ HIw(HHtAOAWLEHLHLD$ IH^LD$ It$LHLD$ #D$Md$LD$ ~\HD$HL$(LD$0\$ HPD$L|$8HӃHIfHH8HtLHL9u܋\$ LD$0Ip HHPHHHUL HHcT$Ht$HDBD$oIw(HAHHFHU1Y Ht$D$IHcD$LD@D$fDH LH>fL|$8H HL@11hL$t.Hx LHH LHֻH LH迻|H LH註eH LH葻Nff.AWAVAUATAUSH(VHL$L$A9}GIHE1HM IcHLAft5f#tH LLAH(D[]A\A]A^A_DAD$9HH1f<H<$IcE1AxH\$Ip HDIX LH{ݸHt1HHLHD$3nKSLMH|$UHOH\$UAAH|$HDD9-@1YfHPLLD$OLD$HIQfALLD$IcHH4LD$HAWIAVAUATUHSH8f>F^AG[IO 1E11I4ff#t_fAfƒI(9AfučW9HcH44f f9Hc)H4HH41HHL(f- fH(H9t f#uH$EoHLcHuT$ LtIHT$ HD$HuLT$ CHD$H\$ D|AG2@EwHD$E1H$HD$HD$1ۅD$ E1E11D$$IO HLAf#mfAv9HcAVH4H4>9t3f u7MALD$LLHAƃf vH^HD$Ht|AGAD9#IO IcH4LA8f4MLD$LDzfDft3HfDf=MuJH4$HH1[]A\A]A^A_)ffH I HcH>@IHKoH5 H81Jf.1HH[]A\A]A^A_H4$1HHL[]A\A]A^A_#L4$AnELcIiVUUUH )IF HpPHD$HD$HtMn KITfHD$(HD$ f=/I7 HcHD$0HBHhD[L,$D$IF LH-IHIF 1LLLT$HPxwIF LHp(HHD$8LL&HHANMEFHt$H|$8萻HHEH9\$, IE HcHL$ЍSHL4AV{  H52 H[mH81aH4$1HHL[]A\A]A^A_H$Pr VH$HC Hp(H$HHHC LHpxH$"IHHC LHH$HHKMLDCHHH[]A\A]A^A_кH$hH@ + LAPsiW U]HcHHf8 HE1xCL,$HJHHcHHHH)ǍBHH|$H)H,HHl$yIu LHHHHD$LH4Iu HHtIE MLHH؋HD@ID$H`H9\$HI7MޱIHrDH$H@ P(f+f-qftHP0H5 H kH81H4$11HHL[]A\A]A^A_|H$I7H@ HcxHD$CHD$(HHD$D$@5DHcD$LHHD$ HD$H@ HHh HD$HEHDe8DmH$HC Hp(H$;HHSsIHH[]A\A]A^A_郺H$IpxHH[]A\A]A^A_SH$HX  fHE HcH>Hr(HT$(1LqHp(HHH$LHC HpxH$IHcHC LHH$HH@KMLDCHHH[]A\A]A^A_Hs 4HHH$IPpHH[]A\A]A^A_{X Hs H(HHH$IPpHH[]A\A]A^A_uH$IpxHH[]A\A]A^A_e{& HC Hp(HH\{ Hs LHxbHH6H$MHHPHH[]A\A]A^A_CH$IpxHH[]A\A]A^A_cH, HLѥ1H HL踥1IuH$1L?AE1A}DEHEHLHp(IHx}@/ HuHLHx~HHRH$HDLLDHD@A7A[[+AEE1IuH$L藧AESH HLФ1fLL5 HHANM11EF襯IF LHp(HHD$LL HHkANM1EFH|$THD$0H$HDHD@A7HL$8HT$0Ht$@H|$(ZY^H$IHPpHH[]A\A]A^A_H$IHPpHH[]A\A]A^A_E1BHHLlAEff=!fHp LLu1HH@ Hp(H$芿HH^HC LHpxH$ HH>KM1DCH5f Hp(8HH H$LHC HpxH$d HHKM1DCLH5m I7HcdHHH$CP~E1YL8IH|HK HLL5]DDAHLtCPA9 IcHs L,ILf>TuH L1 H@xst+ۍEIE1Hr(HT$(LH7wIHL4$LAF$HHIF H4跽IHAFLL4$HHIF H4 IH^H<$GH<$HHHG LH4 HH.H<$MLGD$HH HG LHȋHD@mIID$HUH5 H5 HH@ Hp(H$ԼHHKS1M1LLL$IH}LL$SIi E@I7HcIHFDU@1E(fDڃHcID;]@HcLHHEHH4кgHuHHHH4$H L豟1ELHHItHD$ HHD$("H$LHC Hp(H$荻HHaHC LHpxH$HHAKMLDCHIHHHLآA$CCH HLȞ1BHHLlAEHcI7WHHfA}tSEM1E"cfDڃHcHDA;]}CHcLHIE H4к躤Hu@LL蠤H'HEMtM6MDD$DH $HHL[]A\A]A^A_AE*H LLƝ1HD$ H$LH@ fxPKHpP觹HH{H$H@ H@HL@A%LH5 ]DIT$L4$HH[]A\A]A^A_LHHH$H@ H4f>HHH$MHHPHH[]A\A]A^A_ELHHItHD$ HH$Lh f1PH$H1PpHE1E1H$L11HPH$DL1LDHD@UA7A\A]H H$MLHD@HH[]A\A]A^A_p վξ Ǿ1Ax/@ƍ41Ax*@ƍ4똾 둾늾냾yff.fAWAVAUATUSHH8HL$dH%(HD$(1HT$HL$HD$ fSuH_ fWffteH.XH5/ H81-E1H|$ HtH/t*HD$(dH+%(H8L[]A\A]A^A_@HGP0Ls fA>L艛Ht$HcH)HHt$AFE1H\$6IfDHXHRDDAHcHDE9n~IcHIF H4f>uHt$HIHs H|$HHHt$ I@H踚Ht$Hc[IHsD$E1Lt$FHcD$H HC H,f}thHaLe ~LD1$ fDAHcLH4ID$ H45H/IcAwID;4$uD<$sD$L$F9lHt$LIHLHIcϋsD$AIDL$F9Lt$L.HHs{LHEHjLHLH˩HH[JH9CLl$LD$ LHLH D$!HH< t< uEH< t< tLMHLLRH|$ IHtH/uHGP0HD$(dH+%(EH8L[]A\A]A^A_f.M9ID$M LʰH5 H HDHHE1H8fHCHHxLLHI_HHH52 H8BE1:f.HHH5 E1H8f蛲I4HLHCHAHH5 H8PI訯IHeBfAWHAVL5 AULATUSH@HLdH%(HD$01HD$H\$H\$P1LL$ LD$(/ZY%Ld$Ll$Hl$I9}I9MDID$ LL=;LLHHGH9EL|$LLD$ HLH D$1IHL]MuE1LLLH|$ IHtH/u HGP0fDMt;I,$HI*IEH5 HPHFH81E1HD$(dH+%(H8L[]A\A]A^A_HEHHxLLHIkID$LIP0H@+II9Mt MkHJEH5 H8kVfDHPH5 / LLHM\ HEH5 E1H8fIHpDH(HdH%(HD$1LL$LD$H5* 襎tgHt$H|$HFt:蕩HHtMH(uH@P0HGHHT$dH+%(uJH(HDH5B H8J1fDHIH8聩tHHFHfDH0HdH%(HD$ 1HD$H5W P1LL$LD$ 轍ZYt7H$Ht$H|$du HHHHT$dH+%(u H(1'H(HdH%(HD$1LL$LD$H5 5t9Ht$H|$1u$H5HHHT$dH+%(u H(@1ff.@H0HdH%(HD$ HGH5HD$HD$P1LD$ LL$蓌AX1ZEtH$Ht$H|$HT$dH+%(uH( f.AWH1ҹAVH5Ȝ AUATUSHXdH%(HD$H1LD$@HD$@ H=6Ll$@AH=6H2H=6I#HHFH9HwI9MHH9L5,611LHHTH(L=5H11LtHHHD$H|$HH/HH,DH8HH9)MtLLunL1L1HHH(tH2HT$HdH+%(+HX[]A\A]A^A_HDH5S H81fDH@P0@HGP0H5fDH@P0u@諥H1i1E1H\$H HQHL$HH1E1H|$D$ LD$HWR0LD$D$ MtI(uIPD$LR0D$H|$t*HL$HHT$HHuH|$D$HWR0D$HtH+uHSD$HR0D$MtI/uIWD$LR0D$D{=fDHICH5 H8:1aKfDHCH5 H8 11fD虐L1L1IHfH~I/Hu IGLP0HHFH8SHH9o1`L=2HH2LHHHD$ХHL$HD$HHHHAHBHWH|$HD$HH|$HD$ HL1L1HHH(uH@P0M_LL"HLHD$(LD$(HMHI@HS1LHIMLD$(^HULLD$(HD$8蘚LD$(H5HT$8LHLD$0HD$( LD$0LL$(II(uI@LP0LL$(H+uHCLL$(HP0LL$(I)u IALP0MlIW HCH0H?H8辢HHfH蚤H?HHt HP| HDHL$ HT$H9HL$HHT$HHuHQHD$HR0HD$HL$HHT$HHuHQHD$HR0HD$MtI/uIWHD$LR0HD$HHD$ HD$H1.H|$"H\$HHD$HH1E1H|$tH\$HHD$HHE11E1E1H ;H8#1bIMH@D$H:D$HL$HHT$HHtdI(u9E11HL$E1HHD$HHw1MHL$AHHT$HHE1:E1HU ZH|$1E1H\$H HQHL$H1HJvAWHAVH5 AUATUSH8dH%(HD$(1LL$LD$ HD$袃:H|$ Hl$諰IHHvLeI$H5 H5F:I9LEHEH>I98L5A;M9uEHH蕴HmHu HEHP0I,$u ID$LP0Ht.HLIHu"HtHmu HEHP01Imu5IELP0)H5 H8H8zImt31HD$(dH+%(H8H[]A\A]A^A_IELP0@HmUT$uHAV0Hl$L躅IHH@L9H9tdD$IHLHZI.Hu IFLP0I,$u ID$LP0HIm!@HLmT$ufI,$H*XD$D$CID$LP03DI,$L$AXL$L$LAV0fD1HHaL`@L|$HLРt$Iąu|HmuHEHP0@LhIHH9XtfL^IHLHI,$Hu ID$LP0I.u IFLP0HLe(H5i @LH%L$J, HH1L1HmI.u IFLP0I;Imu IELP0BHiD$ΗHXI,$AID$LP01Imu IELP0HLDHI.IFLP0ff.H(HdH%(HD$1LL$LD$H5 t1Ht$H|$xHc։HT$dH+%(u H(Ð1wH(HdH%(HD$1LL$LD$H5{ ~t1Ht$H|$RxHcVHT$dH+%(u H(Ð1AWAVAUATUSH8dH%(HD$(HFHHVHH+H^Hp;H9CfLv IFיIHHHzHHt{L-'HLIHHLH-IGD$ M@ImHtHmu HEHP0I,$u ID$LP0E1HD$(dH+%(H8L[]A\A]A^A_@I|$ID$LxILLDIHXD$ I9tI/u IGLP0IED$ H5&LIHHt$HHLt$Ld$蔱I/IuH$IGLP0L$MLL$TL$IBH HHD$ tIUHn2H5o L$E1H81ΓL$I*u IBLP0Imu IELP0HtHmu HEHP0I,$ID$LP0vH1H5 E1H8wPfHHsH{s0jE1E11jLE1jjLT$0衞H0L$HHCHt$HLLT$ Lt$Ld$9L$HItmH@t`H5H9CuSHSI9tJHH21MLH5ž L$H81菒L$I/uIGL$LP0L$E1H+HCL$HP0L$H5H8評lIH0H5r E1H8f.Hq0H5ʼ E1H8fL= 4@HA0H5¼ E1H8fIELP0dImu IELP0HtHmu HEHP0I,$YfI/IGLP0 I/IGLP0H2MLH˼ H81L$]LHL$詏L$`苴ff.H@HH "HdH%(HD$01HD$ H HD$ HD$HD$D$ PHD$PHD$(P1LD$@LL$8H A1EtDD$HL$HT$Ht$H|$ RHT$(dH+%(uH8ȳH餌@AUHATUSH HIH@L"HhHmu HEHP0xQtoLAHHuI,$tzHtHy,H8t/訾H0HH[]A\A]fI,$u ID$LP0H1[]A\A]ÐI,$t9H/HH[]A\A]ID$LP0耒HwDID$LP0H/HAUHATUSHHIH@L"HHHmu HEHP0xQuoLAHHuI,$tzHtHY+H8t/舽H/HH[]A\A]fI,$u ID$LP0H1[]A\A]ÐI,$t9HR/HH[]A\A]ID$LP0`HwDID$LP0H/HH?ff.@HH`HHct@UHSHH8dH%(HD$(1H;=1-tw1LL$LD$ HH5 2utnH|$DHHt\1H0HtTHT$ HHPHhHT$(dH+%(uPH8[]@HH= rf1@HmHD$uHUHR0HD$FfDUH賁H}HtH/t4H}HtH/tHEH]H@@HGP0HGP0ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{ 1Ht[LH]A\fD[]A\ff.H.HH@H=I@HI@I6-(---6IDH5,=I8ff.HM.HH@`pff.1DAWIAVAUATUSHHGH;'ALoH;-A IEL,fDHHcHeHmu HEHP0HubLAHHtTEuIH11HHt?HD$荀H|$HcH/uHGP0H~HH[]A\A]A^A_Ð1@HmuHEH1P0HOHW1HwH= BfHWHw1H=A &fDAVAUATUHSLHpHdH%(HD$h1IHtFLmLe Ll$LAL9HD$hdH+%(JHpL[]A\A]A^@IH5'H9tYIɞuMLt$1HLHt$ H|$H)H8ىt+蠵HD$HDH$H5 H8Z1Hs@UHSHHGHXH{ҵHtLHHEHHBH~ HE1HtHHHtH9uHuHH=e1[]遦H1[]AUATUSHLoLg MtdI<$HukI$M~P1*f.I|IDH/uHGP0HI9t"HEH|HGHuI,$t^E1HL[]A\A]LشIHtM~1IDHI9tHEH|HGHuI,$uID$LE1P0HL[]A\A]AVAUIATUSHHH;=(H赲IH~lHx3HHtqADJ|vHtiJDIM9u1LA0HtJHSHhHHPH[]A\A]A^DH"H5j H8 1H[]A\A]A^HmHD$uHUHR0HD$H[]A\A]A^HH=F1DAWAVAUATUSHH8dH%(HD$(HGLpIILME1JDIM9~HCJ|HGIHuIJ\MtfDI>H/uHGP0IL9uL9tHJsHD$(dH+%(ueH8L[]A\A]A^A_E1DH{1LHIf.J<3HHt HCI#*wE1 H8HdH%(HD$(1LL$LD$ HD$H5} ,jH|$ HWHH;=!tcHt^HtHT$(dH+%(H8fDH|$tXCHtHH8t/HD$HH HRH5& H81|1HuH_HD$H:肦HD$YUH裍HHx H]"f蛄Ht1]fHH0HtHHfD1HÐHoff.@HOff.@ATHUH5H(dH%(HD$1LL$LD$HD$ihtELd$Hl$LHt;t:HLߑHT$dH+%(u9H(]A\1@3ҐHH5 H8 1衣AWL=AVAUIATUHSH8dH%(HD$(1H]HD$HD$IDHD$ʭIHHl$ 1AHHLLL$LD$HH ~D1H) HmAEI~ H|$WH|$ =IHaE1E1LjHHH|$H1H1tIHMLL舱I,$u ID$LP0ImuqIELMIP0L9jHHyDӁH:Mt I,$Mt ImI.IFLE1P0tMI DHEI5Hmu HEHP0I/IGLP0fDHAHT$H5 H81}E1HD$(dH+%( H8L[]A\A]A^A_HEHP0/Ht$1LD$ HReIELP0ID$LP0MtmI,$tYI.]IFLP0NHmHEHP0fDI/u IGLP0HmhID$LP0HD$Ht HIH$HT$H5a H81n|e$@HH1off.@HHֺLff.USHHHnHt1HVHHtH5M H81{H1[]ftQ~ HSHuC ‰ HS0HH@HEڋ;0H5H9t H脑tpHSH_HC(8H[] ~ H[]H`?f.t|HS0HH@HHD8fDHqHUH5 H81zt,HS0HH@HE;cfDH[H;RDH[HfHCHf.AWAVAUATIUHSHHH=dH%(HD$81HD$0HD$(HD$ HD$HHD$H ?LPH HD$(P1LL$8LD$@薁ZYHD$ HL%L9HD$0L9HtH@HD$(L9HtH@1L-4 ;L}ugLt$ LH'LHw}uCHLcuI9Lt$ ~H|$0HuLL螲tf.1HT$8dH+%(HH[]A\A]A^A_HD$(Df.H= dHD$ HL%L9H[HHHTsH|$(Ht$ Hta|OH|$Htn7ubI$L(fDHD$0HD$(L9m,@H=6 脱HPH5 HhH81wH|$ 1H5s 1HHH(sH@P0gHPH5g HH5H HD$H:蒪HD$j#ATHH 0<HUHX H(dH%(HD$1LL$LD$HD$~H|$LGIH5;޲HHHt$HtHH;5t?H11lIHmu HEHP0HD$dH+%(zH(L]A\1H1lILcx H|$hfE1yIHuHD$H5G H@HPHH81&vrܙff.AUIH :H ATUSHLHH0dH%(HD$ 1HD$ HD$P1LL$LD$ X}ZYtzH|$踵IHthH5 :H1{HHt9HCLHs HHP’HmItXMtImu'IELP0I,$uID$LP0fDE1HD$dH+%(u&H(L[]A\A]HEHP0Mu躘f.H(H1ҹdH%(HD$1LD$H5U HD$\t@H|$Ht&H58:zHt-HT$dH+%(u?H(zHtH1@HH5 HD$H:mHD$AWAVIHAUIATUHSH-L;5vHHգHHHE1JDIGH9tZIK|IHuHFH;&wHmHEHP0HL[]A\A]A^A_HHIHH 1H1HILHL9uJD>H1LA0IHHhHXLh 눐HH=? 1ufE1_H;IWH5J 1r(H螢IH{HmuHEHP0Hmu HEHP0ImuIELP0UHgH}HtH/t4H} HtH/tHEH]H@@HGP0HGP0AUH=ATU[_KH=G_7H=H3_#H=5*IHH薃HH5Ƹ HHVHH5' HVHH5 HVHH5 HVHH5 HVeHFH5հ HgVGHH5 HIV)HH5d H+V HH5s% H VHNH5p HUHH5' HUH*H5 HUHH55 HUuHH5l HwUWHHH5 HYU9HZ H5m H;UH H5 HUHH5~ HTH H5 HTHH5vl HTHH5HTHH5tHTgHH5q HiTIHH5 HKT+HTH5H-T H^H5o HTHH5o HSHb H5Q HSHH5GHSHH5$ HSx{HH5j H}SxaH 18@aH5 HHIOSIExHIEu(IELP0HIEuIELP0DE1L]A\A]ff.H1H=juh1H=juz1H=/*vu\1H=vu>HH+H=6 聍+HH= ֠H= ʠH=2 辠H= 負fHH <+HEx% uMHx$P t29|<1Hf9}@$H5 P Hd HH81l1H= 1USH*#HHtH=H-HڣH=+ H*ՕH=t*o]H tHuH[]ÐH-HaHH9tH赨tH=ң UD HH=     ]tH=j H= H=¢ H=z H= ݞH= ўHH8ff.fAWAVAUATUSHXH|$dH%(HD$H1HrH-HD$HD$A?)Lt$0L%GH\$ f.(H (LL=HHE1I^HL$8HLH4ׂCLHHH?HH)HD$0HHi@BHD$0HD$ H)HHL$8HiHL$(-ent`H=G 脝@*(3L9=&   @L%L 'H'H=O SH H\$H9tH H H= ZL, uLHD$HtHuRHD$\$HD$HdH+%(uHX[]A\A]A^A_f      H=K >H= 2H=ˠ &H=O H=۟ H= ff.fH H8Ht(PH= ˛ff.f&xÐHGH H8tH= H t HDCdH f.&xrHH=G MH= ucH= MuGH=S ޡu+H%H=7 %HDM@H= ӚH= ǚH= 軚H= 诚ff.@UHtHH6Hu]H= sH= gUHtH1H9uH]H= 2H= &fDAT1ÌHtIċ$xLLA\H= ATUHH L u$Hf$H= L@kbLH rH5x H ID$Hx HHtcH1H5W)1HHtXH(t2Hmu HEHP0HL]A\bfH]A\H@P0H]A\t@H8pfDATUSHtf}#Hy[H]A\jf.+HD HHHH9tHt HQD#H[]A\H= aAUIATIUSHH-HdD 1HͥtHc AЃ);~tLHHqoHLbE1L*<*HiHD[]A\A]@A@Hc Bȃ);t@HH E1HDH:HrH[]A\A]{HA[D]A\A]H=|AVAUATUS&H=nD%EEtE1[D]A\A]A^D"   Ո H-PHcЃH=HHL*LrЃ)ЉgMt>LAՅt+H=辣;uH=g^]A\A]A^fD#oH9\^H<HAf AD[]A\A]A^HE1E11jjjjjmH8f.fAWAVAUATUSHHt$(dH%(H$HL0HB B H;^A~,I^tZI~8Ht!IvHE1HLL 5 I~0Ht'Iv@E1HLL {fDHs HxHL$8HF8Ht$HD$ HF0HD$@HcFHHD$0HF(Lh H$HcCxLl$xHT$HLlHD$L{HƃHCH@ Xt$(H{XINhIVpIFxLc`HkhHH;=DI~hD$`HKXD$,MfpHD$HS`InxHChD1LH+l$kxEtMf8Mt EN(EEMIEfAEAH DHcH>fHtHHtHHtHHKXHS`HChHt H/uHGP0MtI,$u ID$LP0HtHmuHEHP0f.D\$(D$`ED$,HD$AEz=4Ht x~OIHIdžHkmc ЉS^Hmu(HEHP0D$(D$,HD$zaHNH9I~8$HtIvHHLf.HcHTmL$A$xLH+C@HA$9~VLdmN,fDIIHt H/uHGP0LH+C@HA;Bxu <$P<$wz>M$(t HD$II<$M}轅IEHDmLcILl$fDLH+C@Ht)IIHtH/uHGP0LH+C@Hu1҃<$HDT$HD$HT$@ tgMH1H 9M8uIFhHSXIVhHS`HCXIFpIVpHShHC`IFxIVxHChAN,MV8ML$@<$YPMV0MtnAF(ufIF(I~@HHL$AI~8NAn(AV,t-HT$HtHH$HHu HBHP0HD$HHP P H=?29BHCƃH~ 1Ht$IFvpH$dH+%(WgH[]A\A]A^A_D<$ LLH+C@HA;$6xyHDmHߋvSIFxIIFpIGIFhHOIGL$L$H$LLH$OwH$LLuH$HIOH$蒇H$HIVhH$HINpH$IFxHNLcHI0IIGLl$IOIW9}=fIIHt H/uHGP0A$LH+C@HQ9|IGI~hMoMfpInxIFhIGIFpIGIFxHt H/uHGP0MtI,$u ID$LP0MH/Hm$HEHP0DH=_ 褈1MnHC|L{H9l$(9l$`9l$(t 9l$,C|HLIF(H AI~8LckxAV,HSHAn(Dl$,ILl$Ht HCHIׅf.H{ H$d$$T$(L$`N@9HwH@$HD$cCD$H H H81@GHyH5 H8蚊vLcl$,ILl$MHCH1I~0AV(I~HHIF(HL$HAI~8CLAn(AV,GHL$HOLHH$HHOHAHP0MV0HD$MbIv@E1AHLL躎KLH+l$LH+K@HHDHHAAuODEAEH5{kxIADfAE$ADL$H$1DD$PJIHHcD$HIHgKDD$PHLt$HDL$PH,DD$XH(uH@P0H-IM4/LI6WHHuDD$XLDL$PLt$HAVI,$eID$LP0UD $IHID$LP0.LH+l$MgIOHH+K@zHHHAA MMg5RAEHkxIADfAE$IoH5H芏HjIGH5HnIHhjHmu HEHP011LeII,$Hu ID$LP0H8I/NIW.W=LH+D$>cCxAEIIH 6ADHfAEIIHM'H9GpLLH<$UH<$HH/uHGP0I,$u ID$LP0IoHD%LH+D$ECxAEH IADfAE$MgIoIHL}I,$H$u ID$LP0Hmu HEHP0H$IGH-8LH+D$CxAEHIADfAE$DȃAIIWIoH$H$LbLzHHHH9I9D$JHLoI,$uIT$HD$HLR0HD$HHtHmuHUHD$HHR0HD$HHL<$IG!Q5:LH+D$aCxAEH5IADfAE$IoIHUH ]t @^H;-ZHmuHR0[jD%LH+D$ESCxAEH LIADfAE$H{8H^[HH9GGH=MHHH{8HKHHYH(uH@P0D LH+D$ECxAEH IADfAE$HD$MoI@ Ll$t=L\HIEH$HIEu IELP0HeHD$Hl$@ L{H$@rH=fHLH+C@H9E}*IIHtH/uHGP0LH+C@H9E|֋LH+D$CxAEH IADfAE$IoHDHmAu HEHP0IWEKcHHH'=ZLH+D$CxAEH IADfAE$HD$8IcHHY=LHIHLH+D$CxAEHIADfAE$HD$8McIWIJH8HHt H/uHGP0 LH+D$=CxAEH6IADfAE$IoHaHmIu HEHP0MgM-LH+D$CxAEHIADfAE$IoHUH;CH;Ft)HdaHmIu HEHP0MgM-HD$ McH{(IH5 M'IoJDH$CHHPH'HH@H;xhNH$HH$HC0H$HC8HI1H$H<$H$L$H$ebH<$H/uHWH$R0H$HmuHUH$HR0H$I,$uIT$H$LR0H$IGH-LH+D$CxAEHɔIADfAE$HD$ McIoNdHLoGHTGI]IW7G=LH+D$TCxAEIIH5EADHfAEMgIoIHLqHI,$H$u ID$LP0Hmu HEHP0H$IGH5LH+D$CxAEHIADfAE$IHGH;GHPPHLHRHLHH Hc1IHMHmu HEHP0M'IW}GD:LH+D$E%MCxAEIIH5ADHfAEIIH/uHGP0LH+D$CxAEH IADfAE$HD$0McIWJHI1IHDrLH+D$EJCxAEIIH ADHfAEHT$0IcHH@HJHIWIEDLH+D$EJCxAEIIH ADHfAEHD$0McIWIJHxHPHt H/uHGP0-<=oLH+D$'CxAEH IADfAE$IoIGIcH$H$H|IH$L LxHmu HEHP0MtDLH+D$ECxAEH ~IADfAE$AHDMgIHI9D$!DǀHHLHP?II,$L|$Hu ID$LP0HD$HIL@L`HII9@CLLL$L$GLLD$P7gLD$PH$I(u I@LP0H<$THtI9D$nDH4$HLgII,$uID$LT$PLP0LT$PH$HH$HHuHBL$HP0L$HtHmuHEL$HP0L$HD$HLPMD LH+D$ECxAEHȎIADfAE$IoH5OD $HCzD $HICOH5 HD $ zD $HNIGHmuHED $HP0D $11LD $4I,$D $HuID$LP0D $HML+d$LH+K@LHzHHAA6I/IWA FAEDcxIIH5ADHfAEAEAIDfA HT$0IcH qLH+D$)CxAEH"IADfAE$MgIoIHL5I,$H$u ID$LP0Hmu HEHP0H$IGHv5LH+D$CxAEHIADfAE$MgIoIHLPI,$H$u ID$LP0Hmu HEHP0H$IGH 1LH+D$CxAEH IADfAE$HD$ MGMcIMgJtLL$L,_L$I(u I@LP0I,$u ID$LP0-FU=LH+D$@CxAEH 9IADfAE$HD$ IoMc1IJtH^HmAu HEHP0E5LH+D$CxAEHIADfAE$HD$ IoMcIH{0JtHMxHmAu HEHP0E*9 lLH+D$$CxAEH5IADfAE$HD$ McH{0NdLVS?LH+D$CxAEH IADfAE$HD$@Mcɋ5LIJDHH\LH+D$HUICxAEADfAE$MgIoIHLxBI,$H$u ID$LP0Hmu HEHP0H$IGHLH+D$CxAEHIADfAE$MgIH8MI9D$p;LLL$#L$HI(u I@LP0I,$u ID$LP0IoHDHLH+D$ECxAEHIADfAE$IIHM'H9Gc9LH<$"PH<$HH/uHGP0I,$u ID$LP0IoH@YhD LH+D$EQCxAEH JIADfAE$MgIoILHVI,$H$u ID$LP0Hmu HEHP0H$IGHDLH+D$ECxAEHIADfAE$MgIoIHLS1I,$H$u ID$LP0Hmu HEHP0H$IGH$=WLH+D$CxAEH IADfAE$MgIoIHL=I,$H$u ID$LP0Hmu HEHP0H$IGH\uDLH+D$EmCxAEH fIADfAE$MgIoIHLgI,$H$u ID$LP0Hmu HEHP0H$IGH-LH+D$CxAEHƃIADfAE$MgIoIHLqGI,$H$u ID$LP0Hmu HEHP0H$IGH3B uLH+D$-CxAEH &IADfAE$IoH(HmIu HEHP0MgM5LH+D$CxAEHIADfAE$MgIoIHL>I,$H$u ID$LP0Hmu HEHP0H$IGH$D%VLH+D$E CxAEH IADfAE$MgIoIHL!_I,$H$u ID$LP0Hmu HEHP0H$IGHZs=LH+D$mCxAEH fIADfAE$MgIoIH%HLj1I,$H$u ID$LP0Hmu HEHP0H$IGH LH+D$CxAEH IADfAE$DELH+D$HICxAEADfAE$IoH+HmIu HEHP0MgM DJLH+D$ECxAEHIADfAE$IoHp*HmIu HEHP0MgMpD LH+D$ECxAEH zIADfAE$DII/HHIA`L<$ݠIՠLMDL$HMIL,$IoAQHHHHHuHWD $R0D $AQEAH\$HHLHHDH$H{HH/uHGP0H;$uLHH\$HHL|HLe /DaLH+D$ECxAEHOIADfAE$H8D $H8D $)DHuHIH/4HGP0(LL$0LIL$LH5{1 HHaH81gLܟII鳒H(uHR0H_LH5+ IH81IG{IIkI(u I@LP0IGNID$H5- HPHH81IGI,$ID$LP0 I9HH5, H81I,$ߑID$LP0ϑIHH8'u6I,$ID$LP0陑I,$ID$LP0~H6H5) H8"M^HH5) H8g"I,$=ID$LP0-@HtGI,$ID$LP0{HH[H5H8LؐH@H5H81L<$IIގI韐HH8tbH5LHHt3HHmHD$Hu HEHP0H|$Ht D$dHH8u~1HI,$ID$LP0HH5^- H8!IW#HɋHH5_- H81HmHEHP0鬏HdH5. H8 gHI$ID$LP0sI,$hID$LP0XLaIWAHT$IcHL,_H=F' HHHxhHppHPxHt0H;=-t'HHtHHtH$HH5( H8麎H:H5{) H8Imu IELP0I,$u ID$LP0HxHmmHEHP0^HI,$uLP0HɊH5( H8R1HfHHwHmCH$HEHP0H4$,HH5 - H8I,$؍ID$LP0ȍI,$ID$LP0魍HmHEHP0LHHNH(uH@P0I,$u ID$LP0HxH5* H8iIG=7IHmHEHP0IHHɎH8MLH5% >&H҈LH5% H81ʌ1LIH!HH@H#LH5& H81HD$Hx@DHHH8H_H5/& %NIFID$I|$Il$H _ID$HHHEAUHHPHt$H9tHmu HEHP0IGʀ4tTfQuHPHXH5( H81H֋H5$ H8HmHEHP0鎋HPH H5' H81qeu1LIIHBH5Y) HPH·H81_tI9'HL)H|H9eAL$ @utEu<t<E9BHIHP Љ <<IM0IEH@HE_ILLLHx1HuILLgH6Imu IELP0E1DHFHf8_fx_H^Hof|X_H 'Hf<_~0_~1_H^Ho|/_ID$.HNDHV,H^HDHoH <_It$(IT$@HHDtH8H#tVH$hdH+%(Hx[]A\A]A^A_fDH5H1u HC0HC0Hx(HIHC0Hx0HIHC0HHxiHIHC0HHxNHfIHC0HxVHHHHHMIHPHd ^AV1AUATrHHgbfAWIAVAUATIUSHHFHHT$H $LhH"M~g1:Hx@LHcоL tiHI9t.ID$HLtLL)IG0uHx8LLfLtHL$IG0LHx VzHHyH1[]A\A]A^A_DdL{tIG0H4$Hx zHHxdLQtHT$L;H[]A\A]A^A_@HNhH $I|$HHI|$hIIIG0HxLHYHqHAIHH]NAUH ATjH81聙H H= AWAVAUATIUHSHHG0Lh(HxHL轏IHt]HE0LH8AăH HcH>E1H*GH5 H8KE1HD[]A\A]A^A_H5) LtEM H5;JHE0Hx ^xHHxdHE1AfDHE0HE0H@@.74AaLLwI.Iu IFLP0MHLDH[]A\A]A^A_DHE0Lh@PAHE0Lh8fDHE0HR@ub^Hx0H LD,'wHH[DH`HI.YIFLP0JwMuNAZ@E1HEH5C E1H88E1HDH5 E1H8H5G@Ae]DAtMDHAx@DE-DADA[ DAbDHIDH5 E1H8gfI.IFLE1P0@AWAVAUIATIUSH(H^(HD$Ht H;Il$HID$H}HD$E111O@HLeI/uIWD$LR0D$LL)tuHcH;EHL$HTLtMtIE0H2HxH聋IH}MuIHH@LLL8u@I,$tafHD$HD$H([]A\A]A^A_11f.HcH;HtLTufDID$LP0HD$fMtLMt$螓I,$Hu ID$LP0H`IE0HHx sHHdLHmtyLLHL$DID$(1HtHfLHD$fDMI,$HEHP0xHmHEHP0I/|IGLP0HD$m@AWAVAUATIUHSHH_0F ;~ǃE$}EHD HcH>fHuH{ srHHxKdLH[]A\A]A^A_H{ H5E0rHHy1H[]A\A]A^A_UHuHL[]A\A]A^A_Lm1ItLtHc1MtIUH9|HEH%HH/DHuL\Er u  aq HuHtLbHcӾf.ELm 1Afgu! @ItLHc1MtIUH9| ELmP 1ۃu!] @ItLkHc1MtIUH9|HuLHuL衜HuL@HuHuLi!HuHuLJHuHuL+HulsHP6H5 H8q1tf.1^@HuL|}EH HcH>L!IID$0HMjHP(ID$0HM`HP(H5T @AMEA Ec@)AAGLA9ANHcHu1H= ъH<HH>1yH= 諊H<HH01SHD$HT$1E1HL$HL>&AAA$H=2 JH3<HH1H=! $H<HH1H= H;H1LHtL911NH{ H5F9eHHedLȻ1KfHLL[]A\A]A^A_AffL{IE10I\$0聲IHEfL@@ HC`IHELs`Hp@HI9L^LIqHE D w H HckL贺<LoL0M|$0蠱Hgf@@ IO`IT$0HHJhIG`M}HAHBhL9'HELHt1H82H5 H8Y1H5 jH5 H2H811w1H1H5B H8 1 SLtL HH5 L"10I\$0|HH@1 HHnLHC`HEHk`許ID$0LHPhLrLphbLMuID$0HPhHjHhh$HT$L)ff.fHtsATIUHHSHfu [1]A\HC0HHxHxHHtHLEHEx-HHEu HEHP0[]A\fHHEuHEHP0f.AWIAVAUATUSH(T$L$DD$HH.HE1HE1E1QMt%t$LLLD$请LD$IIpLbt~IIE1L9t'NDA8tLL8tTIIL9uMt]Mtt$LL>t*It$LL'H([]A\A]A^A_H(1[]A\A]A^A_E1t$LLff.AWIAVAUIATUSHHL6M In1HfDHCHI9HMdA<$u݅t!H5 HL[]A\A]A^A_鬵@HCH=LH)H=H^LID$HIDHCI9otJ1ItLtFHc1MtIUH9|H[]A\A]A^A_DE1L\L荵uH1[]A\A]A^A_H5 ff.AWHAVH)AUIATIUHSHHHD$HH9KHT$iHH[]A\A]A^A_ID$HHttHI9~ID$HHtuH1[]A\A]A^A_f.LFH9?IfDwwM~M9tBMKLHtvL$uHyH5 EL$hM~M9uIIEM9tIID$HJtuFH|$IH/ID$I)E1L KtHۨHKDIM9uHE0LHx i]HHx3dH褳t"ImtHT$hIELP0ImIELP0H|$ZIHuff.fAWIAVI)IAUIATUHSHHI~JH9kI@ID$I9IKDHHpuH1[]A\A]A^A_ÐH9:fDdH賲tIt$HrtHI9MdHE0I4$Hx +\HHy돐LhIHzHHI fIDHHHHDHI9uHE0LHx [HHxKdHt:I.u IFLP0LHH[]A\A]A^A_I.IFLP0LiL螻IH_ff.fAWIAVAUATUHSHH8HHHD$HGHHD$Hf1f.HH;D$IHTH:uHcH|$D$,HD$ Lt$ E1E1VDMt&LfLLD$ΰLD$IIpLIE1IL9l$~-NDA8tLLQIIL9l$MD$,1H|$Hc1HtHUH9SHDLHptx1HcHu@HcH|$HD$ HD$D$,fDHcH|$HD$ oD$,L⾞L觯u[H81[]A\A]A^A_fHHD$HHD$H/HcHD$ MIMOH|$.E111HHH;\$}WLdI<$uHt HHHLH)QIIt$L8I1HH;\$|HIL꾗L觮ILt$ E1LfL{IHD$HcHD$ HT$HT$ LBH8[]A\A]A^A_HL$HLHH)jIC_1ҾfL:H\$HзIH!1H~HTHHITHH;D$uIG0LHx AWHHx`dL|tOI,$u ID$LP0HT$ HT$HT$1ҾfL6I,${ID$LP0k1mAWAVAUATUHH= NSH8Ht$T$ HL$LD$(DL$$ H0H]0IѣIHfD$@@ HC`I$Lc`0Lu0藣HHf@@ IF`HI^`0Lu0cIHf@@ IF`IM~`HU00H$+H$HIf0@@ HB`ILr`HU0H$H$fHI|$@@ HB`ILZ`u~HtyMttHcD$ Ht$L\$HHDH$umHE01Ҿ|HH@PZL\$t1HE01ɾyHL\$HPhLbLL`h誣f1H8[]A\A]A^A_H$HHptԾ2HGtHE0H58(Hx THHxdH躪tHH L\$Kw{yD$ky%fD[yIfDKy0H]0mHdf@@ HS`HHC`DHU0L\$HcBp6HH3HJpHBxLL\$=HE0H5*'Hx qSHHdH訩HHkH$HH0LTWHǨ?HE01HھnHhpšHE0HHPhLzLxh耨HE0LtHHP(p kHHT$sHGXHHE0L\$HPhHZHXhH$H@HIL(1L0Hǹ 1Ht$HHF`HIG0HV`HHhHQHPhL9H$LH@HtLrL茠Iw00Ht$HHnDv1H5"H5V H81ILD$ PHD$HcH;D$$BUHt$HL$4fI@@ IL$`HS0HHJhID$`HAHBhM9HEJtHLrH90Lc0ÙHzqHH1[]A\A]A^A_@kqfD[qdfDKqL|$(Hl$0Ld$8D$PHD$LcL;0D$S~Ht$HT$H߃HcءHC0HPhHjHhhLmLHLhhq#HC0HPhLzLxh|$Ht$ H9qHt$H$\T$H߃Hc5]8HJDDL$LD$ HL$@t+HHD$L;0HC0HhhHt$HjHt$HT$H߃Hc蜠Ht$HRVH͟uH踟[ff.AWMAVIHAULATAԺUHSHHG0L $HXHI@EF HD$TtpHE0HDjHAAt7Et2AV ;RH5s HHE1X)fDEt31At$fH茟u E1HD[]A\A]A^A_IGPLD$PH $E1LHtEtSH芞tHnHHHE0L@IL$HL$L1HHL$mL$AIHI~H+\H\$HHssC2HHE0H5Hx HHHdHNHH虝HE?E6IHWoHE0H5DHx GHHOdH:HHE1 A"LD$PH $E1LH:f.ǀHCHP0fI@LP0sI(I@LP0HItDH+}HCHP0qfDDH;NAFI@LP0AWAVAUATUSH(H_0DF0F4>Dǃw[H HIHcH>fLf1 ItHC Hc1MtI$H9|DAH(D[]A\A]A^A_1H(LH[]A\A]A^A_)DKpAHcHHڋrxIHqHE1AsDSpHCxHHHH9uPcHF1HtHH= Ic|$*IHHE0LHx DHHdHImu IELP0HĤIHH~%IL$1@HTHHITHH9uHE@A9D$0~I|$HtH5 ZHE0LHx DHHdH9Imu IELP0HE0IL$HP(H9lHME1H@qIH0@IPHHHDƒ8*8HE0LmHHP(IvHHID6xIL9}ID$NtMMuA@ ‰ YIH0@IPHHHD€8*]DHFAHHHL$HE1f1J\IHHE0LHx hBHH\dH蟘GImu IELP0HE0H5Hx "BHHndHYYHE0H lHHP(艼9L+HCA1Ҿ.H$IMLHuHLxHu;jHۗI/u IGLP0L{HIMALL.uHHHHuIULLIHrHE0LHx( AHHfI/LIGLE1P0fLfw$t (A$nLHHE15Af.Do EH=ZIt$>uHFHt H8HP0Lm0芍HHfHHs@@ IE`HI]`诎/HE0H5Hx(?HH¾tHIt$Ht*HHƕH謕HE0HPhHZHXho0螌IHf@@ HC`IL{`0Lm0jHHf0@@ IE`Lu0HI]`6fHI@@ IF`IEMn`M1LxHTHU0HcBp3HHIt$HJpHBxLcDHޓ~HE01ɾ]HHPhLzHLxhԌTIt$H?IT$E1!HtHH$lH$AIc1HtH H9|͹LqHeHE0WHHPhHZHXh HE0Md$ 1ۃhp%I$H9ItHHcMu1fDLnHvH*t^LHtOAUlI|$A|$ H]0{It$HfDE1H(1[]A\A]A^A_+10IHf@@ HC`Mt$IEALk`V n b ID$MHt H8`It$H-]LrH@M|$1ItHkHc1MtIH9|ID$Ht H8HE0HPhLjLhhALnAE7 w  LH蛆HsbAŅI\$HZH;P1fDHtH[AIcH;|"fHvH#.It$HH HE1AH(1[]A\A]A^A_+HF Ht H8 H(LH[]A\A]A^A_\#@H=1hHD$H0H]0萇IH f$@@ HC`IELk`0H]0WIHf@@ HC`ILs`0L}0#HHf@@ IG`HI_`0L}0IH@f@@ IG`IMG`HU00LD$HT$豆HT$LD$HIf@@ HB`ILz`HU00LD$HT$iHT$LD$HIf@@ HB`ILR`<$HML$MMLT$1HھxHPHU0LT$L$HcBp&HHIt$HJpHBxLL$LT$M}2HȍhHE0H5 Hx 7HHHdH33HH~HE01ɾyHHPhLjLLhhtH}0L蛤3H&HE0H  dHHP HHIt$HHxWHÌcHE0H$1ɾnHhp@HE0HHPhLrLph{HE0HL$tHHP(i kHߌLsHBXH HE0L$E1IL$LT$HPhLBL@h7HH9HtHLT$H $`LT$H $AIcHu1H^40 H5i  H)H81/ff.HFHvHwL(MMu1L9}HID$HHtdHI9u^fDLn(Mt5I}~.11@ItH#SHcI;E|ED$0It$LH腲%HU0ID$HzHHHBHHt H/uHGP0H=zcpIHHH>I.u IFLP0H=lcpIHHHqI.u IFLP0HE0HpHx 4HdH¾dHLLH=bpIH'HH茺I.u IFLP0It$ HHE0HzH@Hx H53~3HHdH赉SHH YHI0MGHʈj11LHI.u IFLP0HE0It$Hx 2HH-dHIL$IT$Hy1*IEH9nHΈHcMu1fDHH5 DH@EIt$H @H <  7gSuDImMIELE1P0H4$H菸IL9t$ID$fDseHHH;1 pIHHH0Imu IELP0u@H5ݫ H(H[]A\A]A^A_I}H5} WwH]0AD0f~IH f@@ HC`IL{`0Lu02~HH HD$f@@ IF`HI^`A MHMt$MttHNHQ0lRULv/1ULv1z@1qltUL`vl1OL蹭=H5L=!fDAVAAUIATMUHSHH`dH%(HD$X1H=qHD$Pf1)D$)D$ )D$0)D$@ˌHD$HHHEHHLd$PHl$VHD$ IHMAEA $A$AELl$(Au HD0LHHDt$0D$8詇HD$HH5HHl$E11HH}LcLjD$41ItHHc1MtI$H9|վHDHI赡%HH5W H81E1H|$Ht^H|$ Ht|H|$Ht H/uHGP0H|$HH/uHGP0HD$XdH+%(QH`L[]A\A]A^H=LDZHUH@E1D$ 1Ll$ /@H|$HN]DH=v YHHHN@QIHHH5* H8@HsHd@HE1MHsHTt1afHH5 E1H81MrUHrZLcqff.fAVAAUIATIHUSLp;HtKHLIDLH@HmIt[L]A\A]A^fDHEHP0[L]A\A]A^fE1[]LA\A]A^ÐAUIATIU9HtGLHL1H$UIHtI1LH跂IHIL]A\A]E1]LA\A]@AWAVAUATIUHSH8HFH^ H$HF(HD$ HFHD$HFHD$BD$HtIH;~CE11@AIcH;},HtH菨uH81[]A\A]A^A_f.H4$H褥HD$(Ht1IHtH$E1L0)fDIDLHHPH0衸 AIc1MtIH9|H$H@HtHPHtH0LH_H$E1ELHM'@IDLHHPH0)AIc1MtIH9|H$H@ HtHPHtH0LHOH5pHHT$ LH迷'IEIH1ImuIELP0fDED$0T$LHHt$臗dHD$H@8uHPXdH5RE1HE0Hx HxkH$1HHtHH $HE0HIHPP1HtHHPXHD$Ll$L8M9IM9KtHuHH= 9UH:HHfDImzIELP0kLn8ImIuHD$ IELP0LD$ MH HT$dH+%(rH[]A\A]f.JH 'wȾHEk+ILu:uHt/A@HH sIxH<$H/<#xswHs <*HfH}1DA@DOHWizuDz6uJA-tY_tTHJ<euzuA"HtID$ L[]A\@I,$u ID$LP0E1[]LA\.^IHtHLI\$[]A\DATIHUHOHtiHMtILHH5&1 dIHmtHL]A\HEHP0HL]A\H11cIE1ff.H `H PHHt$HtBH;5t9HFuHt$1ɺJHfD1UH@111JHH3bHtH@PHDAUIATIUH9\HL>=LHHP7HtHmt ]1A\A]@HEHP0]1A\A]fDHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$VHD$dH+%(u 1HOfAUATIUH HodH%(HD$1HUH0H9HAAŅHH0H9HAHH0H9tHAHHt$L8u+Ht$L,uL CHH|fDE1HD$dH+%(H L]A\A]@Ht$LRuHt$LrHuL7HHtH5IHZH|$H+|$H"\IHVP  HH0@H@HHEHt$H9t$~LHA 4\HH@xLσ@@A<8@xH: HH9t$Hmu HEHP0HT$LH= 1JIHt$LSIHt$LL-HHHL$HD$H HH)H9~ H HL$H9^} LU0LMHA@A <@E@LID4A HH9tuHAH9uIcZIH@ IT$0IL$H@HEHt$H;t$HLU0LMHD@E@LID\=AULA<8@yLA<8@yLA<8@yLA<8@yL A<8AA@yLAHyGDALHA LHOAGH9t$E AA @E@LID0\=AuALHyA GDAALAAGDAXEt;@LID4FAHuHHuHf.AxHyEtk@LIDpAfHEH;HEHHmu HEHP0HT$LH= 1iGIlHEHf.H@HIL$HfDHm-HEHP0!fDHm HEHE1P01 HHUH5x H81&IfDH2@ATUHSHH_dH%(HD$1HH0H9t H;tRHH L$$11WH= HL1>FHT$dH+%(H[]A\ÐHH0H9tIHY;u=HNH0H9t H>;tH~HcHHSH5t H81!eEH2@AUATUHSH(H_dH%(HD$1HH0H9tH7Ht$H@t+E1HD$dH+%(H(L[]A\A]fDHt$HuHw%HHtHt$HD$H HH)H9~ H4Ht$H9DM 1L]0LUHDEA@A @HHH9tCAEXELIDҋ vƃcHHH9uQIH@ IL$0IT$H@HELL$LT$M9>Lm0H]HADE ƃ I@@LHDB&#f c0==' =DA' Et[ELIDwHHEOELIDB@HUHHUHf'DHW0HJB;LT$IHQM9L1H= L?HmIkHEHP0\@@@LHDB@A LZMcJ|LfD1HIH#0FH9uKLI@t[@LHDBHNHEH9HEHiHUHAd[HEHf.wTH H`HSH5p H81CA IT$HNHmH1?B@H| =@BEA=@BɁ`D@B1 Aff.H@AWAVAUATUHSH8H_dH%(H$(1HRH0H9tH 3jHt$HEImtvE1HD$dH+%(H L[]A\A]A^fffL\$HHL9K1LH=CmL2I.IImuIELP0ƒ?HȀ?FʀVL\$E1fHfD^L\$w1fHfVfFL\$T@Et+@LIDHfIEHIEHf.H}HDI.u IFLP0ImIELE1P0IFLP0IFLP0LqRH u HcH>Imu IELP0I,$4ID$LE1P0$D"AA$(ImQBD"A$(D"fAEA$(J΃@Rփ@Aĉȃ?A A%AAA$(ffD"A$(MHHSH5b E1H81Q?@Imu IELP0I.IFLE1P0H}HFH}Hn2@AVAUATUHH8LfdH%(HD$(1HH0I9tkL$u_H8H0I9tL$Ht$H36{1HT$(dH+%( H8]A\A]A^fHt$H-uHt$HruHfIHtHt$1H+t$4IHHHT$LD$L9MT$0ML$HH)G@@@LIDɋ #w+ LD$HL9`AL$ Ήσ @uH}HImu IELP0I,$ID$LP01@t+@LID QxIL$HcfDIL$HfHt$H*pHIH\HHHL$1H+L$HD$IAI9f$Lt$ fCfIT$IuImAu IELP0LL2HHHT$H=Ll 1L-f1LH=gL,ImuIUHD$LR0HD$I,$}IT$HD$LR0HD$cImHD$QIULR0HD$?H1IT$H5U^ H81 1Imu IELP0EuH}HLt$ /fDUH1HtHHH*H8Hmt ]fHEH]H@0f1eDHHH8Ht 01HH=] >ff.@AWAVAUATUSHLo0H|$dH%(H$1IEh@ KIE`AH~1HHHu4fHD$P1)D$pHD$T$t)D$P)D$`0HD$PIH10HD$hIHrbHcH&HD$HHD$`H@Ht$HI߽hAD$\DpHD$DH@0H|$(Lh`IcHD$0HL`HD$ IHI)IDME1EMAQ~yfDII1HRHAH|f.vv1ҁƒHH9uIEQ(DM9t#MAAQIEQ(DM9uDMME1fABAz(IRH@HJLHB=v=v1=@ƃDAtBHB@()AEB=v=v 1=ƒ9DEHI9yMMEE|E{HD$0H+D$(HHD$(HD$H\$ L<Aw)H\$PD$XE1DHA H?HcHHH9H?H9H|$H4HcT$XAH\$PD$XDAuD$H|S D)E9oD$IcH[AH RIWH,DuAv!AAvE1AAAU,DT$t+L$xD D)D  H|$hHcD$pHwAMcEMiɁAI EAE)G D\$AMcI9|aDL$LDT$HDD$DT$8L$0H?HH|$hL9ILL$0T$8DD$DDT$HDL$L@H|$hHcD$pHD IcH4pfH@H9uDA)D$D$pD$pEȍHcщAHi H )LT$hDAA<Hc)IrH9`D\$HDL$DT$8DD$0L$H?HH9HLH|$heLT$hD$pD\$HDL$DT$8DD$0L$HDIt DNLcHFDJ4N~@H@xH9uHD$hD\$pASD\$pHpHcH9KMc1JD T$p@0HED$tD$XD$x8E1DH|$PHt H/uHGP0H|$hHtH/tWH|$`Ht:2H$dH+%(HĘL[]A\A]A^A_HEHt2Pt+AHGP0H|$`Hu11ۅADž|fDE1@HcЉeH|$hPLcHwL9~;1HEAEHD HD$ HPH9D$(HT$ HD$`E1HH|$hDD$0L$xD$pH|$hDD$0L$P딿0 IH&f@@ IE`I$HD$Me`H@0HPhLbL`ht+Hx H5JHHxbH|$d(tOH|$S'tMuII,$HmImuWIELP0HL]A\A]A^HAH5M H8,ImtCI,$u ID$LP0HtHmtE1HL]A\A]A^HEHP0@IELP0@ID$LP0HmZHEHP0ImuK@LH5H=:Y 1`AVIHAUIATUHH1HLIHHH@tEH}u>LmIEI,$I.HmueHEHP0HL]A\A]A^HH5K H8z+I,$u ID$LP0MtI.tMHtHmu HEHP0E1HL]A\A]A^DMtI.uIFLP0fIFLP0@ID$LP0I.;IFLP0Hmu,DLH5W H=W 1X9H-ATIUHSHHXH{8t%LE4t1H{HL[H]A\fD3t[]A\DHH5pW H8:*HAVAUATUSHL`1I|$8t[]A\A]A^1)3ID$87ID$@7ID$HHtYH|L@D11H, HHH{HdHmAu HEHP0EuqH(L9uI|$8tlI|$@tdI|$Ht\H=V HHt2H(tAD$P1[]A\A]A^@H@P01AD$P߸ H=I )H=I )fH}AUIATSHHXLc8Mt5MHW<H{HLDLIHt#HL[A\A]fDstDHQLH5oI H81]L[A\A]@HHH@t1H@HH5JI H82(1Hff.Ht@HHiH52I H8'1Hff.UHSHHTHHXH{8t&HtQHq1t-H{8HH[]+ctH[]HH5T H8j'ҐAWAVAUATUSH(dH%(HD$1HHIHHXH{8L1HD$HH|$y1H{@Ht$IHt;H|$HH/tLHD$dH+%(H(L[]A\A]A^A_fDN#HHu6H|$H/u#HGP0CRE1HD$H{8HEIHAH{8LZHH1HIHH;H@tFIxu?M9H{@Ht$LLD$1LD$xlHmM:H H5BG LD$H8%LD$I(t:fHm HEHP0fD E1I(uDI@LP0@HH5F H8"%H(uH@LD$LP0LD$IM9 @HLH5JR H81Pkff.ATHt(H(HAt DA\H@P0DA\ E1DA\f.AUIATIU`HtCHLLHHmItL]A\A]HEHP0L]A\A]DE1]LA\A]ff.HP HP pAUIATIUSHHHcHH|MtPLLH5#Q 1|&IHmtHL[]A\A]@HEHP0HL[]A\A]LH5: 1/&If.E1ff.Bf2fATHt0H(L` HtI$LA\H@P0E1ff.AUIATIUHH HtLLHH]A\A]k]1A\A]ATuHt0H(L`HtI$LA\H@P0E1ff.AUIATIUHHHtLLHH]A\A]]1A\A]AVAUIATIUSHD0AEH=3, 4HHMHLIE1HDH=O 1)IHmu HEHP0Mt:1LLI,$Hu ID$LP0HtH}H}Hmt6[1]A\A]A^uDH5HH?HEHP0[1]A\A]A^LHD1H=QN qICfHDH=4N 1LI@1%DATIUHHtMHL1HHu%IHtHmtHL]A\HEHP0HL]A\H11]A\0%11#%AVIAUATIUHHHHt$H0H|$MMS-IHtjLH5HxMLH5MLx7HHt$L HHtHxHHmImtH1]A\A]A^IELP0H1]A\A]A^L% MHL5,IH=fDH1H5@ H8H1]A\A]A^@H H50L H8\DHEHP0AfHHHHH8@HHH59@ H81ff.@HH5>@ H81@AWAVAUIATUH.SHH{IHH6E1H L HE1LeHHE HEH=1IHIT$H5K F HmIt,Mt I.MtI/t"HL[]A\A]A^A_HEHP0@IGLP0@LLL)"!LhHIHLH!=MI.E1IFLP0d[*HIHE1R@HH(H1HHE1DMtI.uIFLP0륐H H5> H8*DE1AWE1AVIAUIATIUHSHHHt9HYHHtqHH5LHmu HEHP0xHLLL IMtI/tHL[]A\A]A^A_f.IGLP0@E1)IHt I]E1ff.AUATIUH dH%(HD$1H|$HHt$H=w2HH;HyMtCHH=H 5!]1HLHH= !1H<$HULd$MMl$MtL.HPHLELH5IHH@q<HH= } MHLa xlHD$HtSH;tJHH={; xFH|$Hy!HH=v xfHH=MtI,$uID$LP0f.H|$HtH/tXH|$HtH/tXH<$HtH/t)LHD$dH+%(H ]A\A]fDHGP0HGP0HGP0HH=F 4WH5LAHLHH=T eDHH= \@[HH= f.AUATUSH8dH%(HD$(1HIHHFHHuHHoH@um1I9HT$(dH+%(H8[]A\A]fHIH~ 1ItHHI9u1@HUHtHtA$@vHt$H|$HT$ LHtMHT$ Ht$D$ H|$D$ 9f.@HfD H1=ff.fUHH]HAVIAUIATUSYHIHƄI9D$t0H5LHH|HHmt~[L]A\A]A^HEHP0I,$u ID$LP0uHLLH5P8 H81E1[]LA\A]A^HH8t[L]A\A]A^@I,$uID$LE1P0WfDATSHHt=HcHLdI$H(tHL[A\@H@P0HL[A\fDE1ff.AUI1ATIH5B UHL}HtLLHH]A\A]Rf]1A\A]AUIպATIH5B UHL*HtLLHH]A\A]O]1A\A]AWAVIAUIATIUS1HfDIW1@HDHE}@pHtHHHT$xHT$%LH*HQHmu HEHP0I/u IGLP0 I,$LLLHtI<$tFHmu HEHP0!t9ImM>HML`IM @I,$!uHI}H0tH=%6 H|H55 H8I,$LLLHRImM>HoH[]A\A]A^A_H9t"HmuHEHT$HP0HT$HHImM>H[]A\A]A^A_I/u"IWLHD$R0L|$H=5 IAUATUH@H|$Ht$HT$dH%(HT$81HvHLl$ Ld$(Hl$0LLHHt$HT$H|$Ht$HtH|$H H|$H/t}H|$H/uHGP0LLH]Ht$H|$(HT$ Ht$(H|$0jHD$8dH+%(u6H@]A\A]HT$Ht$H|$葸ztI>11H54 E1`AsD{AVL4$L LH=3 fDAWAVAUATUSH(H|$Ht$ HD$HHHD$HH\$D$HCH H8HPE1:<D$1D$ADIc1HtHH9H\T$Dk0t D9;uH{HtH5e HD$D$H@@H5!3 LLH53 H CqH9H52 S4s0H|$Ļ@H|$HD$HD$H([]A\A]A^A_fD$nLc1fIDH8 IHtH51 H,H5 LH51 LtrH51 Lt_H51 LtLH51 Lt9H51 Lt&H51 LHD$@Hc1MtI$H9C0HL$AHD$H@DHD$HJAE1HQE1HIpH9ZA@iHgoH5! H8'LH5% 1S4s0H|$߹f.ATIHUHHt=HLH'HmIt HL]A\fHEHP0HL]A\E1HL]A\f.HtHH1H@1ff.fAUATUHSHHhdH%(HD$XHGHHHHtHxuuI1LuLCLotfH$LLl$HHD$XdH+%(u^HhL[]A\A]fH1 IHE@H/ IHLIH/ HE$@AT?(HIHt8H;ypL`tH@L@HHo/ L1LA\fDHH L1LA\ff.AWAVAUIATMUHSHHhL6H$L$LD$AM~HD$dH%(HD$X1(t B<8]H .2 HcH>I115fD)tKzƃvStOuHqILt$PAV(uƒt HL$ $L$ tHELAtpHD$H;- oLtHEL@H$H" L1lLMPHT$XdH+%(Hh[]A\A]A^A_DHL$(|HD$ IHcD$(HI9t&HD$H$H{" L1L|$PHD$H\$8LHHD$(h@Ht$Pt$LH$MLD$8L$ I>HWIY^HuIVHD$0LR0HD$0AH" HH9\$ tJHHA6IHuHD$AH$H5, LD8@H\$8L|$PI@L;1fDH - H$H L1Mr HD$LTAE/f IMAEA~#H  ZMHE HHt$PHL$HL$HHHtKH;D$P8HgH5H8UAFAM<*t<#^/DȃIEAML(zHE1 Ht$PHHHHD$FH;D$PHT$fIUAE/P ƒIUAEHEL*} xHqImGAE/ ƒIUAELmH5zgHI9tLHT$uHT$)H*AE/ ƒIUAEHL*˾` AEAE/ ƒIUAEH}H5hL*H9  HHH(Hf.AE/% ƒIUAEHL*D$fH~HBHD$ImIEAE/ ƒIUAEH}H5[gL*H9_*RHHHd fAmAE/ƒIUAEH}H5fL*H9H}HH H=H=~HiH5 H8QAE/ƒIUAEH}H5|fL*H9KsHHHH=uH=.AmAE/ƒIUAEH}H5fL*H9 HWHH AmIAE/HƒIUAEHEL*S}  H} H;-whL^ tHEL@H ' H$HZ' L1AE/ƒIUAEL*HU H5cH9tHHT$HT$tHHT$HT$Hy H;-gL tLBH ' VAE/EƒIUAEHL*yfH~H6ImAE/7ƒIUAELM@ AFE1Z#HEHt$PHHL$[HL$HHL$HD$P H= AEM~hAU/LЃIEAUHHD$ HHUM~H L1H謣IH H@HD$HI@ HD$PA~#1H|$PLD$tH;D$HLD$I(u I@LP0H;--^LtHEL@H  /ȃIEAML(zu H;-]G HEHt$PHgH k HHSHL$PE1HLAHL$HcAPHHQH L(HHH HH$HU6/ƒIUAEHH(HEHT$HHt$PHIM  oHu0HEH@HEƃ-AEAHkH;-\fHEH  IEHPIUZIEHPIULHBIEH;-H\L/tMEH IEHHIM/IuD\$AAEL<>E/F HAMHzu H;-[L E1HELD$ HL$KHt$PHCHL$LD$ H\DL$IHD$PEDH=yA}IUHBIE)H}HE(AED|$AEE/SIMAEHHrIEH/4IUHAMH42/HAEL}L*Ht$LHt$M~/IMAEHHzH$H h HLղH;-9ZL H;- ZLtL@H 1LHJCL5BLH  H;-YLbHEL@ULH;-YLtHEL@H  )IEHHIMvH;-iYHEHNYH5 H8'T$AE0/ƒIUAEHD$(HIM~HpHD$ HT$HH8LJHD$1M9MHt$PLLD$LD$HD$HIEI(I@LP0IEHPIUHEH/ƃIuAEL.E1藸HH?XH5 H8YH;-XHEuHWH5* H8HL$P9(nH;-WL^HoXdIEHPIUH0HBIEH;-WLitHEL@H  HT$PLHHL$LD$ Hm|$HEIEDT$HHIEL9E8HHIMH  HVH5v H8H$LHH=˺5I}HVH5 H8bIMHAIEHN9(#H;-}VLdMGHxLD$LD$HHD$ HHH|$LD$HcGHHHOH HHHHD$ Ht$PH8HD$HHP\LD$R/ƒIUAEHE1HD$(HUH5v H8qI(u I@LP0,WIuHFIE'IuHFIE HnUH5 H8GH;-PUL7tHEL@H 9HE 3IUHBIE1I/w&HAMH;-TLu zr1IEHHIMIMHAIEH$LHH= IYHD$(HcHL9(Ht$PLLD$LD$HD$HH=hHL$(IUHBIE4H  H$LHH= IMXLLD$0|LD$0HHD$ HH2H|$LD$0HcGHHHOH HHHHD$ Ht$PH8HD$HHP|$LD$0!f.I(u I@LP0H h 1GI(uI@LP0HD$(HT$HHcHHHMH5 H81LH  HL$P8H , IUYI(uI@LP0HT$HIMHH$H|$PLH-IuIUP7IEE1A111LIHIAs|$HtIYH h hAE@fAWIE1AAVAUATE1US˃AHhH4$HHdH%(H$X1HD$PHt$8HD$@HD$HF<:t>*<(B<)EAHHt$8FH<:uI1@EH$EEHHD$8AUEM~H MHtLLH5 1H81֭|$H~#fDHc1HHD$@H0P;\$H|t$LH$XdH+%(@HhD[]A\A]A^A_@uT1E1f.<;t<|u8EED@E1AD$EuFAAEH=0Rt蕳uH$|$,HJ|$`HL$hBDl$,<$2Hxf;L#HHHD$@dHD$0HD$I9H sAL ٕLDMH z HEL1PH;H5H H81A\A]D$EfHc1HH$H0P;$|kHWH$HDŽ$fD1fH|$01kL- .LD$XD\$HŸD\$HLD$XH H$Af.H9Dd$dD1H5( H8D1$@Hc1HH$H0P;$|c$A]QE1PHHo9HL$h1H5 H81g$ Hc1HH$H0P;$|\$(D$,H LD$H5 9ND9؉H HMHy91H81D$EHc1HH$H0P;$|_H8H5 1H8$8Hc1HH$H0P;$|HF8H5 1H8eD$EHc1HH$H0P;$|H7H52 1H8D$EHc1HH$H0P;$|nH7H5M 1H8D$EEHc1HH$H0P;$||$,H LD$DH H5= \$HDH7H81,D$DL$E~)DHc1HH$H0P;$|A鋼$H$DL$@DL$H$)H57HH5 1H81藘$~#Hc1HH$H0P;$|݋$H$轈 H6H5 1H8P$~Hc1HH$H0P;$|H6AKL1H5 H81ߗD$EHc1HH$H0P;$|YH5H5h 1H81茗D$E.Hc1HH$H0P;$|ff.HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HtcHGtVHt HF tDHt?Ht:H$E1I$ HD$HD$ D$0HD$NH= w1HT$dH+%(uHHLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HtcHGtVHt HF tDHt?Ht:AH$I$ HD$HD$ D$0HD$@fH= w1HT$dH+%(uHH(dH%(HD$1HtKHGt>Ht HF t,Ht'Ht"AoE1$I@IHD$]H=$ 1HT$dH+%(uH(kff.H(dH%(HD$1HtSHGtFHt HF t4Ht/Ht*AoA$I@IHD$H=| /1HT$dH+%(uH(÷HHG tVt2H(H= 1HH12H52 D$ H:D$ Hff.fAWAVAUATUSLHIh0H|$(Ht$HT$HL$0LL$ dH%(H$1H$HDŽ$H$HEh DeEIcHD$AHD$HHDHD$@IHD$LH9D$HcC(HH;D$HHD$`EH\$8E1Hl$HLl$PA1A9HL$HD)HcH\|uHpHt$`PH$u HHD$`ME9HD$HHHHHIH9l$ H$L$Ht$`PMh$HT$0L$AYAZHH\$8HD$HkLk+H:D$1E~&Hc1HH$H0P;$|݋$.1H$dH+%() HĨ[]A\A]A^A_HD$0HLpHL$(HD$H LHL$@H9D$8HSH5#AL LDH n HHEH5 1PHC/H81豐A]A^D$E/@Hc1HH$H0P;$|HHH$HsDŽ$HD$HNDH$蓀fDHD$0L@M~zE1Dd$THl$XMHIL-HGt HӳuIL9K|H9uHD$@MHDd$THl$XJHT$HHHHHEHCfHD$@HD$E1f.H9*DDH5l H8121裏H$1ۅHc1HH$H0P;$|t蛀xfDHDd$THl$X.HH)HL$pH5 H81螋1;H\$A9AEND9AODk$k( ;wHH|tE)IcHHHcK HSIELhAFHL$Lt$xL|*LIIHD$xIEM9I<$u~HD$xHuHmbHEHP0SC 1E1E1HT$pHl$HM~iLt$MHD$hLl$pLd$xH\$h,fDHt$xHFH蒽ZLLHL)uŋ$Dk H/Hk0H/HC8H'H5O H81tH'H5b H8ڼ1WH'H5 H8轼1:H(IH\$8H:D9l$P|D9DH LD$NH ;K(HMH5G 1H$1ۅHc1HH$H0P;$|H$kyHw'L$PH1H5 H81҈D$ETHc1HH$H0P;$|+H&H5Z H81耈1DELt$0MnM71 LH蝻HI9MdID$uH&H5 H8/H$bL$PLH5 1$1ۅ\Hc1HH$H0P;$|4H"&H5a 1H8詺$ Hc1HH$H0P;$|H%HT$xH5_ H815VtH$תH%LH5& H81f.HIHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HtsHGtfMt IB tTHtO$HwI1H$D$0LHHD$HD$ HHD$jLL$ZYDH=\ 1HT$dH+%(uH蠩HIHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HtsHGtfMt IB tTHtO$HwI1H$D$0LHHD$HD$ HHD$jLL$ZYDH=L 1HT$dH+%(uH萨HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Ht HBt^HtYH$$ IHHD$HD$ H1D$ 0HD$jLL$ZYHT$dH+%(uHÐH=L 1覧fDHLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Ht HBt^HtYH$$ IHHD$HD$ H1D$ 0HD$jLL$ZYHT$dH+%(uHÐH=\ 1趦fDH(dH%(HD$1HtcHGtVIHt HF tAHt<oHHwIHLD$HA1HD$jLL$ZYfDH= o1HT$dH+%(uH(H(dH%(HD$1HtcHGtVIHt HF tAHt<oHHwIHLD$HA1HD$jLL$JZYfDH= 迲1HT$dH+%(uH(SH~HtH/t 1f.HHGP01Hff.SH'@Ht2HH[8Hx0H@8HtH@0H/uHGP0HuH&[ff.Hm @H @H @HU$HÐHAHH5%PHuAy[EJA0PLPу߀BHL"H@A< HHDAn0umPLPу߀X(HLP"HA< Hv]E1HAL9ARAfAL!A0ufPH0tA HD9SE1HG Mc%fMIPHAD9uN9r MLIsHu fDHAD9|HI"L[DEu@A L)!1GAtt~?AtAQ"E1HtHL@HtH[LEAuL @Af.L AfD0PHHAAAXtKAOpLU A<3HHASL, L?pL A<3HwcHALLо@LA QH0ttAHuE1HHABupLA<3HwH@A0PLPу߀Ou'HL>HA< HGLLо.IcH L4f.StLH !_Ht4uCըu$HHx>HHڀ-HD[ӦHyI"[H-uHH9HuUHSHHHw'IIɺHyHuH[]@fDH[]ff.@HHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$轜HT$dH+%(uH耞@HH7H8ǪH$dH+%(PH[]A\A]A^A_fDHaH8艪IHHIHD LrL}I,H)MLHH 1rHLL5 C}H1fD=AHL1rHH}HI9tuH L)H)ƅfLH HH)1DrL@ILMGHH# 1rH|HHL)ff.1E1AII!f)ttYt1(H9:XumHHH5 H8ڨHÀ{[]uHfD}uLHLu)tՀ(tGOH_A9bD@{t~ }uf[t ]t@AfH @HtgATHH9Fts H=4 1A\fIH%HuA\H1LH5 H81t1A\øf.HtgHH H9Fu>H~u HDHHH5 H815t1HfD H=t '1Høf.ATL%3SHHILIH  H 1~oHL[A\1H=rO@ffAWAVAUATIUHSHHH`0YuIH{`HEHk`Ht H/uHGP0Lk0MuM~L=1I|L9tHI9uH[]A\A]A^A_@HLuAUHH5P ATUH HdH%(HD$1LD$HL$tA1Et&Ld$Ll$I|$`LbXu.HHHT$dH+%(u>H ]A\A]fIl$`LLHEHHmuHEHP0AU1ATUSH{HtbL-II}HtR17HL譖xIHmu HEHP0CI|HHtseHHuI,$tDE1HL[]A\A]I,$tIHmuHEHE1P0HL[]A\A]ID$LE1P0HL[]A\A]@ID$LP0Hmuff.ATHH5 SHdH%(HD$1H#A1EtLL$$MtpHyHH3Hu\@HsHHtKL蓆tCx(HHHT$dH+%(uHHHH= 賮HmtJui1菩HHtZHH= 舮uGHmt-H[]fDHEHP0@HEHP0@HEHH@0H[]ؔH= 茠ff.USHyHtQH=Ht~HgHH9tZHt<7|H=HH+wH4HH[]H=y1貭t@YH[]f.hHDHmfHSHHHH=St\hHHtN=H|G1[fxH=1HHMG[H= &fDATE1bxHtH=uHtH9 GAt DA\-IAuHFpDA\HcWxHHHH H5 H81ff.HH=HtH/Ht+H=HtJdHHf.HGP0AWAVAUATUSHHdH%(HD$8H HHXLkM{H- DMEL%* H{(H5,,LGOL5XH5FL= (H{ I6LOx%IvIHt*DEEtL1蝂ØIvIHuL=H5" L5| JIwH{ +HHH{ I7HD$ NIwIH}tL1fLH{(lIHH{(ڦHs`H{(=hI/u IGLP0u[o_MIFE1HD$HIFJHpH@ L@H4$I8~cM9t^LLD$0zH9C(tKH9C tELD$MItH4$HFLL$kL$I(u I@LP0IL9|$pI.u IFLP0UuH{ SEIH{(SHCImu IELP0JnHD$8dH+%(HH[]A\A]A^A_H{ I7LLd$ L.菖IwIH)1臣IH#HD$(L|$ HD$0H$HD$0HD$f.H$Ht$LLcHD$ H58HxH9t |tƋutHt$(HFMH|$ 1ԊHHt$(HD$H¿1uLD$HHLLD$HD$LL$LD$yLL$LD$rLD$LL$I)uIALD$LP0LD$I(uI@LP0fDHt$(LLfDH= 1WD빐LD$LD$H= 1L$VWL$^DH= 1:WDH= 1"WxDH=8 1J~4DkGfD[I/\M@CfD3H{(Hs`H{(Md 膈fDAUATUtH5A H@Hx0HtiHH59 HHmIt%MtHLPbI,$ItL]A\A]DHEHP0@ID$LP0L]A\A]@IH=4 AWAVIAUIATUH$H:H}H5HH9t yH辌IH!mHLHI̢LHPI|$8uDI|$ HtID$ H/HDuHH3gID$ HLL1rHHtkH=D LH9HmAtD]A\A]A^A_HEHP0@HGP0p@裣HH밾'H= 踓똾,H= 蠓LL3}pfATIHUH nHtBHLHHdyHmAtHD]A\HEHP0HD]A\Aff.AUATUH蟓HHI[HtHxH51IH9tNwuE;eHu[H~IIHtKHHL踠I$u HI$u ID$LP0L]A\A]fHI$u ID$LP0E1]LA\A]ff.@H=TAWAVAUATUHI1IppHHH=HsHmIMI8IGHIHt|gLLHɟI$HI$LLMHt1LLH= 1*R]LA\A]A^A_DI u!E1]LA\A]A^A_HEHP0:L(qIHtHqHHtIw g_aDID$LP0J{LHpzI$HI$nID$LP0^ff.ATUH0kHtCHHHݝHmItHL]A\HEHP0HL]A\E1HL]A\f.ATUHRHt;HHpHmItHL]A\HEHP0HL]A\E1HL]A\fAUATUHoHt.HL-GpLHIqHtL]A\A]E1]LA\A]@KLLHCtHHI6qHtHLxyH= fDAVIAUIATIUH跏LLLHFwIHt>H(t(LHpIHt]HHL]A\A]A^fH@LP0@[LHHpHtLH=xyH=B =DH1LH5_ H81]]ff.AWIAVIAUATIUSHHHHHh_HIMH}0H5 j~HHtqHMLLjHIH5>1ߎIHEHHEZYHt)Mt3I.t>HLLL[]A\A]A^A_rfHEHP0MuH1[]A\A]A^A_IFLP0@Mw`MAWAVIAUIATUHOHkIHHXJHHDML;JIH?LHLLNI,$Iu ID$LP0Imu IELP0HtHmu HEHP0]LA\A]A^A_DMu11LH,NI,$IuID$LP0DHHH@HHx0H5 |IHt21HH1H5p<+I/Iu IGLP0M:1LHLMI,$I)ID$LP0@I,$t)E1]A\LA]A^A_ÐI,$ADID$LP0H= ?ff.@11~1~DAWAVAUIH= ATUSH_?H= HP?HHHHcoIHLHlIHtI$}f.HLHޘuZE1Mu?D1L1OIHuLHMH8\t!輈IM9t[HLBHHuE1HL[]A\A]A^A_HLHZI,$u ID$LP0:@L%A(ff.AUIH5iYATLUSHPzHtWHHH=IHtUHmtI$HL[]A\A]HEHP0HEHHEu HEHP0HE1[L]A\A][HtHmuHEHP0H踕IHtHHH3HufHsHHHmtHCHIHtHxH5H9ttmukL軀H&HSHLHPHnHEHHE.DHmu HEHP0L%Hmu HEHP0HLL[]A\A] dLTHmInfAWAVAUATUSH8dH%(HD$(HHLpH9HGHM IIDH}HHEIH$I~LziIH;$UHLHHH5v7\HHH5>7HD$[H|$IH/MtmLLD$LLD$I(uIPD$LR0D$t>~?I~01LH561HHH(uH@P0 MtL;$$tLXL8JLeMILImu IELP0Hmu HEHP0MHD$(dH+%(H8L[]A\A]A^A_DINhI~0E1LH551IHEImeIELP0VfD諏>fDMIE H55LRH54LIHH$I9nRMeIWI+H;$tuHtpH5y4HYIHHLImuIUD$LR0D$x}u&H_H5S H8;ox\IOHAuHfAD9A1Ҿ.LVHHuI/IGLP0fHD$HGP0LD$M)I~0MFhE1LLH531AHIELIHIEKQHH;$H5!3HXIHtQH@HQH5B H8څ*DHIH5^ H8躅f.Hl$ Ht$H|$HoLl$M HLt$ D EsH LH0ahD$MTH,$1L-r ]DD$AHE$[H;MIL;H/H/%HGAP0H$MMIFLM~Hh H}`pguH}`H5A \gtE1IFH$1AL.HTHHHH1?_HHE1111HHmHHEHP0DHHt H/Lt$ Ll$Ht$LLE1cuH$AH}hH5 AZfDH H5H H8蒃D13IE1LL)HL^IHtI~H(cI,$Ht6HvH@HH5 H8"mDID$LP0HAH5} H8k5H5/LMIHHH@H5~/LMHA xL>IO1AL.RHHHW1L-]IHI/IGLMP0%DHH5IHHHHHCH;C OHPAiHSD HL3C  {8^HCH;C tHPAxHSD HY@11ҾgxIHHFIHCH;C HPHSD(HLLL0H511ҾgwHH*HQFIHCH;C HPHSD HLHH?0C H]H59 H8r.HCH;C QHPAsHSD LeIHLH} HL!C HCH;C .HPAHPA[HSD LmISHLrMIE1HEHJ< IM9udH j{8IHC~ IH;C pHPA(HSD IHLE1MJ|HIM9uHCH;C HPA{HSD H$Ll$Lt$IH|$HSD 0HHI} HHHHCHHCnHHCHCH;C HPAcHSD Hc}H7Hc}H+Hc}HHc}HHc} HH}(HH}0HH}8HH}@HH}HH{H}PHoH}`HcH}hHWHc}$HH}pH?C iHEHP0H HC(H9MHPAAHSD E Lm LeH@tLe0IHLH1HCHHCHHCHHCHHCLeHDHHCH;C \HPHS?H9HPAaHSD H=HHC0HHCH9HPAzHSD wLeHHHCrHHCH;C HPA)HSD HCH;C HPHSD(DHheHCMHJHCH,HCHHCHHCZH7HCHHvHHLHHCXHxIHC1HZHCH<HCHHCHHCHWHC?UHH $HH $HPfdH%(H$H 1HD$@D$(HHD$(HD$H$@ HD$8H4$HD$ T$8D$iHHH|$0Ht1H5f1H|$0>H|$(HT$H $H)kH$H dH+%(u@HP ]DH H *HD$0Hl(WfATfUH1S2HPdH%(HD$H1)$)D$)D$ )D$0|ZHD$HVL` HLd$(Ld$x&D$Iĉ\$8Ld$ HHH|$0Ht1H5ͱ80H|$0=Ld$MtTHt$I H|$L)FD$Ld$HD$HdH+%(HPL[]A\DD$tӃH5n H HEHcE1H8efDH YHS)HD$0IH='H|$H/uHGP0QfD'E1;M_I,$TID$LP0D$@UATHH5 UH(dH%(HD$1HL$HT$D$LD$$tkt$H|$}HHtUH|$H1H^ H5]HmItHD$dH+%(u#H(L]A\HEHP0@E1&UfDH(HH5 dH%(HD$1HL$ HT$D$ $A1Ett$ H|$HT$dH+%(uH(TDAVAUATISHHhH~0dH%(HD$X1H"L;f8H{IE1H1A LLA)L+HHH{He^ H51I\IHt,HLH0LI.IuIFLP0M9u+Ls0HD$XdH+%(HhL[A\A]A^@k3IHtkE1fDH L8NIL8(HHt$HC0Lc8LHlHC0HHuG$E1hM9}#H LLH5O H81U/9HYH5 H8ZbRHG HtH;G(s9HPHW DHt9HHHtHøHH?HpHHG Ht3HW(H)H~FHPHW H%HH HfHHuHDHiH51 H8jaHHff.AWIAVAUATUSHdH%(H$x1AWJAO(Ãō@؃〃SH HcH>HYAWH5 E1H8`H$xdH+%(HĈL[]A\A]A^A_@HyH5 E1H8w`DHH5 E1H8W`AGPAWf.LXI0IHo AGE1PLIML)IMHL(IEMo Mi IG(L)Hb IEIG LU1f.|g a $/$HI AGE1Pf.Mo M IG(L)HIEIG L#2IŅ AGP@LIMDLIMDMo M IG(L)HbIEIG LU0{f(f.$ztD$.T$HZAGE1P LHc4Iw H IG(H)H9MH.IG Ld$pHLj&11LD,p%zfH~f.$$  2.H E1AGPjf.[kHD$hHŅHfL8HH L$IHH|$hHHXiHE HHEu HEHP0I,$uID$LP0@L8Hp-IHAGE1PDLA-H AGE1PyfLI-IHAGE1PEDL8HcIw H IG(H)H9H.IG H|$pH$11D,pH f.$y $v,$HE1AGPfLH@,IHH HH9HHHHHHD$HLpHD$LH=߾11HD$hIHAGLl$hP L?IH AGPHLHH5 H8 TAGPIHmH5 H8SAGPH HmPHD$hIŅH2 Ht&1LEHLl$hIDHH9uAGPHJI@HD AGPH|$h]Ll$h AGP IŅ HI@HDImIELP0f.LxLcIw H IG(H)I9 J.IG LL11LBD,p5f.$f(zu$" $HfHnFYIŅuLHIbLHHH@@HH5 E1H8QAGPLHHHhHHEu HEHP0I,$)ID$LP011OIHH5j H8bQAGPI@LB AGP@hMI,$u ID$LP0HH5 H8QAGPHFIŅ AGPHYHD$hIą\ H H 1LSHZ HT$hHRHHH9uLl$hAGP#L1 DHD$hHH2Iw H IG(H)I9 J&IG H} LZo AGIP1)1IąAGMP1<*HD$hI@HGH$H=9H5ÿ>AH|$hH<$Hy(H HD$hH/ HGP0HD$hHm 1MtOl$ILHH H|$hH<m Hmu HEHP0IM9ul$Ll$hCHD$htLHHD$hH$HH5 H8"JAGPHH58 H8JAGPHmH5 H8IAGPILd$\$ HD$D$\$$LE1EIafIV(H)HHPIV H=+fD9<$7AD9=IF HuLHuMuHI,$5AGPH޳H5 MH8HHóH5 H8HAGE1P`DD)D$WHH5M E1H8HyfDID$LP0AGPMAGPH|$hRLd$h$AGMPAGPLLHH&AGPI@L{9AGMPHI@HO9NAGP[LLHHHH5ځ E1H8oGAGPHI@H8x^Ld$hIHH|$hH/HGP0HlI@L8x{AGMPI,$u ID$LP0AGP~HH5 E1H8FAGPYHI@H$8AGP0I,$AGPImAGE1PAGPImAGE1PHH|$hH/uHGP0HD$h\$MOHPHD$t$AtAFMPqH|$hIH/uHGP0I.uIFLP0Im\AGE1P0LLeHH/H|$hH/AGPH7H5 H88EAGPHH5~~ H8EeMAGE1PAGE1PAGPMHGP0AGPsID$LP0AGP\LH1HD$h*AGP;AGP/IELE1P0AGPIELE1P0AGPImAGE1PIELE1P0AGPAGPI,$Mu ID$LP0HrH5S| E1H8CAGPMMID$LP0AGPeP4LH5IAGPFI,$AFE1P,HݮH5&} H8fC2HJH5 H8KCIELE1P0AGPI,$AGPHwH5@} H8CHtH5| E1H8BAGPAGPzImtAGE1PdAGPXIELE1P0AGP?ID$LE1P0AFP%ID$LP0AGPLT$PL\$XHAGPHl$hLd$IE1#IwHtDLLT$HL\$PI,$uID$LP0L\$PLT$HMgI$MgE1E1E1E1E1Ld$IAGPCH$H|$hHH5{ H8kAH$H|$hHD$E1E1E1JHD$E1E1E1HD$*HD$E1E1E1HD$HD$(Ht$HH$HHH|$E1E1HGP0fATIHuLYIHt1LA\HE1H2{ H81LA\fHuHǫH58{ H8P@ff.ATI1H(: UH5LHXdH%(HD$H19HHH@uQHPHNH5z E1H81 Hmu HEHP0HD$HdH+%(HXL]A\f1Ld$D$H$HD$HD$(HD$ HD$0HHD$@IH}HH|$@IH/tH|$0HYvOHGP0H|$0Hu8f.E17/ATHH5 UHdH%(H$1Hl$PHHD$P1H$HD$HD$ HD$`HD$HD$(D$GHD$@HtYHHIfEH|$@H/t+H$dH+%(u-HĸL]A\f.HGP0E1.fDATHPdH%(HD$H1H<$1HD$HD$D$HD$(HD$ HD$0FHD$@IHt%HAH|$@IH/t3H|$0HtHD$HdH+%(u'HPLA\f.HGP0H|$0Hu-ATHPdH%(HD$H1H|$ HH|$(1H$HD$HD$HD$0D$FHD$@IHt%HrH|$@IH/t,H|$0HtHD$HdH+%(u HPLA\HGP0H|$0Hu-AUHH5X} E1ATSHdH%(HD$1H.5t`L$$MtyHHH3HueDHsHHtSLtLkMt^fnCLf8f~Hc}IHD$dH+%(uOHL[A\A]DHQLH5o E1H81zH1LH5v H81],fDHAVAUATIUSHHHH3Hu DHsHHLtH{H[HHcHHHH9EukLHHtnLH耩IHt[Hmu HEHP0I$HPI$HuJIT$D$ LR0D$ 5@H٥LH5u H81=Hmu HEHP0H[]A\A]A^f.H1[]A\A]A^ÐHLH5?u H81H[]A\A]A^LHHt1ICIHhHH5z LImt @IELP01ff.UHH5z HdH%(HD$1HE2tQH,$H:xAu'HHHHT$dH+%(u(H]fDHHtHD1)ATUHpHt8HH@:HmAtHD]A\HEHP0HD]A\Aff.AUATUHHdH%(H$1%H*uwLl$0IEH=wfLAIHtVLHHs#LHLI]H$dH+%(uAHĠL]A\A]f.H$dH+%(uHĠH]A\A]IT(@ATAHPdH%(HD$H1HH<$HD$HD$HD$ HD$(HD$0BHtD H|$0HtHD$HdH+%(u HPDA\'ff.ATHPdH%(HD$H1HH<$HD$HD$HD$(HD$ HD$0Ht;AAII H|$0HtHD$HdH+%(uHPLA\I 'f.AWAAVIAUATUHSHH(H7dH%(HD$1H~I>O:~B9wHX{ HcH>SHH5q E1H85f.HD$dH+%(] H(L[]A\A]A^A_f.LHH9(u)2HD$dH+%( H(AHL[)]A\A]A^A_ E/ƒHUEHD$dH+%( Hc: @~&E/ZƒHUEL"M IxNI$E/lƒHUE?#L"MLHHD$dH+%( H(L[]A\A]A^A_8fDE=:ƒHUEHD$dH+%( H([]A\A]A^A_E/ƒHUEHD$dH+%( H:@}膊D$ dmAIH6 D$ D$ul @HL+IHHLLq?I/u IGLP0Imu IELP0D$D$9D$ HLIHuL$ Aغ}+L$E/4ƒHUEH|$D$s&I]nD$ Lcl$ L;IHT$ E1u$fIT$JIM9HLD|$HuӋL$ Aغ]+L$HLI,$u ID$LP0E1KE/dƒHUEHD$dH+%(:H([]A\A]A^A_E/ƒHUEHD$dH+%(EH:H([]A\A]A^A_fDE/ƒHUEHD$dH+%(HHH([]A\A]A^A_=8DE/$ƒHUEHD$dH+%(:H([]A\A]A^A_&E/ƒHUEHD$dH+%(e:H([]A\A]A^A_!E/dƒHUEHD$dH+%(H:H([]A\A]A^A_f)fDE/ HUHBHEI>?#L" MLHHD$dH+%(H(L[]A\A]A^A_kE/ƒHUE?#L"dM+LHHD$dH+%(MH(L[]A\A]A^A_6#fDE/ ƒHUEHD$dH+%(H:r@H)HUHBHEI>@HUHBHEHUHBHE7HUHBHEHUHBHEoHUHBHEHUHBHEHUHBHEHUHBHEOHUHBHEHUHBHEI>l@ƒHUEHUHBHEHUHBHE/HUHƉMH42/HʉEHLI>HD$dH+%(XH(L[]A\A]A^A_@L%I$I8]HIHEI>G/ƒHUEH2MtHxhHEI>/:ƒHUEH2M]HHEI>/ƒHUEH2MH HUHBHEI8}I,$u ID$LP0H:H5m E1H8X,HEHPHUH0HBHEI>_/ƒHUEHc2/ƒHUEHc2L$ Aغ}HL+L$I/IGLP0/ƒHUEHc2L$ Aغ}HL+L$8I/u IGLP0Im8IELP0)H'H5l E1H8E+L$ AH}LYIHHH5f H8+-HUHBHEHUHBHE-HUHBHEHUHBHEHUHBHE_HUHBHExL$ Aغ]HL0L$ Aغ}HLHU AWAVAUATEUHSHHcIHXT$,dH%(HD$H1&HD$ EHLpAEHD L|$0HD$HD$8Ll$@HD$IIL;t$tjHt$LLDHHTHT$0Ht$8H|$@HD$ HD$HtH|$ uH(uHPHIR0L;t$ufDHL$ HtHHD$HHt=H;T$,uGT$,uyHD$HdH+%(uuHX[]A\A]A^A_f.HAHP0H;T$,tHD$HdH+%(u6HH5i H8HX[]A\A]A^A_(fDHH{Off.@AWAVAUATUSHT$ L$xHc\$IIDH %IHL$E1ugKDII9tRLLD|$HuۋL$T$ ALL+L$I,$t7E1HL[]A\A]A^A_fI;T$ u$T$ tHIID$LP0I,$u ID$LP0HwH5h E1H8'돋L$T$ ALL-tATASH1H8dH%(HD$(1H|$}xktIoHSHt$H|$HT$ D$t8E1tHT$(dH+%(u0H8[A\@HHDfD1off.@HHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$1HHD$HD$ $D$0HD$HT$dH+%(uH@H=AWAVIAUATU"mHHqHH5HIHIGH5L IHjL uLIjHH5f L1A(IXZMt+I,$D#LHIH`HHmu HEHP0I/u IGLP0MtImu IELP0]LA\A]A^A_E1IHFf.H= DHHt/H=$h,H}Ht1-HzHE1]LA\A]A^A_fE1111H= IHtH5$H1H=}e HHmI/uIGLP0DID$LP0HmAHEHP0+HHLH8HH5E1H8^f.ATUHHt;HHHmItHL]A\HEHP0HL]A\E1HL]A\fAUH=}d ATUSHHHfIŋ3H=2 HHH5HBHmItHMtR1LLfI,$u ID$LP0H[]A\A]DHEHP0Mu|H=^ tH1[]A\A].fDH=c 1<D; H=c uH[]A\A]H=c HH5Ac H8!H=c p"AUL-D ATIU8 LH]HtPHHL1Hi HH5+)HmIt L]A\A]HEHP0L]A\A]DLpHHuE1HHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$HHD$HD$ $D$0HD$HT$dH+%(uH1DfATIHUHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$OHHtG1LHHmIt HD$dH+%(u%HL]A\fHEHP0@E1fDAUATIUHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1. HHH$LH$HD$HD$ D$0HD$AIHtq1HH|HmItBI,$t+HD$dH+%(uVHL]A\A]ID$LP0HEHP0I,$uDHmu HEHP0E1ff.fAUIH50ATIUHHH9t HtOLHHtlHLAąuRHmtD]A\A]f.HEHP0D]A\A]HuHԈH5Y H8]DALAH5!_ HHH81HH5Y AH8 a@AWIH5IAVAUATUHSH(, HIH@L'1ALH.IHxIEL1H5HIHk^ HD$MA_-L1Hy^ H5MH$IHMHHLI.2H5C^ HS HHgHIHVID$ H|$LIV HHD$UI.Iu IFLP0MiHLHHD$%IHL0MtAHL$IHbHMfHI~H{H5$H9.H(] H9D$ZLHuLxHH5~LMHHLLxBImu IELP0I,$u ID$LP0H+ucHCHP0Wf.E1ImI,$u ID$LP0HtH+u HCHP0MtI.u IFLP0E1H(L[]A\A]A^A_ÐHH53\ H8ImuIELP0HpLLHHaIFLP0HCHP0I.f.IELP0HъH8H+eHCHP0VHHI.?IFLP00f.E1HHT$Ht$H=nU iIHHLHoI.eIFLE1P0V1H5Z HIH5HZ HD$RDHCHP06fImu IELP0I,$u ID$LP0H+u HCHP0H(HL[]A\A]A^A_SHT$H5T HE1H81fDHL$HnSH]HHT$H5gT H81;HT$H5T HHT$H5T H81} HWHT$H5T H81Qff.AWHAVH5Y AUATUH dH%(HD$1LL$LD$HD$Ll$H5XLt$LBHHtrH5Y L+IHtCHH"IHtpHmu HEHP0I/u IGLP0Mt%I$HmuHEHP0E1HD$dH+%(H L]A\A]A^A_HuMtAH5 Lb IHu*Hmu HEHP0I/uIGLE1P0@LLHmIt3I/tMgLZIGLP0@HEHP0GAUIATIHUI HtHLLHt Hmt]A\A]DHEHP0ff.ATH=iIHtH5q HLA\AUIATIHUiHtHLLHt Hmt]A\A]DHEHP0ff.AVAAUATIUSHfD9H=v=v 1=ƒAv,Av1A9cLcfDALcIHt]M)L)DMH|EaL)J|e H]A\A]A^If.DHHHtfDHH5SIHHarenegylI8IuespemosImodnarodHH@I1H1I1HsetybdetH1HHIIJ|DH MI HM1I H1HHH1LIIHI1L1H MHI HM1I H1LIIHI1L1H I1H9uIJ41HwdL e Ic L>fDWH0HOH!H(H HOH!H H H7H!H I L1LK4H H H[H1H1H HH40HHH1H H1HH HHH1H1H HHHHH1H H1L1ƀHH HH1HH1H HHHHH1H H1HH HHH1H1H HHHHH1H H1HH HHH1H1H HHHH1HH1H HH HHH1H1H4HHH1H H1H1DWHwI HGHt8t#uHxZHHHÐHx[HDHHHxHDHHHHHIHILHHL9}3HFHHHHHH)HHHH)HGHHuHHHHЃtff.fH(D$tqD$t&tBf/:D$r2f: 0f.f: D$D$H(ff: D$D$H(fL$f(L$KL$Of(\fTm9f.zuYf(XffUf(SHfT*9 J9dH%(HD$1f.sDf.wHT$dH+%(H[]f/8/H4HFfDH|$^f۾f/Cf.Ë\$z%`N{1IIII:@H,Hx^fH*\HL9HJ HGf.HztZYHH!HL!H f/rf(\H,L1HyHHfHH H*Xf1fDxtHcHi?%CH$)k=)ÉHЉHHH!ȹ=)HH HHH9HGifWP7H@ӉHi?%CH$k=)؍x AWAWH IHILLfH+u HCHP0ImtzfI.IFLP0H+uHCHP0fDfDHWD$R0D$-@H)gHD$HLHE@)1I.uIFLP0HE@HP\HEH8HEHH$kIHt;H;Yt2LHADžt LH=uA?H5H9H5HIHAH5_HǻIH+H;DYHH5蟻HHHD$H|$D$H/fT$HH5[HHH;XHD$hH|$D$H/uHGP0D$GH5HHD$HOH;XHmu HEHP0T$1LH='E 薱I/Hu IGLP0Ht!LH.Hmu HEHP0H}sHD$HD$HH;HHND|$Et'HIcH9uAGHcȀ| AEljD$D|$HIcH)H9}"HHH)HA)׾ HHuE< HHA /@H)D$E< L=LLLH}tH5H ur| HL$tHbrLHHD$Kl$tALLL=\-~fLLuLH=C HL$HHD$HHu HAHP0̶LHAf.kfDLH=FJ LAHEHxLH=]AlzH([]A\A]A^A_HXqHD$H$LpMtL.bHPHLEH<$H5'HtHPqH(uHR0LH=E AEzEH|$LAMtImu IELP0Hmu HEHP0E<H([]A\A]A^A_!fDH訥HIMIMLH$eL $HHHLL $vH+L $uHSD$HR0D$L $1ۅu'LLLL $LH={@ L $MtI)u IALP0I/IGLP0 fH5iHH$譲L$I(u I@LP0LMDLLAEfH;-SbH;IH'H@t L Ht5LH=yEADžtI. IFLP0fDLL`Ac'fD蓳H@I.MtI/t50HnHD$#HhnHD$IGLP0@H}81I)IALP0fIFLP0qHGP0@LǺLL$|LH=? AL$AI(I@LP0HH$ΜL $HIHLL $I/L $uIGLP0L $'LLLL $bLH== 3L $H^qH=c A@LH=n> AfHiQH bQHHD$HHu HAHP0H= IHtHf.I.IFLP0L $1L $@HPH PHHD$HHD$HAHP0fDD|$^HPH PHD$HHHHAHP0HD$誰HL $1QL $mAUH=IATIUEHID$@tMtH`OI9EH;-Ot-Ht01IHHLH?Imt8]A\A]fL舭HP]A\H} A]H81fDIE]LA\A]H@0fDLHHt8H(`H@P0TfKLH1]A\A]fLL"AWAVAUATIUSH(H4PdH%(HD$1H;茑FSuRH;LH; ž1"S-H;UHtH OHH9tU@軘L|$Lt$ILLL`H<$H=yIHH6NH9LLLH|$H|$Ht$tH<$HtgLl$Ht$LٹH<$HtH/twH|$HtH/t^H|$HtH/tEL1H51HHtSH(tI9u]HH@P0HGP0HGP0HGP0HH\$9WDAUATUSHH=O HgH2HƻIHH HH5OL HmtIL-M LLHL-q@LLdHt'H;LtH[]A\A]HEHP0@H{0H59 HHHLL莎xzHmuHEHH@0H[]A\A]@H=کLHHt\HLLFxVHmAHEHP02H=1@ |H=8 pH=@ dH=@ XH=1@ LH=M@ @AUATUHSHHJH;HtDHHH(tET1H[]A\A]fH@P0膗HH8IHtuH5H腭I,$Iu ID$LP0MtLL3HHt+vImIt\MtmHGL#EfImu IELP0H=? H,@HEH57 H8rIELP0똸ATxSHIHHHH=NHHzDID$`ID$ID$ID$ID$ ID$(ID$0ID$8ID$@ID$HID$PID$hID$pHCLcAD$XHMH=MI$HML%MHHM裫HL[A\蛢HMHHH=y> @LE1 ff.H=DMt"SH=CHtǃ[f=zHzyH=7> :f.ATUSH=IHBH8iMQ1I\$ID$AD$ fAD$$ID$(ADŽ$IDŽ$ IDŽ$I$ID$PID$XID$`ID$hID$pID$xID$0ID$8ID$@ID$HADŽ$IDŽ$IDŽ$IDŽ$IDŽ$ADŽ$IDŽ$IDŽ$uYH=KHCI$ID$HtL LcH=KoL[]A\H HL8fDBf15DHH9GHH@Ht2H@HVHtH9P| H@H9HH9u9tt[ˏ[D[險H=[7 H=7 fH(dH%(HD$1H|$HHt$ڷH=3Ht(H1H51HHtnH(uH@P0H=ŅHHt%1H51}HHtEH(uH@P0H$Ht$H|$5HD$dH+%(uH(Kf;贽@AUI͹ATILMU蕍Ht@HLLHHmIt L]A\A]@HEHP0L]A\A]DE1]LA\A]@AWAVAUATUSHH8DwdH%(HD$(1H9L(A{H| HcH>fH) E1H$fH{HHcsL=Yw L@HHtMH{H|$:DuHHcCH9t/HmH|$uHEHt$HP0H{Ht$LHŋSHsIDH= 1`HH HMLH=I 17IHmu HEHP0LL踢MtI.u IFLP0MtI,$u ID$LP0H{Ht HCHD$(dH+%(H8[]A\A]A^A_H5HG$W H4 H( HDE1H$t@KjfDH7E1L(H4 H$CH( E1H$-DHI5E1L(H$5 H$ H)5E1L(H4 H$HT$Ht$H|$ $Ld$ML~H|$ IHt H/uHGP0H|$Ht H/uHGP0H|$Ht H/uHGP0H' H$ffDH3 E1H$MDH3 E1H$5DHY4 E1H$DHy4 E1H$DH4 E1H$DH' E1H$DkHH9H8fDH1:H4' E1H81XH' H$xH-8HE1Lޟ6fH4$H=& 1IfDH|$ HaDH% IE1H$fH% IE1H$H% IE1H$蟸ff.@AWAAVMAUIATUH@dH%(HD$81HHL|$LL$ME H4EDщD$'IMD$LLLH% E辂LISH|$HtHD$H/t*HD$8dH+%(uvH@L]A\A]A^A_fHGP0L|$H 4LL$MD$Hl$ xD$ IMILE1 a?ff.@AWAAVIAUATIH=dUSLHHT$QHtlITHHt\LIHDLIHtHT$IILLHIHlHL[]A\A]A^A_f.E1ff.E1@AWIAVEAUIATIUSHHt~LILLHPIHtSMt AEu9LIDLLHI躏HL[]A\A]A^A_HIH荏E1AVIAUAATIHUSD HtKHLALDHDHmIt[L]A\A]A^fDHEHP0[L]A\A]A^fE1[]LA\A]A^ÐA1Off.@A1/ff.@AAVAAUIATIUHdH%(HD$1#~HtfLHL$IDLD$HIHt1LHxIH=HD$dH+%(uHL]A\A]A^fDE1Nff.AUAATIHU~HtH|$LLHԟH4$HH|$}Ht$HH=oHHOHD$Ht$01ɺHD$0HD$HD$8H$HD$@ѠHHUH/;H|$Ht H/H|$HtH/twH<$HtH/tXHD$HdH+%(FHP[]A\A]A^fDH5!&HH4$@HGP0HGP0HGP0]@H=ԒHt$H=軒H4$H=h裒覱H= 1bH$Ht$H|$_f.HGP0@I}臅tH4!uLl$Ld$ Hl$(LLHLLH趝H|$(H|$ H?'H81H=/ 豚HT$Ht$ H|$(譐1H=' 菚H|$H$Ht$茐H|$(H/t1H|$ H/tH|$HHGP0HGP0HI$HHD$(AH1$HHD$ 5+cfD:葤fAVAUIATL%~ UHLS3wH$" L}IHjHE0H}(H5 H>HEhH9HHHݱIƋHH5L LneLIL1Hڲ H5 kHHH(t6Hmt[]A\A]A^ҺfHEHP0[]A\A]A^鹺fH@P0HmuH=a 1RqDH=` 1:qEDH=1 1"qH= H= 0H= H= زH=Q ̲H= HH=i3 @Ht!H(Ht HDH@H@0HH3#H H81]n訦#9qfgAWAVAUATUH#HHH诌IHH諤IH=HEðIHGHHE(HHL6H=J 芰IHH趏HE HHcHpHUH} H5 cH "H8uc讇IH+HH=裍LH= ľI/ŵHLHx0HH蓀Ht*1'LqLgLE1zHTr]LA\A]A^A_KHu1H=rI S.HuIGLP07nfDE1]LA\A]A^A_HqH=l H= H= ff.@AVAUIHATUSHHdH%(HD$1BjHHHL%L>gHL%~L&gHu@ tSE1HHLAăuHtHH8~tMAAjE1Hmt.HD$dH+%(HD[]A\A]A^fE1HEHP0@D$H\$fDH= nLIHMI.IFLP0@H= TnLIH֊MI.IFLP0迩uA%D1酈DHCtHfD$ 'RD$ HfAUIATIHU9hHt7HLLHS_HmAt D]A\A]HEHP0D]A\A]踡A1ŔDAWAVIH=V AUATIUSH8HL$dH%(HD$(1vHHHHL=&LHID$HLoH5C HHxHFLĝH5p L襝tHZ LLOHLLAt$MLY^IMI,$Au ID$LP0D$/Hmu HEHP0HD$(dH+%(H8D[]A\A]A^A_@H5E LiH IH5H/ LLt<LpH|H9LoLo>{HL蝫HH=H@H;v LhLLHʐIHnHL$H`C % H+VwfLL赡h軫LHD$.`HH|$&L^LH\KzHL蚥Hmu HEHP0蟞T$sA*LdHHLLHD$[LD$HxH5a LLD$[LD$IDHD$II@LP0D$f9D$&kLH H:AH81ee5HHj H81CeLAeADH+uHP0H}H5 H8nfI(AI@LP0LL蕟zHpH+UHCHP0FHAI^HH5 H8ҧhAVH& IAUAATIUHHHHDHot+LHL荂AEu5HD]A\A]A^fDHLDHL]A\A]A^~@LHD]A\A]A^f11Ý1鵝DH1额f11C~15~DATUHH=P SHqHtPHiHIؾHHÕHHt2H(AtD[]A\H@P0D[]A\A4Aff.1鵟DATSHIHtHL[A\@cvHtHH;?vtH;H5 ܥf.Ǟ鷞AVAAUIATUHSHH0HH5D$dH%(HD$(1H9tmAą"HZf.aH|$֧DD$ D$ YD$D$ D$ \$D$ D$ f/D$ \D$ XD$D$f/ f/H,D$ E1HH,IEHD$(dH+%(H0D[]A\A]A^fL$ fD$f/vL$ \XL$D$L$ eDHXmHIEH;}~tHEmH!H5 AH8IHhIEH5 AH8ˣ a ff.@,> ff.@AUAATUHSHH(HH5~dH%(HD$1H9tDAąH1D$D$f.D$DݒH|$D$D$臥D$f/!r f/sAHH5 AH8轢HD$dH+%(ukH(D[]A\A]H,E1HHkHHurHEf.H H5Z AH8Dݒff.fAVAAUIATUHSHHH~H5-H9tAąHf.?D$fL$DH*YD$D$艑D$D$f/D$ f/D$E1H,IEHD[]A\A]A^DHHHHtGHHHH9sHHHH9|_HDImH[]A\A]A^cqHtHAH;;qnH;H5  ԠZHH5 AH8謠2H H5 AH8苠fDʚ;Bf@B2fAUI1ATUSHH8dH%(HD$(1HB\H}%AH$Hiʚ;HHKH9whHl$ImHt5H\ Ht$1HHHC tRCHD$(dH+%(uwH8D[]A\A]HH5 AH8|Hl$Im봐fH*L$YfH*L$XHi AH8蛨yяATUHSHH0dH%(HD$(1H[AHtMHJ Ht$HEHEu[ffH*D$Y H*L$XEH}%H$Hiʚ;HHKH9wEHl$H+HAH8軧HD$(dH+%(u9H0D[]A\HIH5Z AH8Hl$H+譎ff.fU1HdH%(HD$1HHwx&1H,HT$dH+%(uH]D@HH|$H|$|Ht1H蘋uHH8车fDHH|$H|$9Ht1HHuH5H8mfDAWAVAUATUSHT$dH%(H$1Hu+1H$dH+%(5H[]A\A]A^A_Ë >VHI觊D|$IMH$AH$tNxDLLHD$wH|$HD$sHD$Hx0I)IM[H$uDLLwHyH$&t6t1 gƎZ^Uf.0RUyn1H=B hŅ0UUaT-UfDD$ tHiH8衤nw=THt$ I訍Lru}HTH9D$ uoHTH9D$(ua-TyAI)HMLHމhHHuH LH5D H81rg3TfD1H= ^Ņys8u^LHމ]HxtJI)HMSXHt$ 臎u#HD$ -SHSHD$(HS'RHUH5] H81fՇHHH H5  H8肙]ff.f1@USHdH%(HD$1x uAH c tEH=11ҾH HD$dH+%(H[]H=s ԄHHt8tH5Dq H8t HHH,$0H$:|HH usHtEHHrf.iCHÞ&JH9uHPFHfH@裈H= 藘H= 苘ff.DMEtAWAVAUA1ATUSH5kHHm{MHH- }؏{HHHrIHH蛊vLH{M薔ud GU ڜ 譤HEHp>IHH5wdHv|LnuHE(HHLkpdIHH N,LΙHD$H L1HE1F11H~< MuQIcHI9~\A,DAEf=wHsLD1AqtAwtfpwfnwDHt$H뤃rfvHt$111fDHHcI9E1HD$@HufIM9 C|tM9 HD$PE1MHD$O ALKHD$MufDHtA|ltMALM9qHI9cE,\At1I9DNAljD$ EAhw(A vVAG<^wNH= HcH>fDAO/w+HHH|0FE1I9 A\ID$DT$XLD$vHLH|$LD$HD$xDT$X494uHD$H|$@AHt$8HH~L(HhH$A/ H EJcH>HD$LLLD$LD$D$9HLLD$XH‰L$ HD$``AfHcL$ LD$XHD$Ak@ ADHD$Ht$HD$XDT$HD$LLLD$`LL$XLD$`LL$XHD$IfqtwtfpfnwN,ClM9fIM9ClftAqAnfqt E1҃nLLLD$XT$LL$`uT$LD$XBL(fqEAnAqt2Awt,AWv#AoAvE1L9LL$`D)ȃT$ HLE1ifAhw*A vPAG<\wHH5% HcH>AO/w#HHHu 0uEHD$fDLLLD$`LL$X{LL$XLD$`HD$RHD$LLL\$pT$`LD$XLL$ 8E1ҍHA LL$ LD$XT$`L\$psH|$B494aHt$K|DT$ HfL)ʾ HZ H8t1Hff.@HeH8Ht H5HHH5 H8t1Hff.@H>dt@HHHt H@HcxX j1ff.fHH~~zFHh HcH>fDH?HtH4HHHH?Hs@H?Hl@HH!HfDH?H3?H|0@?Hl0@H?H0@fZHg@H?Hi@Hc?Hi@H?HhH?H0@HHPHDH??H/DH?HhHvfHH5 H8r1HH6HD$H:rHD$fH=1H8@F2fDHH9H5 H8mZxHc=Hgf1HfATUHSH DfHndH%(HD$1A^HHt$HP HcH>t+LEH}MtUI(uOI@LP0CLEMaHEfHH5P AH8Dq@HD$dH+%(H D[]A\HG;HEHu[AHEdHEHu;HEH=zH5 QfHt$F9HMH|$AE6fDk[f.[EMDC[f.3zCZEDPHEHH|$}HH!]H H-=H}H5e WAuDH|$|HEHX?HJkH|$;:HEHH5 @HaH9GH;=pE9HEH耺H5 H=D9HEH5$ HкH nfD{9HAfEH=aH5 ;K9HqfEHH5 H=HH8yVAfDHHAH5 H81:fLEHe dfDD$E>D$HA#>HiH|$k8HHEH-H5 H}UD=HufE=HlEf=HLEfDk=H,AfUK=H EH"H5 AH8lx=H=DHH5b AH8l?\IHH|$0(\IHHLLHHD$HLT$HaH|$L,!LT$HHHCH(u H@P0LT$HI,$uID$LT$HLP0LT$HI.uIFLT$HLP0LT$HI*u IBLP0CHtAOHIG0HcH;PH@LHT[IHHl$(Lt$Dd$@@HaH5 H81/LH]I@LP0(E1E1DI@LP0Ht$L IHWH(H@LP0fDMMHl$(Lt$I/Dd$@I)uIALT$LP0LT$MI*IBLP0DMHl$(Lt$I/Dd$@IGLP0DHt$(H|$09IHH(u H@LP0HD$H{HLIHsH(ZH@LP0KIGLT$LLL$P0LT$LL$@L5MpLLE1MDHl$(Lt$LDd$@H|$ LiHHH(uH@P0C@D$HM|$H"HD$xL{HD$pHD$(HD$pHD$H$HD$xHDŽ$HD$@fH|$x*Ht$pHH?Hn*H HH _UHHHt$pHLkHHHHL$(HT$LHt$@4)u E1UHD$HH|$ ;AHHaHHD$pHHL>HD$xH|$HubH)tVH|$x)H@HTIHHt$pHLjI$HI$uID$LP0H|$pH/YHGP0ME1H|$Ht$pHt]Ht$pHT$L/jyHt$HHD$HHu HFHP0H+u HCHP0H|$pE1HjH/`HGP0THDŽ$~SIH2HD$xHD$(HD$pHD$H$HD$@HL$(HT$HHt$@Y'H|$x'(HuHt$pH|$ "\tHt$pLH>ixHt$pH|$ [yI/H=.5H IHylH5HH|$ [RtKHC@D$HHCHP0FHH$HCHP0I/u IGLP0C@D$HXHI$@ID$LP00H.9HFHP0*H=-4H7HH:H+u HCHP0Ht$HHD$HHu HFHP0H|$8Ht$ HHnH(ACHt$HHD$HH$HFHP00LUHH=yHtHWuH/uR01dHPHHtH]L]ff.AWEAVEAUAATIUSHHHHYH=HD$"LD$HHpHX`L@I$L` `HH@H@(H@0H@8Dh@@D@TH@XDxLDpPHCHt PD@@f.eH1h1HE|c1HE(qcH}HE0H}(t{HtvHuH{HfxbH{ HKxRLcHmu HEHP0HkAuHEHC(Mt*I|$0HTKH[]A\A]A^A_Hmt1H[]A\A]A^A_HEHP0@ED@I(uI@LP01ff.ATUSHH8P Ht3HHCHHx8HmItMt[L]A\#D[1]A\ÐHEHP0Muff.@AWAVAUIATAUSHHH8 HtXHHCHLpLq8HHtQT#HAtsMcL 8NIHu;Hmu HEHP01H[]A\A]A^A_fDMcLMIHtHHL'dIEHIEtIAuSAumHEHPHUHuHUD$ HR0D$ H[]A\A]A^A_fDIELP0AtHCHHx(8Iy/H{(H\7HHt?"I L4MIHH{(HHYcI$xyHI$>ID$LP0.HIEIELP0H!LH5 H81#HCH;PPpLnfDHI$ZID$LP0Jf.AUIATUHSHL&MtHI<$~A11HcI;$},IDHH0uE1HD[]A\A]fMeMtGI<$~@11f.HcI;$}$IDHH0/ufIEHtH0HtHEHHIE AHhH0HMHEHH HD[]A\A]f.ATIUSHHHoH}8tgH{8~HHtzAL$4AT$0H= 1BHHtZHCHHx8FHmu HEHP01H[]A\1Ht$4^Ht$HE8HCHx8uH1[]A\ÐH]HHHxHt)HPpHt0HphHt7H=QN 1YBfHPpH HuHphHHuH5H=N 1Bff.LH 1HH5H= AfAWAVAUIATIUHSHH8LqD>LD$LL$IvdH%(H$(1MQEL$$ED$ 1LLH/HMA AH ЈAHAV=11H=+ HDHHHD$LD$IHIu I@LP0A t^HEL|$ H LH\H\1L+IHHH I/I6HmM~E1@ItHKAIc1MtIH9|H;ALtHI6pIvH\MnE1ItH;AIc1MtIuH9|AFtHEHHAIcH;|H|$tHt$HtHt$HtnH$(dH+%(H8H[]A\A]A^A_FfDEHEHH$(dH+%(umH81[]A\A]A^A_DmHfAHDHIt'HfDIGLP09I@LP0Aff.@AUATUSHH(WHBGH;GLi>HwIH HcH>fDH LFHNH7E1HHZt^CHPSHH([]A\A]DHH5 H8RPCHP1SHH([]A\A]@HvHHw7H HcH>fDHvHdl@CHPSHH[]A\A]A^A_HѱH5B H8HCHP1LnE1DJ LHHLH/AIc1MtIUH9TMtHLIt$H$H5 H IT$HDH##Lc8H  mff.fAUIATUHPSHHCIHH1H@-CID$ HGID$HID$ID$8)HLH=HI$Ml$@HH,R H5* RL=*AT$H@LAD$LHHE1E1HL"ID$ID$EUu@Hm1 HtLcHc1HtHUH9|DLtd11HHtU11IHBI|$1HHHmu HEHP0Imu IELP0uLE1HL[]A\A]gH@H5 H818LH=f HHHLE1m8'HL[]A\A]f.Hm1 HtLzHc1HtHUH9|HuLFHmHEHP0fD&AUIATIHUIHtHHHr`LHD$H|$IH/MLL$HH5tLL$HHHD$L1H+ H5CtLL$9:H|$LL$IH/I)MMI/HL$HHD$HH]H|$HGP0Lf.HH5[ E1H81fHD$HGP0LL$f.IALP0iHGLL$P0LL$Hf.LL$f-H|$LHD LL$II)u IALP0HLIu>HIIGLP0HٟH5 H80HIu IGLP0HL$HHD$HHxH|$HGP0gH0HdH%(HD$ 1HD$H5ד P1LD$ LL$-AX1ZEtH$Ht$H|$ H'HHT$dH+%(uH( fHH1ҹdH%(HD$1IH5 H$tHH4$H8HD$dH+%(u1H$ @HHHUHH5; HdH%(HD$1HHt^H$HPH;u-HH9H$HT$dH+%(u1H]HQHRH5Ѭ H8111gHUHH5 H8x)1HlH5 HAt HH]1]ff.SHH5k HdH%(HD$HHT$H1Ht4t0HCT$PXHHHT$dH+%(uH[@1ATHH5 HdH%(HD$H?HT$HD$L`1\txD$~'MuMfMt;Md$uD$Mt(I$HD$dH+%(u4HLA\DD$HH5f E1H8#-E1fDAUATUHH|$HHH5njHHtr1Ht$HHIEHmt=MtI,$tHD]A\A]@ID$LP0HD]A\A]HEHP0@HAD]A\A]ff.fATUHHtLIHHt9IH-HH5 kHI.Au IFLP0EH=L5LrIH@I$ HIF1/IF  1IF( CBIF0 IIF8IcIF@ IcIFH 1IFP IFXOIHLH5 HI.u$IFLP0$g IHHH5 HI.u$IFLP0$1IHHHH8HtaE1JLHHD$LT$L $I*uIBLP0L $H AIcHHH8HtL $lL $HuLL $L $I)u%IALP0H5SLJfE1H$dH+%(uIHĸL[]A\A]A^A_DIELP0IFLP0IFLP0I.uIFLE1P0H= 1 LL $L $II)u IALP0MCLH5ޑ HI.u$IFLP0$H=g%IHHH5gHI.u$IFLP0$H= IHHH5_ H}I.u$IFLP0$}HHHH5{ H:R]HHAH5 H*H=L5{LIHWIFIIF ;H= IF(1IF0 IF8HLH5D H|I.Au IFLP0EH=H5sHHWIH>HGH8OHyHH5LH$L$I(u$I@LP0$?HH8H'HH5 LH$L$I(u$I@LP0$LLLlIHLHL@I,$Au ID$LP0EH= VIH}HH5 LI,$Au ID$LP0EMLI/Iu IGLP0MLH5Ŏ HI,$Au ID$LP0EH=vL%WLIH}H^{Hc8ID$H zHc8ID$ H|Hc8ID$(H2yHc8ID$0HHc8~ID$8H|Hc8jID$@HVxHc8VID$HH Hc8BID$PH{Hc8.ID$XHR{Hc8ID$`H}Hc8ID$hHb{Hc8ID$pHzHc8ID$xtHLH5H9I,$Au ID$LP0E;H=H5.H HH=sM IHHH5 HI,$Au ID$LP0EIHHHH5? I,$u ID$LP0H=3pHgIbHwH8@>4HwH8I.IFLP0H5LL51HrHHeH5BLL!I/IGLE1P0I,$ID$LE1P0vH5KH=SAVIAUIATIUHH(dH%(HD$1Ht$HH|$LLHIHtLHH~uJHmt3H$Ht$H|$`HD$dH+%(u?H(]A\A]A^@HEHP0@[HHHtLSff.HIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$HLHD$HD$ H=KHD$H{$H0D$0lHD$dH+%(uHff.@HIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$HLHD$HD$ H=IHD$Hy$H0D$0HD$dH+%(uHff.@UHSH^HxH1iH}Ht H/uHGP0H}Ht H/uHGP0HlHt~H[]HH[]fH[]DATUHSH dH%(HD$1HHt$H|$H$HtHvH9CHHuqH9EH=vIHHtHExI\$HHEIl$AD$ 苿LAD$$H|$Ht$LH<$Ht H/uHGP01HT$dH+%(u7H []A\uH= H$Ht$H|$AUIHATAUHSHH(dH%(HD$1"IcHH,$HHD$HtNH1LH\$7HI7Mt2HD$dH+%(u7H(L[]A\A]@HuHfDE1FfDATHt5 HHt1H(At DA\fDH@P0DA\H iu1AJSHtH~PHt,HHHtIH;$utLCPHCPMtI(t1[H(uH@P01I@LP01[1諸H{PHtHCPH/uHGP0[fDAUIATIUSH(dH%(HD$1HHt$H|$xHLLHZIHtr1HLH護HmIu HEHP0I,$u ID$LP0H$Ht$H|$MtCA]|LImu0IELP0$Hmu HEHP0H$Ht$H|$ ~t M9sLAptJ)DAωAI@D ?H I9s*A@ H fHn@1uZDҁ?H H fHn@ D1)?H M9sAxHD H fHnf.D҉1?H H fHn@NDGA9AWL_1AVIHvAUIATUSYLcIJ,MڋEE xDD$A9rYAIME11AA8IIILIԉHI H)HAxH L9sEEEEANA9HcHI H @I9sHH:99trDL߉D$1HHHH)HЉWH H9sHcItXD$[]A\A]A^A_A:u IM9rA]ANAA9]yD$[]A\A]A^A_u HI9rD$A][]A\A]A^A_1DIW IH tvL_0HwH@IEL9}IH=g!ftCtHI9tuut4tO<.t/1I)AM DFfHwHf.<.uHI)AM ft#LQH(vuMlI$cDtLLHdLxLH=)J<IHH$HIf.HHMLLHHHt{HHMHt?}I)Ǎ(w1Ґ LHH9uHHlIHEHIEkDM]L)HI,$ML8M2I$E1%f.HbHbH{cHHx H9DAWAVAUIATAUHSHH9D;EH;bD0A9IcHƃ;-D{EH53w HA_H5$w HHH5w H1HaD0HLsL5(9AJDHHx:tHD[]A\A]A^A_f.Su)HbaHcD9H ITH5bHH)bL0Hv H8fDHaAhD0fDHy`A_0eHaHx H81贬CAV1DH)`u A_AHtx H.aH81_DADH_tAHz HG`AD0fUHSHHHfDHEH9u4HH EAtDH=Dr 6&@蛯uDuEuE1EAE!EHD$(dH+%(uVH8D[]A\A]A^A_@u& tAtH=q fAtH=q HcuHf.H=q H`H1H1dH%(HD$1H|$u D$xHT$dH+%(u(H:e 1uDHcHf.ff.Hf@ATUSH@dH%(HD$81Hu/HfE1HD$8dH+%(H@D[]A\ÐHKIIBH9rMHHru>HHHAHEu#HLff.K趻@AdH HfHtHcGH{H HHtXh H@H[]@HpHcHHt H0H4@H gE HHHsLD$hHL$`T$XDL$PNDL$PT$XHHL$`LD$hI`HIοIEED$XHHD$(0$D$HD$Xf2D$@D$D$tAD$pD$81D)L$8fA*f.zAf$AN )fLD$`T$XDL$PDL$PT$XHLD$`IHIEE|DT$@D$XET$PT$Pt$Hh)ЅOD * EDL$pE>IcEA9F HINHITfH9HH290tL1Ҿ l$4LD$HIH( DD$@ELD$Hg D$tADž Hl$ L1Ҿ IHLLHH0MAFu A~ D9|E1LL$L$HI IcEAVu)… HI~HIT @H9 HH9t HHH@}0tD$4D$HIcEH4]H L,IMMMt*M9t%IcG H]H L_)9f 9YfHY,*у0H\f/f(\f/vHL$ @H9oHPH9tHL$ EE|$t3_fɋD$4*YƒD$HYX afH~fH~H @H H L蛁LDLD$XT$PIH_@LD$XT$PHA|IHcD$4Hf AAD$(fIhf(^,f*ʍB0A@Y\f.zt`AAC ^ID @H9kYfHf(^,f*ʍJ0MY\f.zuD$4D$H@@yH9 BfDf.E|$@?t$8t$XYLd$8AGIlHD$ Hl$@Hl$8HD$\$8LLA^D$HDx0IcD$)u0HIvHITH9sHH:98tۃLHHHH|$8A…Hc@Av1)u@HMNIHTI9HH 9tHcGH KVL HHD$`Pf.IM\$H L,IMIcD$=H>H L$I $IcGKHa>H LH H,HMIcCH">H LI D$`t$94$t$TYM Gf(LfHfLfzLfIPD$d fL f/r+H,fɅDƉH*f(EufWfH~ǾfH~)H H H fHnyf/aY f(fWu *IcEEH<H IML,LHD$HeDL$(HD$H?IM\$@9GHFdGI9uDD;l$}7EUMcD)K OTLDG HGdHH9uAHXH f/ f/ NH VHa1IcEI߃H8H L,IMIcGGL\aLPD$D$dHF )HFYD$`HYH|$0t$HT$\l$8,$HH6@D$ IHHAD$\AIHHIG趩t$\E1ƉŅ=Bt%IcGA9EHIMHIT H9HH290t$MHD$IdfDAE1LL9LDl$H)A,AD)ED$Eu A|$uIL9l$uL1Ҿ +IHuIcGLH6H LfDH=D% 1mDHD$HdH+%(HXH[]A\A]A^A_fHE1HD$(fD$D$̡D$Afff9D$DHL$H4$HL$ HW0HH@HDHE1E1M9|VqB|HcHxUHHH)HHL9|zKIAL4AM9tuB|=譕HcHyDH$L8HD$L0HD[]A\A]A^A_B|}kDHoHAHH5aAH81]H$L8렐AWHAVAUIATUHSHHdH%(HT$1W H4$AAA HO0LwH@LEHEE H)DKHCHCCHC DC(HHHAA~A >);)A >;11H[AAQA-wH(H\#„}HCH$HH)HAcAA<0„0=tSHSH$f.AL>wu;wuA >^HHKH$H)1@^KAHHH$H)¾f^uKAɐLwHRIHHKLLuHcЃ9HuHCH$H9AUAA<,PAA<_„cSHC_H$H9tdAHAA .ƒ,H$H5 H)HouA<AjAC(StoDC(AxADAHHHHHu9H HHH8DH5 1 Z1fDHT$dH+%(H[]A\A]A^A_DA<,u+fHC,H$H95AA<_H$AA,tS.EoA%eHH8A@߃^2DH5 1RY13H5Y HH810Y1H$AA<0fDA-wH(H#)HHHK LLH$HcЃtH5 H_A Nf>wEf;wEA FDAFf-wH(Hf#Df^uKAFeDAAffA^E1MtfnL$f8?f~AD$ @u<t<E99UrHu HEH)I9~ MUHu Dt$MMLHu HLHH] HD$HdH+%( HXD[]A\A]A^A_f.E1M?ME1%fH1LL $f~D$ GfnD$ L $fnf8?f~*DJ+H}LDHL $9Hu L $LHu H1HfD1%DAWAVAUATUSHH $H(dH%(H$1I1IB?HL|$HǺHLcHHA=tGtvHcHt$LDPHHtYL9d$sCLHL6H ^Dt$H$dH+%(u7H(D[]A\A]A^A_H]mAHpAVAUATUSHH $H dH%(H$1H1I4>HLt$HǺHLHIoff.U1SHdH%(H$19=HtOHHHRH;1uD$%=H$dH+%(uHĨ[]0l1ngATAUHmZD1ҾH1dHA^UEx HD]A\HAH8AUIATAU ZDLHoHAUEu D]A\A]HnAH8蠆ff.AT1Ҿ1 dAăt AADA\H H8XfDAUAATUSHHtuD!A EuSZuR1DcƒE9t1DicE1HD[]A\A]ÃPTDH11h6Aątq\jt u!1DctH(H8`!fD1DbFuAdfbS11HL$bHL$At AD!tHH8ff.HѺoff.@H1RfAThxH 11A&xDA\ADA3@AT UHH(dH%(HD$1Ld$LH wjH19HHtpLH}HI7MtULE-111x4HD$dH+%(u1H(L]A\fkhE1LuE1jff.ATu}IHtH,111x LA\fDLE1uff.H11`AEx DHHH8AHDHdH%(HD$11HT$!TD$1l3x1HT$dH+%(uHHJH8肂ifDATIUHdH%(HD$15Hti1HHH(0tCH<$LgMHmAtHD$dH+%(u6HD]A\fHEHP0@Hmu HEHP0AifAUIATUSHDkf8uv1kuRTLHeHAOExH 1DxHD[]A\A]D0HA[D]A\A]HLAH8H3fDHAWAVAAUIATUSHH9HFHD$eHf.SHT$LDH:D;HINLH?Au/tjtIHL[]A\A]A^A_tHIH8ND;fHAWAVAAUIATUSHH9HFHD$dHf.+SHT$LDHb~D;HINLH?Au/tNitIHL[]A\A]A^A_tHMIH8~D;fAVAUATUHSHHdH%(HD$1HLH$Lh ]RLHIyLITMMtyH<$H/tEL](11x9HD$dH+%(u>HL[]A\A]A^fHGP0LqE1eQc8u hMH<$H/uHGP0H<$H/uHGP0HHH8T[@AWIAVIAUATIUSHiHM6H(HGHMtH{H|$GH11yHHDHHa1yIHtHHeE1MtH;1\I$HMtH{1[IHMtHCIE1Mt H17yH1HD[]A\A]A^A_DH|$?-%ME11g}1MMtNH;1E1Q[I$HHt%1YfD1LxM A?D1E1E1M3f.1E14AHGH5Z AH8rDATUHSHdH%(HD$1`wn^.b11HEpH}HEHH E1HEHD$dH+%(HD[]A\E1auHHvHI7H<$AHEHHED,us.Qb,HECbH}HEt]HtXHEE1HE`.b_HEbH}HEt"Ht`uH HEE1 3Aaff.AWAVAUATUSHHn Dv(dH%(H$1D$ HD$0HD$8HD$@HD$HH{IՋVE1HAAAEAn/$Ag[f.zAArgDDHL$DtIHLCIƋC +t t H{&LL%LH-HqE ‰ @HM0@HUHHHD‹A$-t $E1HHL$(LD$$LLy{(nat{Ld$0LHD$ L\$P1MPLLSATD$E1LGT$(nDv=HBHr3HEHHH{H8H5) 18t%uZLLHyHT$8dH+%(uoH@]A\A]HD$8dH+%(uNH@HH]A\A]DHEHHHH8B߃^gH5 118[DAWAVAUATIUHSHdH%(H$1L9uMHH9F H$dH+%(HHH[]A\A]A^A_fLl$PHHLA>AdLDD$xA%AH3JHHHHHHEHHHH8DH5h 1A7H$dH+%(HD[]A\A]A^A_@H$dH+%(H1ɺ []A\A]A^A_u@H|$pH5S D$,HD$0HD$8HD$@HD$HT$\Ac A@H 4H 5 L$XAރ+tM tHH|$`AXt4Ant.D$hu&HH9EuLHDuA@1HDDIHD$3HH@ ‰Hu HM0@HUHHHDƒ8-HD$-Lc1L)Ht$|$xnat|$hLt$0$L${HD$,L$ILPLAUAVjHD$0Ht$(ML\$ H HH5T$,A9T$L$rID$I+D$ H9~ HH1LI胼$XHLLPAVD$hPLL$8\H AHHmHEHP0fH@HHt`LLHHmA$HEHP0DHEHHHH8A@߃^DH5w 13AH5 fDHaH8fALt$0LfHLt$0cnAǃE fDHM0@HUHHHD€8-HD$1fDcL$XH5e ]H$0$HH$H=V$HD$HD$HŋD$,HD$9BûE1D$,rLL$mNL$A Dt6HM0@HUHHHDf8- @HEHHEHHEH5HHsALt$0H5KH8AenUAWAVAUIATUHSHdH%(H$1L9YHHLA>E1H$u D$EtUAF)f HHr8IEHHHH8DH5 1A_1f.H$D$tfo$fo$HDŽ$fo$HDŽ$HDŽ$HDŽ$)$)$)$H $A܉D$40* $D$(= Lm0f.f(zu$4 $HL $%f.x $f(zO$E1AAEEAnuAg۸D$D$0DHHL$xDD$Df(|gHD$PHH$DHL$|DDf(OgHD$IHHI5LH5HLIZIHH|$LAIHAE ‰ <IEH8-AƒHD$ AD$ AA‰A- cIL$0@IT$HHHDHD$D$8-tD$8HD$Ht$ LD$lHLH$DT$@kHt$LLH$LD$pkAnaH$E$HH$H<L\$tI1H$H$HDŽ$H|$XASL$L\$PAVt$$PL$HL$@T$`H HHT$0L$D$pL\$HH$pM1DŽ$+H|$@ASAVt$PHL$(T$X"H H,L$HH$Dt McIƸIIH9IT$tM)|$(>|$(^XE1Mt D$49BЉT$t9UrLM HEL)H9} H}LM HE]HD$(MMsD\$KHE Et&8Ht$((HHE DL$0Eu4HE1E1LjHt$jHL$@Ht$xJH HE1E1LjHt$jHL$(Ht$`H AƃHE QH\$(L$HjHHE t D)HMLU H|$P>H|$4Imu IELP0I,$u ID$LP0H<$XxH$dH+%(HD[]A\A]A^A_@f. h f(fTHfV`f.XAD$AD$0A AgEHf $D$p. $T$HHD$HD$PH|$PA*H|$ H$H$IEH8-OH$dH+%(HHL[]A\A]A^A_-DA1D$AD$0A AgDHIM0@IUHHHDf.IM0@IUHHHD^f.H$pM1H\$@HASAVt$PHL$(T$XTH H^1+IL$0@IT$HHHD€8--D‰D$8HD$K4L$4H}LLLD$8LM LD$8cfDL$4H}LLLD$8LM LD$8.f.H\$(j|$f4CHHE H\$()fCH\$(DD$jHU HBHE EHD$(D)HE fT$tLE1E1kfDHLD$(+DLM LD$(c@E1M1ME1fIL$0@IT$HHHDf8-@IM0@IUHHHDf8-ID$HfDLH?LHII)HID$HfDHt$(A(fDFHt$((HE fDIEHpID$H9fDAeAIEHHHH8AF߃^DH5 1A&_H5 HH8ZHD$HD$PH5JH|$P'H|$Imt H$AH$H5 IELAP0H$H$ JAWIHAVIAUI/ATIUHdH%(H$1CHH$1MLH H!ML HhMA1AtUHc "L5H4$1H|$LcH9tMH;0uH;xuHcHHRI|.\fDH$dH+%(Hİ]A\A]A^A_ÁtHIIH0HxHLHH@pX;HHtQHcmPH@[I|H[uDHLHH@pX:HHu2 HHHw HDLHHtfL<IHL(IHtwHLHPHmu HEHP0Imu IELP0I,$u ID$LP01H$LH HIHmu HEHP0ImuIELP01hHmuHEHP01PGATL%sUHdH%(H$1H=hLGIHH=_ HtuID$H=Q Ht_ID$ HHEPvjHSHID$(H$dH+%(uzHL]A\fI,$tIE1@H5LC?HHcDHuQyID$LE1P0sHFAUATUHSHH>/ IHuFIH HJ H=wTL$HL9 B#H[]A\A]fD|/L,tH=v9IwFIL)A@IE1rDB+/INl+WH= ^Uff.UHH=QHt2HQHt_*H=H^ HQ H<"H~QHHtH]]D]fDAWAVAUATUSL$HH $L9uHdH%(H$ 1H\HD$DE H= H- HD$?I")1H=|IA$1HHD$(H/$1HHD$0I$1H=c HD$@I$HD$ H MMHM 1L#/LI FH:H-{LHL$ L0U/tL$ HL LHDŽ$`(ta$/L HIHH:/uLLLL(uLW HNIHH2:/uLH$`HHL=z HD$L- LHLHHH11HHH@HHL,L|$pH L{IH H$PHcA| A}#tHcHLPYIHt LHMImIu IELP0MkLl$hLH5 LFHHHH5 T41LH5 FHHH5 TH5 L1bFHHH\$HTHLdH LHt$HH-R H:H8MCHtHt$ H[H58 HLHD$8HmHT@HH:/uH|$H|$8DŽ$EH\$HHHHH:/uH\$HrHHHHq:/uD$8H\$H5 H[H#H|$DŽx`3DŽ|`6H?:AH1 L-LHpLHt$ LH56 LD$Tt$85 HD$E1Ht8~ HD$HsLd$(HD$HXHL)L`HMt:LAIA<$/LEHuL&H|$IOt7LI MIJ<IH Ht$HHHe LHHD$H FHt$LFHt$HLEH\$L|$(Ll$X6fLLL)HHZzLHLL4M}TC:L@A?/ItFHLEH|$v3HD$|/t'AMS:tH5 LWEMgLLLl$X7EHt$HL*ELLE|$8L%IHH HtHTfHH:/uHHh HtHT@HH:/u9 |$TL.HWIHtITHH:/uLH IHtIT@HH:/uLHHHtIT@HH:/uHH|$(W)H|$0M)H|$@C)H|$ 9)H|$/)H$ dH+%( Hĸ []A\A]A^A_fDLLL{LMbLd$MH-0L$:L=HHIM)I@A@LHIBD%LH1H IHt`HLLAmEuX$uAIt=Ld$HL8LH 7HL{fDLH3@LHh#/LfH|$HH"KIHLH>I/Hu IGLP0HzLLDŽLLD$TD0Hl$HHHHTDHH:/uHl$HbHHT fHHt:/uLL|$L[LLHH=H"Hs H81L-Ld$HHT$|HT$>/#D$TH|$Ho:DŽ$1HF{H=* AH=> A,/!H|$H D$8DŽ$ff.fH=HtHH=HH==tHf.HGHHff.H==tH=f.HH=Hff.H=D=tH{}f.HH`}Hff.ATH=aUH:HtXHH5tH-HmIt\MtJ1L(I,$Hu ID$LP0HtHmtDH]A\@H= 1B%-4H]A\a;HEHP0MuHEHH@0H]A\@AWAVAAUIH= ATU%:HH5 HH*-IH(LLH+IHwDHH=N8 1K,IH1HL23IHHmtI,$t`ImtAI.t+MI/Atv]DA\A]A^A_fIFLP0@IELP0I.ufDID$LP0Imu@HEHP0I,$sfIGLP0]DA\A]A^A_f20HH8 H81d2Hmu HEHP0AHH AH812HH H811Hmu HEHP0I,$uID$LAP0H1H H81[1Hmu HEHP0I,$u ID$LP0Im(IELAP0=AWAAVAUATUH-I SHHdH%(H$HFD$L=p9H5a9HHD$(HJf.mt!ctEHHD uHcHD$E1L;$4E1E1L% :9D$$D$$fDHHDj ic(mO?9wIcL>DHH H AH(1HH1H H$dH+%(PHD[]A\A]A^A_DAGH1fHHIH_HD$HH8@MHHH8HHLHD$+LD$I(I@LP0y$oHYHIIH)D$.fDHyHa HH/HHIH=r d%Ik@H HL$$ADD$$HD$E1E$HD$H D$  H-Er@Mt$I~~1@IFHHH5! 1H-iH$HcED9EL,H5u L7LHDD$0H$DT$HD$0H $HQE1kH41HL$LH5aH8)AHcUDH4)1H(MUH|$FH|$E1AH|$Dt$EIL MH H1I9LL$8H DELL$8"HcUDH4)uHFME1H*H8HDEH=$-HHH(H@P0fHɟ1 H8H1 H8H 1H8R1:IHH= 1H= 1A4&H31 H8oH 1H8TIELP0@H= _HCHL$8H̜H=^HHL$8HIL MH޺ H1I9LL$8HLL$8D(E]I9H C Ho^1;H=.^'H&8HkImu IELP0H=& 1$+HcUD)H4H8^E1oH|$H<$uDT$EMBH<$H<$H5J eHHyDD$$EuJHHt$P!uD$h%=@n-R#AFH==t uH H|$HcUDH4)HaHH8F/H DEL$H<$E1HKHD$DE)WMH=l\"HH1L1H=; E1A9HٙRLd$0Hl$H3H H<$ HD$HD$HD$4t$t H<$+^H|$(HL$L1H5[#ImuIELP0L,I(]I@LP0NH= HH8H50( HIHHL$L1HH(Lh(wH$HHHIHt!HImIu IELP0Mu.~(HL$LHH5 "E1AL-HL$LHH"I,$uID$LP0HH5 H8+ImIELP0E1'H<$1D }HHDAC EIASH H| PHĜH81[HA\QHL$H H AH81H&>H= D H1H3HD#H8 'D AUH EPAHL H H81;A^A_=HLHǻ H81 H=ܻ +H=H *f.HG@t/SHHHHtЅtHCH~HHC1[1ff.fHG@toUHSHHHHHtЅtCHCHHt/Hu1HSHsHKHHrHUHSHMH HkHHCH1[]D1ff.fHG@t?UHSHHHHHtЅtHCHHHtH1[]1DHSHsHKHHHrHUHSHMH HC1HkH[]ff.H՘sHfDHSHfDHVH~#1HH9tH9|uf1ff.fHF@uHؕHSHHHHt HЅtHCHHtH3H[DHH[ff.ATIUHSHHHt HՅu-H{ Ht LՅuH{01Ht[LH]A\@[]A\ff.AUATUSHIHt H-mHXhLH9+tHL9uHL[]A\A]fDHmtHCHH@HEHP0HCHH봐UHHHtH/tqH}HtH/tRH} HtH/t3H}(HtH/tHEH]H@HGP0HGP0HGP0HGP0ff.@HGHHH@HGLGHHtHGHWHHPHGr~ rL fH6H?ǶH=]HtH/HItfDHG`0HGHHHt&HWHHGHGHHWHBHGDSHH8HtHC8H/t1H{@HtHC@H/t [HG[H@0DHGP0HGHHHu0HWHHGHHHOHIHOHHHPPH=6?%ff.@IHHL HfAW1IAVL5AUATL%pUSHv-IHt^I$L9u kHL9t`HC HkHI9tI9tLLHЅtHLyImu IELP0E1HL[]A\A]A^A_I HpL9vfAV1AUATIUS,HI|$I~_1L5DIlHE@t4HHHt H҅tHEHHtLLHЅuHI9\$[L]A\A]A^Imu IELP0E1[]LA\A]A^AU1ATUH-~oSLm`H,IHtZH]H9t$HsI9t L7u#HH9uH I9uHL[]A\A]@I,$u ID$LP0HE1[L]A\A]ff.fAWAVAUATUH-nSH|$@Ht$ HT$(L$DdH%(H$1HD$H# D$@H HcHDT$@- n n|$@t nHcD$@HHHD$HLL5H-+nHLL$HU HHHHH9tLFILBHPHVL H@HH H9u҃|$@Lt$tHcLt$HHD HD$HD$HHDL9fDHPHpH 6H HPHL9uHD$HH\L9L%|@HC H{1LHL9uHD$H\$pH\$xHH\$pLlM9SL%HfDIU M}LHLHIELIEH5ȎI9u ^IM9t@IEHHuIMIUHHHJHL$xIMLl$xL)I]IEIM9uHD$HLdL9t$|$@M9t&Ht$HFL ID$HD$HHDHFH0HD$HT$pHHLpL0Hl$PHl$XHl$PH9HHHH Hxt.HHHHJHL$XHHHD$XHHHH(HHHH9uLl$PI9t,L%IE I}HLMmI9uLd$pI9E1L5 L- fM$$I9t1IܸtID$ IL$LLHP1OM$$I9uLt$pL$L|$L$L$I9uf.I9tLM6HB HL|H~M/MtLI}tIEHHtIEIMIUIEHHHH$IEH$HMeM/MuI9uL$M9Hl$0Ll$E1H\$8IAM9t{I^0In11HH}HHH(uH@P0Inu IF HP0H$L9uIIVHHPIEIFMuL0M.L$M9uMcLl$Hl$0H\$8Ll$pL$L$I99fIEIUHHPH$IEL$L(IEMeuFIU t9HHt-HMuIEIELImuIE LP0fDLl$pI9zH$L9HT$xHHPH$HD$xHLl$pI9oL@HPHpH 6H HPHH9uL%IE I}1LMmI9uLd$pI9L HH9 HPHtLHBHHBHH9uHt$HFL ID$HD$xHFH0HT$xHT$pLd$P1I9tKL5i L-R M$$I9t2HtID$ IL$LLHP1M$$:I9uΨH=Ld$PI9taDIt$ uID$ HxtH=|W x M$$I9uHD$PH9tHt$HVHHPHD$XHFH0|$@Hl$XHl$PHtD$DHD$ HtHt$H0HD$(HtHHD$Ht$H@HHHHpHXHH$dH+%(aHĸ[]A\A]A^A_HoLHD$Ll$HD$IDҳJIT$ HHID$LIl$u ID$ LP0HT$pL9yII9Ml$ tH=L H\$pH\$xH\$pHL9t$s|$@tMHeH e1H9tHHH9uHH=7 Le`IH=L 1HSI IE1L9tHHL9uH1I FM9uH=HD$H1iwIHD$H HD$HH= H41LH+|$HH=W H=αLd$P1D,H1@H{H5׵ H8b1fHHH^1H5 tH5HH@1HÐL]HH1IHH5} HQtHHH@1HfATH=. HHIIHHH5! LHHHH5" Lx{H5 LxcH5ڴ LxKH5Դ Lx3 H5д Lx&H5ƴ LyE1LA\1HbHH@1H:HH$@ATE1H dH%(HD$1t!HD$dH+%(uYH LA\HT$Ht$H,2HT$Ht$H<$Iff.zu 1S֨ urH[HtfHRH~]ATL H5+UHHH LDHzRE11H811 ZYpuH]A\fDH=\HHt\H,IHtdHp H= 1HmtvI,$uID$LH@0H]A\1u@H=qH]A\DH=YHmKHEHH@0H]A\HEHP0{fDHSHH9wwUHSHuSH HHtSYYHCY9~xtu4HHC[]fVH멐H[]uD-ju!HuHŦ YEHHBHIHH9 Y~ H9 c9Y97Y Y9 Y~̽fH1fSHH Ht HXH[ff.fHff.@USHHxAHH(HHH} HHHtHXHhHH[]H=D o H1[]fDSHGHHp(Hp HHHH9w$HH7HtL@HX([LD[f.S t%HHYH{C H[H=qH5ί 1[fATUHHo HtH{ID$萘H;ID$ cH{ID$({ID$0Ȟ{ ID$8;H{0ID$@-HKPHSHLID$HLs`LkpHSXLLHShLL H{8H{@I$H{(I$xI$ HuHL[A\A]A^I,$u ID$LP0HE1[LA\A]A^ff.ATIUSH dH%(HD$HLH8HT$ H5/ LD$ 1|$ 1HT$TuaH=nl$\$IHtsID$ID$ Hu7HD$dH+%(uDH L[]A\HCH8I@I,$uID$LP0fDE1ff.UH dH%(HD$1Hl$HHt%H=HT$dH+%(uH ]HCH8Qf.AVAAUATU1S1\I!HH5Hu08"uvHHIHqHHuZLEu#H苓IHp[L]A\A]A^@HxHHIILůL-H6B[]A\H8A]A^ffD1DfAVEAH H AUHDATAUHSH HtH~uYH{tH} uK&IAueAu_H{ Hu jLAEueHsGH[]A\A]A^fDHAH5 H81[1]A\A]A^DHM Hs DDULA誮EtHAHU8Hs8[H8]A\A]A^fDAUE1ATIUSHHH56p豓Ht?HxHПHHt?H} ^I$HtH5b H8JAAWAVAUATUSL$HH $L9uHdH%(H$1HIL׵IHx{H=#1IIHuOH@I4HMHEHHEu HEHP0HI9tgHLHHu1H$dH+%(H[]A\A]A^A_fH>H5 H81fDLLxnH CH@HQ>H5z H8HmkHEHP0\HHENH)=H5>z H811H<H8f.AUAATUSHHH=kH,IHrffH*CYW H* X ffH*CYW ID$H*KXH{ ID$ H{(ID$(H{0ID$0xH{8ID$8jH{@ID$@\H{HID$HNH{PID$P@H{XID$X2H{`ID$`$H{hID$hH{pID$pH{xID$xHI$HI$I$eHu0HcHLD[H]1A\H=x A]GI,$u ID$LP0H1[]A\A]ÐH=mx IHtHH5X I,$HjHt H2볐ID$LP0H=iHHi:H8ATUSHHHdH%(H$1Ht$迦HD$Ld$LHx uJmH|$H/uHGP0u=LH$dH+%(u>Hİ[]A\fDCH9HsH8%1SHtHG Ht+H[DHG(HuHC(Hu1[DG0t< t)HC(Ht;HHC 붐1$tƅt׾HHC Hu1몐1HHC(HuHC 1느AVAUATUHH $HxfH VE1LdH%(H$h1Hl$D$HHAv D$(HIHD$HD$ Hv D$ D$8D$HPHP1ZYtf谪|$ Lt$`IŃtHt$0L警LI蒥MxHD$HBD$`LLH@tڼIHoH$hdH+%(uiHxL]A\A]A^f.H|$0LLIMyH7Ht$HH8IDI|޽ff.ATHH UHUHt SH0dH%(HD$(1HD$PHD$P1LL$LD$sZYH|$H;=<肗HD$ HH\$ #軺8}|$t$ HHL$ILHHxHH=?1OD[8u^!u5踨|$HL$1ҋt$ IALH覣Hx1HT$(dH+%(uH0[]A\DH5H8)bfUH $HHHHHs HdH%(HD$1LD$D$A1Et t$HHT$dH+%(uH]ff.fUH GHHHH%s HdH%(HD$1LD$D$tJE0t$t< uBt>@Ht$Hc謊HT$dH+%(uH]fD1@<9fUH FHHHHr HdH%(HD$1LD$D$tJE0t$t< uBt>HIt$HcHT$dH+%(uH]fD1@<艺fAUH=VIATUHuHfIHL@ML$L@(H TDHq @8@HHq ID$1AD$ ID$XtdIl$0H- HHDdɥHI>LID$XI|$Xt L]A\A]H)3It$HH8蜨@I,$tE1L]A\A]DID$LE1P0AWAVAUATIUSHH $H;DD$ t$H@H[]A\A]A^A_@H<$HIHI$HtHH9$vHH蝅L<$KH4H3I$Jt>HtL9,$yH1[]A\A]A^A_HHEu HEHP0I<$1豄Mt@H|HHH;SI9uH;膄H[]A\A]A^A_I$fAWAVAUATUSHHGHt$HHŁttII!IHu1JJ\5LHIIMI7CIL9rH 1H5= H8}1H[]A\A]A^A_@H1H5 H8RH1[]A\A]A^A_ÐÃt4HD$H[]A\A]A^A_ftHkmD[HuAGHT$`ff.H`Lff.HJff.HBkff.HHH5m dH%(HD$1HT$t0|$'x#Hc HT$dH+%(uHfD1觵HHH53m dH%(HD$1HHT$衄t54$|$聹x%H4HHT$dH+%(uHD1/ff.@AWAVAUATUSH(HXI{IAEӠI|$XHHH˛HLsLF{.HuHt{.uHtCH=>D$HHD$菋IHIt$0H@H@H@ H@(HuHHt$ȖHt$HH|+HHt$IHHt$H_LHLKI|$0ID$HH@HHtrH8tlLH蹶LIEjAEMl$XMt!ID$XtLHHqE1H(L[]A\A]A^A_@LH轱LIE}IELI}t#I}tD$AE0HD$IE8 ImdIELP0UA|/I</I|H5 H8,It$HH8諡 fDATUSHH dH%(HD$1HHt$H|$߫HkXHt=HCXIHILF1HپHi H=u9H{0H$Ht$H|$]HD$dH+%(u*H []A\@H91H8葑tH%αff.UH賌xHEH]H@fD]fDATHLHUHH 2;E1HhdH%(HD$XHh Hl$HD$(HHD$8ID$@HD$HHD$PHD$XHD$HHD$ HHD$(D$D$HD$PHD$PHP1sH tT$t$ H"$IH跚HD$XdH+%(u HhL]A\臰ATHLHUHH 9E1HhdH%(HD$XHk Hl$HD$ HD$(IHD$0D$8HD$@HD$HHD$HHD$HD$ HD$PD$ PHP1sZYtt$ 1H.#IHÙHD$XdH+%(u HhL]A\蓯AWHLHAVHH 8AUATE1USHhdH%(HD$XH Hl$HD$ HHD$0IHD$8D$@HD$HHD$PHD$HHD$ HD$XD$D$ D$HD$PHD$PHD$ PHPHD$4P1qH0tZDd$D<$\$Dt$ 膚IAumuiEuHt$0DDOALd1E@}IH[HD$XdH+%(uMHhL[]A\A]A^A_f1EȀEfH|$0D蓿AfAUHL HATHH 6E1UHPdH%(HD$HH i HD$(HD$IHD$ HD$0HD$8HD$@H$HHD$HHD$1spt2*|$(IŃtNLAEuSL%,I$HHD$HdH+%(uHHPL]A\A]H|$ nLA˓EtH?&Ht$8H8貛I訬HHLHdH%(HD$1HLL$H ,5oA1EtH56'|$ HT$dH+%(uH3AWHLpHAVHH 4AUL-]g ATE1USHhdH%(HD$X1HLl$Hl$HD$IHHD$ HD$HD$(HD$0D$8HD$@HD$HHD$PD$D$PHD$PH-PHD$$P1nH Dt$\$D|$ 0|$8IăELD$0Aƃu EADLƉ2ty8_u EL_LؑL%A*I$HԔHD$XdH+%(HhL[]A\A]A^A_fDDL膑tH#Ht$HH8nIfDLkLHt#H$LH5jx E1H81eTH*La LE1H SH5nx H814#f.AUHHHATH 2USHdH%(HD$1ILD$ltYDl$D$$fD 8u^ѫu5hDDH蚞H`uH(H 1HT$dH+%(uH[]A\A]H"H8fAUHLPHATHH 0E1UHPdH%(HD$HHd HD$(HD$IHD$HD$ HD$0HD$8H$HCHD$1HD$@kt.`H|$ I賬LAXEx3L%'I$HOHD$HdH+%(u(HPL]A\A]fH!Ht$8H8 IfHHL>HdH%(HD$1HLL$H /jA1EtH5v%|$mHT$dH+%(uH蓧HHLHdH%(HD$1HLL$H .jA1EtH5v$|$HT$dH+%(uH#AWHL`HAVHH A.AUL-b ATE1USHxdH%(HD$h1HLl$ Hl$ HD$(HIHHD$8HD$@HD$HD$PHD$XHD$`HD$hD$D$HD$PHD$$PHPHD$8P5%HD$LP15$iiH@Dt$D$HT$DL$AD|$ÃtAą~ EDL$ Ց|$HDL$ IŃu^ Hl$HD$ HD$(IHD$0D$8HD$@HD$HHD$HHD$HD$HD$PP5"HD$P15I!eH t>Dd$ Dt$襎H|$0DDI貇LA藉Ex:L%!I$H莌HD$XdH+%(u/HhL]A\A]A^HHt$HH8DI:f.AWHHHAVLhAUATE1USHY HdH%(H$H\ Ll$`H\$hHHD$xMHDŽ$HDŽ$DŽ$HDŽ$HD$hHD$HD HDŽ$HDŽ$HD$ HD$(HD$0HD$8D$@HD$HHD$PHD$XD$D$D$ HD$ PHD$PHPHL$,QH {'P1Hl$@UAPdH@H$Dd$\$D|$ t H|$(H|$xt H|$0葌IAEHL$0EDH$hAL]EL%I$LPHHH$dH+%(HĸL[]A\A]A^A_@H H5n E1H8ODEAEA R@HIHT$HH$H84Id@Ht$0H$A)艟fAVHLHAUHH a%ATE1UHhdH%(HD$XHZ Hl$HD$ HHD$0IHD$8D$@HD$HHD$PHD$HHD$ HD$XD$D$HD$PHPHD$$P1aH tDDd$Dt$ 蕊IAt\Ht$0DDyLA聅ExYL%I$HxHD$XdH+%(uNHhL]A\A]A^fH|$0DúLA(EyHHt$HH8IDSHHHH #HdH%(HD$1LD$I`A1Et(;4$|$Hqu Hc踢HT$dH+%(uH[fHH81jf.H0HHHdH%(HD$ 1HD$H "P1LD$$LL$ Q`AX1ZEt!T$ t$|$Tt'HhHHT$dH+%(uH(HQH8艵œfAUHHHATH T LE1UHdH%(H$H"W Ll$`HL$hHD$pMHD$xHDŽ$DŽ$HDŽ$HD$`HD$H HD$HD$HDŽ$HDŽ$HD$ HD$(HD$0D$8HD$@HD$HHD$PD$ D$PHsPHL$QH P1Hl$0UAP^H0tL$T$ E1HLIL|HtH$dH+%(uHİL]A\A]ff.ATHHHUH HL dH%(HD$1IH$PH<$=tHxHI`LHcsHtIHёIH<$HtH/tHD$dH+%(u.HL]A\@HGP0+lHtE1\ff.AWHLHAVHH AUL-uF ATE1USHdH%(H$1HL$H$H$HHIH$HDŽ$HDŽ$DŽ$HDŽ$HDŽ$HDŽ$HD$0HD$(D$$D$ HD$ PHD$,PHPHD$@PHD$PP1oNH0L|$(f\$HD$pDt$HL$ )D$P)D$`MtHm HtxI9H6HH9AHHL$HHHL$HT$`Ht$XHy&HL$tSHy HT$pHt$h 6I9tHTI9GuLHtPH!H5Y H8誙E1HOtH$dH+%(HL[]A\A]A^A_I1HT$@Ht$0tI 1HT$HHt$8tHD$0HD$XHD$@HD$`HD$8HD$hHD$HHD$pH$A$A׃tWÅ~fauIċD$PAuttxH$1҅?L5pL%I$@HH5X E1H8_f.E$15|fD$PANL$MH^LH54X H81dDH9H5jW H8誗DHD$XH$H$HD$`H$HD$hH$HD$pH$H$1uxH HHH H8H%DHHHHdH%(HD$1LD$H ^;A1Et|$mx'Hc/}HT$dH+%(u Hf.Hi H8衐wf.HBHHc|H賉HHc|HHHHdH%(HD$1LD$H :A1Et |$j|HT$dH+%(uH0wHHHHdH%(HD$1LD$H c.:A1Et |$|HT$dH+%(uHvff.HHHHdH%(HD$1LD$H 9A1Et |${HT$dH+%(uH`vHT^OH HHf.HcHD{@ATUSs(H@IHtHs@+[I]LA\fDHY H8t苎+L[]A\ÐH5aI +L[]A\f.H3|HhHH(HH5K dH%(HD$1HL$HT$ DA1Ett$|$ ct#H HHT$dH+%(uH(H H8tf.HHH5 K dH%(HD$1HHT$CA1Et4$|$tt&H HHT$dH+%(uHfDH H81jtf.HH HH5|J dH%(HD$1HL$IIWCA1Et4$|$vx%Hv HHT$dH+%(uHDHa H8虌sfHHi HH5I dH%(HD$1HL$IIBA1Et4$|$!Lx%H HHT$dH+%(uHDH H8 BsfHHH5I dH%(HD$1HHT$ABA1Et4$|$+Lx'H` HHT$dH+%(uHHI H8聋rf.HHH5H dH%(HD$1HHT$AA1Et4$|$;Wx'H HHT$dH+%(uHH H8*rf.H(HH dH%(HD$1LD$HT$ H5VH AA1EtHt$|$ HT$dH+%(uH(qfDH(H HH5H dH%(HD$1HD$ HL$PI1RLL$ @AX1ZEt T$ t$|$Fx#H HHT$dH+%(uH(H H8ىqfH(H HH5G dH%(HD$1HD$ HL$PI1RLL$ ?AX1ZEt T$ t$|$fx#H HHT$dH+%(uH(H H89rpfHH HH5F dH%(HD$1HL$sA1Et|$ZMx&H HHT$dH+%(uHfDHy H8豈of.HHI HH5jF dH%(HD$1HL$=sA1Et|$j1x&H HHT$dH+%(uHfDH H8!Zof.HH HH5E dH%(HD$1HL$rA1Et|$`x&Ho HHT$dH+%(uHfDHY H8葇nf.HHY HH5`E dH%(HD$1HL$rA1Et|$Zx&H HHT$dH+%(uHfDH H8:nf.HHH5D dH%(HD$1HT$qA1Et|$FxHcsHT$dH+%(uHHI H8聆mf.HHH5jD dH%(HD$1HT$qA1Et|$豅xHcrHT$dH+%(uHH H8:mf.HHHζdH%(HD$1HL$H5C pA1Et |$zHT$dH+%(uHlATHHHUH ٿSHdH%(HD$1LD$/A1Et.Dd$vXDH4HqSx-H HHT$dH+%(u#H[]A\fH H8*lf.ATHH5B USHdH%(HD$1HHT$;A1EtD\$,$WI1H9~f߃49uLRH HHT$dH+%(u H[]A\kAVHLH5ZB AUATUSH dH%(HD$1HL$HT$ LL$k:A1Et>Lt$Dl$Dd$ WLDDHYHRx.Hg HHT$dH+%(u$H []A\A]A^fDHI H8聃jf.AVHHHAUH ATUSHdH%(H$1LD$-A1EtcDt$Ll$H\$ D$ Dg8ufluU VHLDIfLQxɋt$ LH$dH+%(u)Hİ[]A\A]A^1@HQ H8艂ifAWHHHAVH AUATUSHdH%(H$1LD$LL$,A1EtgDt$Dl$Ld$D$ H\$ f8unku](UDLDHI4cLPxƋt$ LH$dH+%(u.Hĸ[]A\A]A^A_1@HQ H8艁hfAUHHHATH HUSHdH%(H$1LD$ +A1EtLDl$ Ld$@e8u^juM@TDLH2YH8OuLܛH$dH+%(u*Hĸ[]A\A]1@Hy H8豀gf.AVHL HAUHH !ATUSH`dH%(HD$XHP Ll$HD$ HHD$0MHD$8D$@HD$HHD$PHD$H HD$ HD$XD$D$HD$PHPHD$$P1N*H tvl$Dd$ 3Ht$0DjLMt;fd8uq,iu8RIƃuH|$0D^vLMuL% I$fE1LPHD$XdH+%(u)H`L[]A\A]A^DH H8!IWfAWHLHAVHH QAUATUSHhdH%(HD$XH O Lt$HHD$(HD$0MHD$8D$@HD$HHD$PHD$HzHD$ HD$XD$ HD$D$HD$PHQPHD$ PHPHD$,P1(H0,$Ll$Dd$=f.Ht$0LD=L4Lt>b8uvqgu=QIǃuH|$0LD@ULKuL%[ I$@E1LNHD$XdH+%(u)HhL[]A\A]A^A_H) H8a}IdAVL HH5u; AULATUSH dH%(HD$1HT$HHD$P1LD$ q3ZYt[Lt$Ll$Dd$f.kfu7PDLLHzHJt҅u.HW H1HT$dH+%(u&H []A\A]A^Ð;aH2 H8j|cAWL HH5: AVLAUATUSH(dH%(HD$1HHT$PHD$P1LD$ 2ZYtaD<$Lt$Ll$Dd$ @{eu?ODDLLHHHJtυu;Hd HfD1HT$dH+%(u.H([]A\A]A^A_;`H2 H8j{bAUHH59 ATUSHdH%(H$1HT$ eA1Et}Dl$ Ld$f_8duy$NDLH6DHIut$`t$`t$Xt$XLL$XLD$PHL$HHT$@Ht$8H|$0%H H$dH+%(u'HĘ[]A\A]1@H1 H8izafAWHH58 AVAUATE1USHdH%(H$1HL$HT$ LD$0tyDt$Dl$Hl$D$ Dd$ D^8mcMDDHDI\ZLGxD$ u>L%O I$H$dH+%(HĨL[]A\A]A^A_fDH=`IHtdHc|$ e|$$ID$\3Hc|$ID$ eHc|$(ID$(~eHc|$ID$0oeID$8@HbI,$t,DE1NH H8xI/ID$LP0_AVHH `H57 AUATUH(dH%(HD$1HT$ LL$LD$.Dt$Ll$l$ Q?HuawKDLIlLHlFHx'HdHT$dH+%(u9H(]A\A]A^H H8wHu>HHt1_UHH H5B6 SHdH%(HD$1HT$I.tTO\4$|$HZ>HHt!HcHT$dH+%(u2H[]fuE>Ht1@H H8)wb^fUHH!H55 SHdH%(HD$1HL$atW[|$H 7HHt'HcHT$dH+%(u8H[]u=Ht1@HA H8yv]fAVHH55 AUATUSH dH%(HD$1HL$ HT$,A1EtuDt$ Dl$Ld$D$@Z8uv_ue(IDDLH'WHDxDd$Hc,bH=q4 HD1xHT$dH+%(u)H []A\A]A^1@HI H8u\f.ATUSHdH%(HD$1Ld$D$DY8un^u]XHLH$HSCxDd$HcbaH=3 HD1wHT$dH+%(u'H[]A\D1@H H8t[fH(HH5M3 dH%(HD$1HT$ T_A1Et(t$ H|$lu0T$t$H=3 1bwHT$dH+%(uH(DH H8)tb[fH(dH%(HD$1H;Au>T$L$H=2 $vHT$dH+%(u&H(Hq H5. H8Bj1ZfAUATH(dH%(HD$1HT$Ht$H|$ KxT|$s-|$Ig-|$ I[-LLH=H14vHT$dH+%(uH(A\A]H H8r2ZfAVHHHAUH  LaATE1UHdH%(H$H-C Ll$`HL$hHHD$xMH kHDŽ$HDŽ$DŽ$HDŽ$HD$hHD$H@w HDŽ$HDŽ$HD$ HD$(HD$0HD$8D$@HD$HHD$PHD$XD$D$HD$PH}PHD$$P1Hl$0UAP-H0twH$Dd$t H|$(H|$xt H|$0DIAHT$0H$D^>AL?EL% I$LBH~BH$dH+%(uHĸL]A\A]A^fH H5, E1H8gDHt$0H$nAkfDHy HT$HH$H8dlI^WAVAUATUSH@dH%(HD$81+UH|$8HffLt$(HH* @Ll$ Hl$H='H*D$ $^D$WD$HI3HID$fH*^$t3HtID$ fI*^$W3HtbID$(fI*^$:3HtEID$0fH*^$3Ht(ID$8HD$8dH+%(uKH@L[]A\A]A^I,$t!E1@H H81oI@ID$LE1P0SVAUHL{HATHH E1UH`dH%(HD$XH> Hl$HD$(HD$0ID$8HD$@HD$HHD$PHD$HHD$HHD$ HD$PH*P1ZYt?|$8Ld$u^yAH|$0LI9LAnH`L]A\A]LIH Ht$HH8 DIUfAUHL@zHATHH E1UHdH%(H$H>= HD$(HD$IHD$ HD$0HD$8HD$@H$H-HD$HHD$1@@|$(Ht$PIŃF6LA+;E$$$$L$L$H$H$Ht$xH|$pH IH=H$dH+%(uLHL]A\A]DH|$ ;LA:E`H Ht$8H8nBIdS@AUHLxHATHH UH`dH%(HD$XH; Ld$HD$(HD$0MD$8HD$@HD$HHD$PHD$HHD$HHD$ HD$ PHMP1ZY&Pl$ |$8Iʼnt>)2HHtCHWIL} H8vdI뺐H|$H/uHGP0KAVHLwH5# AUATUSH dH%(HD$1HHT$LL$}A1Et3Hc$Ll$Dt$H1#NHD$HuL1HT$dH+%(H []A\A]A^cH8%M6DLHIHD$Hp HLH1HxH9u HD$fH|$Hc:HD$ifGH H8cAH|$H/uHGP0H H8b%JH|$H/HGP01SHHXHt HCXHChHC`[AWHH5g! AVAUATUSHHdH%(HD$81HL$ HT$OLd$ Dl$LDL:IHE1Ht$0H|$(HL׏D!f.F8mKu,5L|$(DILSLH/Hx1LD$ Ll$0ED$ AME1LAIP _D9LSHy EHtGHWHT$8dH+%(HH[]A\A]A^A_H% H5n H8WfD(HtN1f.LLl$0AEKL@H H8`_@HULBGfAWHH5q AVAUATUSH8dH%(HD$(1HL$HT$ >Ld$Dl$ LBL8IHHt$ H|$HLAԍD%D8mIAą2L|$DIL8`LH-HxLLl$ E1EME1fLAIP ]A9|LSHHUHT$(dH+%(H8[]A\A]A^A_H0 H5 H8U&HtO1LLl$ E~SE1_fDLLl$ ECLHZ@LILHT H8^nEE`AVfHLqAUH5M ATUSHpdH%(HD$h1Lt$HT$)D$LL$L)D$ )D$0)D$@)D$P{Ll$\$B8mGu,1HT$ LHt$INLH+HxHt?HTIH|$tL<[HD$hdH+%(uCHpL[]A\A]A^@c$HtE1fH H8A]HutD@AUfHH5# ATUHpdH%(HD$h1Ll$HT$ )D$L)D$ )D$0)D$@)D$PJt`HT$ Ht$|$ S.HHt:H2SIH|$tLOZHD$hdH+%(uHpL]A\A]f{#HtE1Cff.SHH5b HdH%(HD$1HT$Gt9|$vÃtHcHT$dH+%(uH[Ð"Ht1-Cff.fHHH5 dH%(HD$1HT$FA1Et|$HT$dH+%(uHBHHHHdH%(HD$1LD$H 3A1Et1|$@HT$dH+%(uHWBHHHHdH%(HD$1LD$H NA1Et1|$@DHT$dH+%(uHAf.HHHHdH%(HD$1LD$H ӒA1EtD$1<@HT$dH+%(uHrAfHHHHdH%(HD$1LD$H #nA1Et1D$@dHT$dH+%(uH Af.SHH!fH5 HdH%(HD$1H^DtTH<$HHHH % Ãt& HT$dH+%(uH[f; Ht1m@ff.fSHHeH59 HdH%(HD$1HCtDH<$H@H 0 Ãt"K HT$dH+%(uH[DHt1?ff.fUHH5 HdH%(HD$1HHT$tvD$<$HHH HHH!H H @H HH!H Ht HGHT$dH+%(uH]fHt1?ff.fAUHH5 ATUH H dH%(HD$1HL$LL$HD$HD$I Ll$=Hl$Me L8HHU LH=1HHHx 5HmHη H8WH|$IHudfH|$HtH/t`HD$dH+%(H L]A\A]Hѷ H5 H8BME1H|$HtH/uHGP0fDHGP0HEHP0LH=QHLXu"Hmu HEHP0L% I$H\=ff.ATHH5O E1HH dH%(HD$1HH$@t1L$$I|$ `Ku\H=L3uaL%R I$H<$HtH/tHD$dH+%(u=HLA\@HGP0H H8QUI@H|&LF!L>!H$dH+%(HL[]A\A]A^A_fHt$@LHIMAI8H HH5 H81rI9u Ld$cH|$Ls&6ff.AWfL= HAVL[HHAUH 4ATE1USH(dH%(H$1HsL|$pLl$pHD$xHHMH$HnHDŽ$HDŽ$DŽ$HDŽ$HDŽ$HDŽ$L|$(HD$0HD$8HD$@HD$HD$PHD$XHD$`HD$h)$)$)$)$)$D$$D$ HD$ PHD$,P1L$AVHl$@UAPAH0$\$DD$~DD$ Ht$@DD$ $H$IH$yH$t{Lc 7LcLML% I$LH{H$tLJH$dH+%(udH(L[]A\A]A^A_LcfDH LH5 H81EHy H$E1H8"f3ff.AVL5 L YHAUHHH JATE1USHdH%(H$1H7qLt$`Ll$`HD$hHHMHD$xHlkHDŽ$HDŽ$DŽ$HDŽ$HDŽ$HDŽ$Lt$HD$ HD$(HD$0HD$8D$@HD$HHD$PHD$XD$HD$P1Hl$ UAPH tr$\$ ~v$Ht$0IąH$LLcOMtoHë H$H83!IL8H0H$dH+%(uuHİL[]A\A]A^f.[ LcLMuL%D I$D1LcfDH LH5g H81 h1ATHHHUH YE1SH dH%(HD$1LL$LD$D$zH\$l$HH1&4HD$IHIT$1It$ >Ho.8u53x!Ld$f.HI H8IH|$AH/uHGP0HD$dH+%(u_H L[]A\@.H H8.IIfH9u Ld$@H|$H# ;40@AWHLpUHAVHH q~E1AUL- ATUSHxdH%(HD$h1HmLl$ Ld$ HD$(HMHHD$8HD$@HD$HD$PHD$XHD$`HD$hD$$HD$$P1ZYD$HDt$~ ELl$@H+ MLDH8 H$HHHH  |$HHHIDžLEUFHLH\,8"HL Ht$XE1H8HdLHD$hdH+%(PHxL[]A\A]A^A_fDHfD+HqH9 LH5H81 HH$H$HHH Ht$XE1H8 SE1?1yFIHtyHDH$H9LmHfDIH9$A}IuLuH) ,IHt4HLy.I.uIND$ LQ0D$ u LE1I/uIGLE1P0C-AT1UHEIHtC"*CHHtLHL-u,Hmtm/HHu!HL]A\Hmu HEHP0I,$t!E1HL]A\DID$LE1P0!HEHP0ff.ATHH5 HdH%(HD$1H/t`H4$Hx_10/IHtHHpHx [tHD$dH+%(uKHLA\@I,$uID$LP0fDE1H H5H81I+fDSHH5 HdH%(HD$1HT$/t9|$ÃtHcHT$dH+%(uH[Ð Ht1=+ff.fHHHHdH%(HD$1IH %y0A1Et H<$HT$dH+%(uH*AUH=vATHS6HtnIċL-t*LLH5 HHLA\A]@L-H5uLZ'xLf.E1HLA\A]ÐAWH=~wAVAUATUSH5HtI GIH`H L(MImHuqHkHL HH,HH-LLHQI/u IGLP0Hmu HEHP0ImIHtK=HF#HHtHHH)Hc=,IHi4ImIHuILH5' Lj I. 1H58 LG H5! L+ H5  L H5 L H5L H5 L H5 Lg H5 LK H5 L/g 1H5s LN H5` L2 H5M L H58 L H5% L H5 L H5 Ln H5LR H5L6n H5LR @H5L6 H5L H5L 1H5oL H5_L AH5JLu 1H5;L\ H5,L@x H5L$\ H5L@ H5L$ H5L H5L H5L @H5L| H5L` H5LD| H5xL(` 1H5iLG @H5SL+ AH5@L BH5/LCH5LDH5 LEH5LgFH5LKGH5L/gHH5LKIH5L/JH5LKH5LLH5LMH5vLNH5dLkH5RLOH5@L3kH5.LOH5L3H5 L@H5LH5LH5LH5LoH5LSH5L7o1H5LVH5L:H5LH5LH5xLH5pLH5hLvH5RLZ1H5@LAyH5*L%]H5L AH5L%H5L H5LH5LH5L}H5LaH5LE}1H5L,dH5uLH1H5cL/H5SLH5BLH5/LH5L@H5LkH5LOH5L3kH5LOH5L3H5LH5L1H5LH5LH5LrH5{LVH5mL:rH5]LVLHH=г[;3LH.H=8;LHH=j;H H5LHHH=$L-L5vL=oHLH5LHsLLH5H9L-}LLH5HcH5LHH^IHCH5KiLHAiLH5!LL-H_H5hLHh^LH5=LH=LH5" H+ʚ;RHLHY'HLHJCHLH:fHLH+nHLHHLHHLHzHLH<HLHo9HLHX8HLHAOHLH*HLHHLH#HLHkHLHtYHLHfQHLH\%HLHMxHLH=rgHLH-[eHLH#DtHLH-?HLH HLHXHLHVHLHHLH"HLHSHLH.HLHuhHLH^bHLHG_HLHu0NHLHi HLHZ$HLHJHLH@UHLH0^HLH">HLH;HLH x#HLHamHLHJHLH3HLHsHLHHLHAHLH{HLH|HLH}HHL~HLHwHLHghHLH\QHLHQ:LHL'LHLHLH<}HHL_HLHLHLLHLHmuHEHP0 f.E1HL[]A\A]A^A_ff.AUHH5ATE1UH dH%(HD$1HT$ tMLl$LHHt81Ht$HDtH|$$IHtEHIHmt#HD$dH+%(u@H L]A\A]fDHEHP0@Hq LH5H81] fDGU8'HKHcHcH>@]]w}H tp]wH ]fDu:KHPf_] ЃÐwH Hcu_t1]fwH Hc1_]!fD1 ]fD1 ]fDwH< ,뚃!H ]fHH (]H( <(]f*#k#l_] f.i"#1_]!]""]HP1f_]!]0)]ff.@AWAAVIAUAATAAUASAD$HAHHD$HH-H$; HKwHcDH>DE1HD[]A\A]A^A_D9{wD9{sDA9Cw9CsH fD9{wD9{rfAHD9{tHvCHAw$HT$A DHHH#\HH1@AwH$D#2H$ fD{Ds AAUIATIUSHHoHHH)HH9~HSH9HEA}wAEHHcH>H1LLTHxI$tH9wH)HH[]A\A]EmH9wzf.HH9v;A$A9uHI+$H[H]A\A]fHH9w3HH9vf8 u|@H)HH[]HA\A]@H9I HH9vLL9uyAU1ʁ!HH9wfDHH9vf9 tH)HH@EmH9w}DHH9;A$A9tfDAEЩtHH)H@HH9w&fDHH9sf9uif1_fATE1USHwhH;w` D[]A\HHFHHXHIHHHHtHEXDH]`[]A\HA7DAWAVAUATIUHSH8HGLwhT$HD$HG`MIVHHXHL)HGJ7D$HUh1HMAL=jHCLcC@HEA<$HCTAT$ tHt$H)H9AD$MՃIHCAAHSHJ:HK9IcL>DBHH9EH~|HUPH|L$HH|$ I9uZMtUL;d$  HC=@8A<$D$9D$u"HCIHHCL9d$  H9D$wLmhE1MLIUHCHUhIH}XIJH H5HcH>IAfMLmhMuHC HS8HHHCHEmIH8L[]A\A]A^A_H9HIFKHIHIHHHH HEXHEhH]`HPHLmhIHC8HHCHEfMHs(HC8HKL[ HuHHs0HHu@HpHMDFM9| A-H;H#LHE`H)Hw+HLT$mLT$LcEH}XJHC8HPHEhHHEhHS8LhHELmhHBHU`L)HGHHLT$ LT$LcEH}XHEJHr8R@J/HEhHLfLMHCI S@Lcf.HC8JT/HPHEhLhLmhMfH{8HGHLLmhUMLmhA:MuHCHK HS(HsHHHCvHK HUHHS0HU@HUhIH9H@MuHCHsHLT$HEH iIH]LT$HMXHUhLIH,HA(HAHA LaHEHHA0HE@fDHC8MdH HC(HHH)I4fM_LmhE1MuLcA$MIHC-@HC8JT/HPHEhLhLmhMHC(HHI)BHHCHCH;D$8HHCHpfHCHCHHCfDHCH;D$9HHCm@K@HCLmht E1H9EHEADHCH;D$;JHHHSHC HCH;D$8AHC8A9HCHCRHШt HHHE@HEHH9HEPHKH HCHCH;D$9DHrHDHMHS8HLbH LM`HCLmhLEXHqE\$LHEL)Hs LL9wH2IUHHGHUhS@MI MLMI@M`AP@fHMIHS8HIH L]`LmhLJHqLHCH}XL)MEHHL$AIHEHs H9WH|$GH2LLEhMa LHGS@LgHMW@DBHH9EHHuPHLHBL$s@LbHMr@HCHt$zH)H9DB HEHrHLl$L|IH2H}XLT$J IHqHA HAVLHAL9i IЋH]HHY(H]@HY0 HUhLE`HEHrHMI)IGwL9K<IHEHuhHqILIҋ>HC L$q@Lcs@HCRMIHH+uH9Hu`LmhH)HEH}XIIUHM)IG<J/IHUhLMHC LcC@fz LczBH=HcH>fDHU@HEHMIHS0HHC(HS8H~^HtYHU`L$HEhH}XHH)I9vI4H9JIHEHuPLHLT$qLehLT$LcA$~ At$HC HU`LmhHEH}XIIuHM)IGUHKJ/HuhLHB La\fHCH;D$Y8 KHCH;D$9;JP(HCH;D$8AHC8A9`HCH;D$0z6BHH9EHHuPH HtHH9@@HH9sHCH)H(9@88dHHHCH9?H9D$wCHsH|$MIDBH)I9!HuEHC HA$A<JHEHHUhHA(HE@HA0AD$IՃt E1H9A WLE`HAHrHH}XMHEI)IGPHuhA4$HLIM$q@HC Lcs@HCRMILmhE1HH+uH9[Hu`H)H}XIUHHEIM)IGJ/IHUhLMHC LcC@ BHHC1HUHEH9I9 AT$v H t 6_-I9A$1u<_u{HKHHKHIfDEd$L9AHBLL)HIEHHGwL9x JIHEHEhLcJ/C@LHMHBB@HELbHuHHRH|$GHs(Hu@Hs0HLLEhLHGfH9INdJH9 INdL9bItJ LaH9dJIHEM94 ItJLcUM9ItJHS8LJL9\ItKHs8LfH9D$It$ HLT$LT$ HCH;EHUHHQ(HU@HQ0L;ebf.H;BH2HEHHU@HC(HS0H~SL$I9vK,L9 KIHEHuPK<(LLT$ LehLM`H}XLT$LehMLL)HwIEL9 JIHEHC8H@J/HuhLM`HS8LnHELLmhL)HBHGqLEXH~PHLbV@K(H}hLMI HCLcS@SHUHEH9=1I9) 1I9 191L9eL;eA<$ wL;emA|$ \HEHMH91I9v9At$HL$ @t$NT$HL$ HHPf@_ ƒ1I9s-T$E$$T$HAHfA_ ȃ9!HEHMH901I9v9At$HL$ @t$T$HL$ HHPf@_ ƒI9dT$E$$T$HAH>A_42HEHUH9I9 I91A<$T$蚻T$A<$T$ T$A<$T$6 T$A<$T$,T$1A<$_1HEHL)HRI9wHEHuH91I9v%AD$xH n <_ 1I9XA4$@JH n @@_ 'HMtfI9NItJHs@MH9D$v0A;t$nM$Lc:fDHHSDHrHLLl$ IHLT$HMXLLaAD$L9LALA DT$HAt H9EHELmhHA@HH9~HMPHHH9uHUHE1H{8LmhGHC(H:HMI)*LmhHE1MIEKLT$IIHMHLeHHwHEXHEhLe`LT$L@HHEdLcHIEKLT$HIHMHLHH HEXHEhLe`LT$HPHHELcHIEKLT$HIHMHL跿HHHEXHEhLe`LT$HPHHEH~PLEXL9NI8K4HV8rHHBKLT$(HIHL$ HT$HLHL7HHILT$(HL$ HEXHEhHT$Le`HpHHEI9IA$fDH1LHcHxHEtI9wH)H[]A\A]DAEЩFLH)fDI9WIHI9LHuHH+EH[]A\A]AU1ʁsHI9wffDHI9u8 tHH)D@HI9wHI9E8 ufEmI9wfHI9tG;A9uC@EmI9weDHI9t;A9t@LH+EH[]A\A]fDHI9wfDHI98uof1ifAWAVAUATUSHHH_LgL9>IHF Nt,LH)H9tPLH)H9HC@LUL|HHI:f.SHLtMn1LLM.HuHLkI9u1HH[]A\A]A^A_fDL9sHI1HLI^Ht@DUDMLEIDmAuL9sO<ωDHI9vD8+uJ I^Iu>1LLLL$1HSHLL$I9w>DILN&~LE1H)L9}fDIBDIEI9uL9JAK4LHD$LLML)H)HLHT$IA@fDI9H8CuI9HT$LD$8MILlCD=HTL<8uHPL9tHI94HfDLLD$0L)LT$(H؉L$$HGHD$HH1LH|$HLD$0HI9LT$(L$$IAH|$JLMLD$8L9L H9HO wKIcL>H9v4HGHDH)HvH @HH9tD9r1@H9vHH9vHy@H9vHqf.HH)HvH$RH9vH9=@H/HHBH)HH9gH<ff.@1H9AWHDL=AVIAUIATUHSHH$L9}HEPIcL>f.I9vcHpHI9vWHHAH)HI9wAJ<HHH)HI9w'-HfHH9U9r1H[]A\A]A^A_HJI9vH4fI9vLH)HIH9wHI9vHPpI9vHh ;pwHtLH{AD$HDI9afI9OLH)HIHH94L]HtL;ABA4 ABI,hfDI9HI9JI9LH)HIH9LEM9LD$PHtHxLLD$AD$II9j8HhXI9OE1fHTI9:I91L0H)HHH9HhwHtLH5CHDI98HHI9LpH)HH9HMcLdgfI9H8 }DI9oLH)HIH9WHI9JHPpI9:Hh ;p-HtLHUAD$HDI9HhZI9HH;$9fI9HI9I9D`LH)AL$HH9DHAvA|$H9v | Ht5HxLHL$MHL$Hl@I9/LH)HH9HUHlI9HHPI9HH I9HxууNu)H9fDHuyMgHt5HxLIAD$HDI94LH)HIH9HhH4LHAAD$Hl\H4fUHH HtH/t9H}HtH/tH}(H/uHGP0H]HGP0HGP0HtJHt,HtHT H5H8xHO H5H8Rfff.HHP H5H8"1Hff.HHiP H5H81Hff.AVIAUIATIUHSHHGtsW x^U HEIE AEA$ uHEHH[]A\A]A^fDHM0HEH@HEH[]A\A]A^@1LL蛷ugHCIHAEA$HuHN H5#HD$H:HHHD$i@1^fH1O H5rH818UHHt HH}8HtH/tcH}pHt ŠHEpHDžH}hHEx衠H}HEhHtH/t H]HGP0H]HGP0AVAUATIUSHHHH dH%(HD$1HGHLJHH)HH~H?HHmIt L[]A\@HEHP0L[]A\fDE1[]LA\DAWAVAUATUSHGHDw8H|$uDD$߃ DD1IHH~ L HI9tSkDtH;距IHcHLI5HIu IGLP0HA!I9uEtODH=1.HH HLWHEHHEuHEHP0LؾH~sH='HHLH蠛HmIMHD$LH=Hp01菥I/Iu0IGLP0$f.HD$H=fHp01YII,$u ID$LP0HL[]A\A]A^A_fHIuIGLP0DE1HEHP0MTHHEuHEHE1P0fE1ff.H #ATUHHHFIH@`Ht HufHG(Hx HL-HHH@IuEHmtHL]A\HEHP0HL]A\H1L]A\H耻HmIu@E1HL]A\fIIfDUHH|J H]HAWAVIAUATUSHHnHIHHIHH~SL-!J 1DIDHH9t5ItL}LLHOHuI,$ucID$LE1P0HL[]A\A]A^A_H5IG L1HI HL[H]A\A]A^A_Hvf.E1ff.H@HyH\I Hff.AWAVAUATUSHLo MtIEHL[]A\A]A^A_fDHHHHD$HtE1H{HHkP:IFH<$HtGIF HD$HNtIL;cH}jHEL}H$4IHtLTHuI.u IFLP0HT$HH$HH6HBHP0'HD$HIHC ff.HG(L@(Mt Hw@HyHG Hf.HLTHtHf.HG Hff.AVIAUIATUHSHH=7PH57HqHtNHxILLH@HI H5H8zHH;-> H\$`HL$,HHD$`IWHHt$XIHtvH|$`tHD$HEIXHL$Io0AG8HD$IOIEMo HIG(IGPHHw H9sxthHq< H5H8bI/tBHH9EH~|HUPH|L$HH|$ I9uZMtUL;d$  HC=@8A<$D$9D$u"HCIHHCL9d$  H9D$wLmhE1MLIUHCHUhIH}XIJH H5QHcH>IIf.MLmhMuHC HS8HHHCHEeIH8L[]A\A]A^A_H9HIFKHIHIHHHH HEXHEhH]`HPHLmhIHC8HHCHEfMHs(HC8HKL[ HuHHs0HHu@HpHMDFM9| A-H;H#LHE`H)Hw+HLT$蝩LT$LcEH}XJHC8HPHEhHHEhHS8LhHELmhHBHU`L)HGHHHLT$9LT$LcEH}XHEJHr8R@J/HEhHLfLMHCI S@Lcf.HC8JT/HPHEhLhLmhMxfH{8HGH|LmhMMLmhA2MuHCHK HS(HsHHHCvHK HUHHS0HU@HUhIH9H@MuHCHsHLT$HEH ɥIHLT$HMXHUhLIH|HA(HAHA LaHEHHA0HE@{fDHC8MH HC(HHH)I,fMLmhE1MuLcA$MIHC#@HC8JT/HPHEhLhLmhMHC(HHI)BHHCHCH;D$8HHCHp^HCHCHHCfDHCH;D$1HHCc@K@HCLmht E1H9E HEADHCH;D$;JHHHSHCHCH;D$8AHC8A9HCHCRHШt HHHE@HEHH9.HEPHKH HCHCH;D$1DHrHD辡HMHS8HLbH LM`HCLmhLEXHqE\$LHEL)Hs LL9H2IUHHGHUhS@MI MLMI@M`AP@fHMIHS8HL]`LmhLJH:LHCMEHL)HwH}XHL$AIHEHs H9gH|$GH2*LLEhMa LHGS@LgHMW@DBHH9EHHuPHLHBL$s@LbHMr@HsHD$zH)HH9HuDB HrHLl$L٠IHH}XLT$J IHqHA HAVJHHAL9 IЋH]HHY(H]@HY0HUhLE`HEHrHMI)IGwL9K<IHEHuhHqILIҋ>HC L$q@Lcs@HCRMIHH+uHH9Hu`LmhHH)H}XIHEIUHM)IGFJ/IHUhLMHC LcC@y@z LcjBH=(HcH>fDHU@HEHMIHS0HHC(HS8H~^HtYHU`L$HEhH}XHH)I9vI4H9JIHEHuPLHLT$虽LehLT$LcA$ At$HC HU`LmhHEH}XIIuHM)IG]HKJ/HuhLHB LaTHCH;D$Qf8 BfHCH;D$1;JP HCH;D$8AHC8A9`HCH;D$0zΙ6BHH9EHHuPH HtHH9@@HH9HC&D9f98dHHHCH9H9D$wCH{HD$MIDBH)HI9H}EYHC HA$A<HEHHUhHA(HE@HA0AD$IՃt E1H9A LE`HAHrHH}XMHEI)IGeHuhA4$HLIM$q@HC Lcs@uHCRMILmhE1HH+uHH9PHu`HH}XH)IUHIHEM)IGJ/IHUhLMHC LcC@fBHHCHUHEH9I9z AT$fj H " wf_mI9A$f1uf_udHKHHKH;VIEd$L9AHBLL)HIEHHGwL9 JIHEHEhLcJ/C@LHMHBB@HELbHuHHRH|$GHs(Hu@Hs0HLLEhLHGfH9 INd@H9DI1NdL9ItJ LaH9JIHEM9l ItJLcUM9 ItJHS8LJL9ItKHs8LfH9D$It$ HLT$.LT$( HCH;E$HUHHQ(HU@HQ0L;eJf.H;BH2HEHHU@HC(HS0H~SL$I9vK,L9 KIHEHuPK<(LLT$裷LehLM`H}XLT$LehMLL)HwIEL9 JIHEHC8H@J/HuhLM`HS8LnHELLmhL)HBHGLEXH~PHLbV@K(H}hLMI HCLcS@3HMHEH9%1I9d 1I9 191L9eL;efA<$ uL;ekfA|$ YHEHuH91I9v?AL$u+L$ Ht$hL$ Ht$II8Gu 1f_1I9s7E$$AuT$$A̋T$H0Nu 1fA_9HEHMH91I9vBAt$u+t$ HL$Át$ HL$II8Gu 1f_I9HE$$Au!T$}T$IAIAЃfA_DHEHUH9bI9 I9P1A<$T$hT$A<$T$T$A<$T$,T$A<$T$"T$w1fA<$_1h@HEHL)HdI9NHEHuH91I9v)AD$fwH  f_ 1I9>A4$f/H  f_  HM0fDI9VItJHs@MH9D$v0A;t$6M$LcfDHHSHrHLLl$ĔIHGLT$HMXLLaAD$L9LA MLAdf.T$HAt H9ESHELmhHA>@HH9~HMPHHH9uHUHE1H{8LmhHC(HHMI)LmhHE1MIEKLT$IIHMHLMmHH>HEXHEhLe`LT$L@HHE\LcGHIEKLT$HIHMHLlHHHEXHEhLe`LT$HPHHELcmHIEKLT$HIHMHLlHHHEXHEhLe`LT$HPHHEnH~PLEXL9PI:K4HV8:HHBKLT$(HIHL$ HT$HLHLlHHLT$(HL$ HEXHEhHT$Le`HpHHEA@MԋA8DVM95HAHT$@H9vDD;A85HIHALI M9}HUhE1IM9HALM`HEILBHMI)IGwM9(ItJ 'HqHLEhL#L$Q@HCLcS@|HIEKLT$HIHMHL kHHHEXHEhLe`LT$HpHHEHIEKLT$HIHMHLjIHHEXHEhLe`LT$HPHHEMIEKLT$IIHMHLojHH`HEXHEhLe`LT$L@HHEMIEKLT$IIHMHL!jHHHEXHEhLe`LT$L@HHEFHHBKLT$(HIHL$ HT$HHHHiIHLT$(HL$ HEXHEhHT$H]`HpHHEHHFLl$HIHLLqiHHbHEXLT$Lm`HEhHs(Ht1H~,LLMPLT$L)H4LL.Hs(LT$HC0HuHHE@LcA$qI9CA$f4H  1HIUKLT$HHHMHLhHHHEXHEhLe`LT$HHIHUhdE1LmhHIU LT$HHHMLBhHH3LmhLT$HEXLe`HS8HHHFSLT$HILHLPLgIHHEXHEhLe`LT$HxHHE_HCMՋHHCHIF Nt0LH)HH9|}tPLHH)H9HC fDLAT$M<I1LHtH]1LHH]Hu HL9r1H8[]A\A]A^A_f.L9sHH]1LHH]rHtAT$At$ML$HuxEd$AuL9sL46M< $ HI9xfD9#uJ3H]HE$u%1LHHtJIM^2~LE1H)HH9} ICDIFH9uL9AHM\MH)I4AI)I)MMAD$f.I9Hf9CuI9DA HAfBHH9EH~zHUPH|L$HH|$ I9uXMtSL;d$  HC;@8A<$D$9D$u"HCIHHCL9d$  H9D$wLmhE1MLIUHCHUhIH}XIJH H5yHcH>[IIf.MLmhMuHC HS8HHHCHEkIH8L[]A\A]A^A_H9HIFKHIHIHH0_HH HEXHEhH]`HPHLmhIHC8HHCHEfMHs(HC8HKL[ HuHHs0HHu@HpHMDFM9| A-H;H#LHE`H)Hw+HLT$ LT$LcEH}XJHC8HPHEhHHEhHS8LhHELmhHBHU`L)HGZHHLT$詆LT$LcEH}XHEJHr8R@J/HEhHLfLMHCI S@Lcf.HC8JT/HPHEhLhLmhM~fH{8HGHLmhSMLmhA8MuHCHK HS(HsHHHCvHK HUHHS0HU@HUhIH9H@MuHCHsHLT$HEH IHLT$HMXHUhLIHHA(HAHA LaHEHHA0HE@fDHC8MH HC(HHH)I2fM LmhE1MuLcA$MIHC0@HC8JT/HPHEhLhLmhMHC(HHI)BHHCHCH;D$8HHCHpweHCHCHHCHCH;D$7HHCp@K@HCLmht E1H9EHEADHCH;D$z98HHHSHC HCH;D$8AHC8A9HCHCfRHШt HHHE@HEHH9.HEPHKH HCHCH;D$7HrH3fDHMHS8HBLbH:LM`HCLmhLEXHwE\$LHEL)Hs LL9H2IUHHGHUhS@MI MLMI@M`AP@fHMIHS8HH L]`LmhLJHqLHCH}XL)MEHHL$AIHEHs H9wH|$GH2:LLEhMa LHGS@LgHMW@DBHH9EHHuPHLHBL$s@LbHMr@HsHD$zH)HH9HuDB HrHLl$LIH/H}XLT$J IHqHA HAVJHAL9 IЋH]HHY(H]@HY0HUhLE`HEHrHMI)IGwL9K<IHEHuhHqILIҋ>HC L$q@Lcs@fHCRMIHH+uHH9Hu`LmhHH)H}XIHEIUHM)IGTJ/IHUhLMHC LcC@f.z LchBH=xpHcH>fDHU@HEHMIHS0HHC(HS8H~^HtYHU`L$HEhH}XHH)I9vI4H9 JIHEHuPLHLT$LehLT$LcA$ At$HC HU`LmhHEH}XIIuHM)IGeJ/H{HuhLHB LgLfHCH;D$G8 9HCH;D$'J9@HCH;D$8AHC8A9P@HCH;D$z0/w&fBHH9EHHuPH HtHH9@@HzH9HC$D998\HHHCH9yH9D$w;DH{HD$MIDBH)HI9H}EHHC HA$A<HEHHUhHA(HE@HA0AD$IՃt E1H9A LE`HAHrHH}XMHEI)IGdHuhA4$HLIM$q@HC Lcs@pHCRMILmhE1HH+uHH9EHu`HH}XH)IUHIHEM)IGJ/IHUhLMHC LcC@BHHCHUHEH9I9 AT$z H q _xI9A${1u_u`HKHHKH3IDEd$L9AHBLL)HIEHHGwL9 JIHEHEhLcJ/C@LHMHBB@HELbHuHHRH|$GHs(Hu@Hs0HLLEhLHGpfH9INdBH94I!NdL9ItJ LaH9JIHEM9Y ItJLcUM9ItJHS8LJL9ItKHs8LfH9D$It$ HLT$uLT$ HCH;EHUHHQ(HU@HQ0L;eAH;BH2HEHHU@HC(HS0H~SL$I9vK,L9 KIHEHuPK<(LLT$ LehLM`H}XLT$LehMLL)HwIEL9 JIHEHC8H@J/HuhLM`HS8LnHELLmhL)HBHGLEXH~PHLbV@K(H}hLMI HCLcS@7HMHEH9#1I9u 1I9 191L9eL;eA<$ xL;enA|$ ]HEHuH91I9v>AL$L$ u-Ht$_HcT$ Ht$HHPf_ ƒ1I9s4E$$Au'T$_Ic̋T$HHfA_ ȃ9HEHUH9 I9AL$HT$L$ ,_HT$IHcD$ I0Fu _nI9ZE$$AIT$^T$IIcIAA_ HEHUH9]I9" I9K1A<$T$ET$A<$T$]T$A<$T$蔔T$A<$T$苎T$z1A<$_1lfDHEHL)HxI9PHEHuH91I9v&AD$H M ƒ_ 1I9;A4$.H  @_  HM3I9VItJHs@MH9D$v A|$98?M$Lc HHSHrHLLl$ IHGLT$HMXLLaAD$L9LA ILAtfT$HAt H9EdHELmhHAD@HH9~HMPHHH9uHUHE1H{8LmhHC(HHMI)LmhHE1MIEKLT$IIHMHLJHHHHEXHEhLe`LT$L@HHE\LcYHIEKLT$HIHMHLfJHHHEXHEhLe`LT$HPHHELcoHIEKLT$HIHMHLJHHHEXHEhLe`LT$HPHHE~H~PLEXL9lIVK4HV8BHHBKLT$(HIHL$ HT$HLHLIHHLT$(HL$ HEXHEhHT$Le`HpHHEA@MԋA8DVM9|2HAHT$@H9v Y89HHIHALI M9}HUhE1IM9HALM`HEILBHMI)IGwM9CItJ 'HqHLEhL#L$Q@HCLcS@HIEKLT$HIHMHL~HHH HEXHEhLe`LT$HpHHE)HIEKLT$HIHMHL0HIHHEXHEhLe`LT$HPHHE1MIEKLT$IIHMHLGHHmHEXHEhLe`LT$L@HHEMIEKLT$IIHMHLGHHHEXHEhLe`LT$L@HHEYHHBKLT$(HIHL$ HT$HHHHfDH1LLHxI $tH9wHH)HH[]A\A]fDHH9wSHH9v: uHHH)[]HA\A]DH)HH[]HA\A]H9IfHH9vLLeuHI+$H[H]A\A]AUHH9wHH9+9t"fEmH9wfHH9v;A$A9tfDAUHH9wZfHH99uf.EmH9w-DHH9=;A$A9u)1AVAUATE1UHHHHH HdH%(H$1H$HHD$HHD$HD$PHD$P1LL$ LD$(.ZYH4$H|$Hk^Ll$Ld$șHH}Lt$ MLHL֖H^HD$0HuXLHD$ D$\bi|IJIHMQL% I$H$t H$uH|$@Ht H/uHGP0H|$xHt6HD$xH|$pHDŽ$HDŽ$d6H$dH+%(HL]A\A]A^H$t H$H|$@Ht H/uHGP0H|$xHt5HD$xH|$pHDŽ$HDŽ$5E1cLH蕧IDfIsIL萒hfDAVAUATE1UHHHHH _HdH%(H$1H$HHD$HHD$HD$PHD$P1LL$ LD$(q+ZYH4$H|$H[Ll$Ld$8HH}Lt$ MLHLFH^HD$0HuX1LHD$ D$\elIwGIHM"TL% I$H$t H$}H|$@Ht H/uHGP0H|$xHt4HD$xH|$pHDŽ$HDŽ$3H$dH+%(HL]A\A]A^fDH$t H$P}H|$@Ht H/uHGP0H|$xHtj3HD$xH|$pHDŽ$HDŽ$?3E1`LHID3dIIL6ffDHG(HATUSHHHG`HGXHLJHpHt2HCpHC(HCHCHk1HǃHHpXCTHCxtfIYEHu4H{MuUH HC(HH[]A\f1H[]A\DH H@˵IfDLHD$HD$HSH;S(t4HS(H[]A\H舣fDbIEH;S0t HcKTH뽐HC(eAWAVAUATUSH8H_LgL9>HIF D~t7LH)HH9tPLHH)H9HC LAUMtAA I6LH]tH]1LHH]*Hu HL9r1H8[]A\A]A^A_HH]1LHH]HuL9rAMAUMMLHEmL9sH M4AHI9wD9+uH H]HEEu81LHH $lHIHH $I9w5IMA!~LH)HH9 L9AHI4MMH)I)I)IIAE I9H9CuI9fDC3HAL49uHH9tHI9yJL\$ HEJLL$HL$LT$L$HEA1HHt$(OH,HI9L\$ LL$IHL$LT$L$Ht$(KL9DAWAVAUATE1USHHHHH H@dH%(H$01HD$@HD$PHD$HHD$@P1LL$PLD$X$A[]HD$@Ht$8HH|$HHD$UHHv{XH@ H5SH8XILt$P1HHIL-H!1]yIHHD$Ll$`HD$/HD$ HCXHD$H$HDŽ$HDŽ$HDŽ$Ht-HDŽ$HD$`Ht$LHDŽ$HDŽ$HD$P$;"MI?HMHD$`Hc$H;D$P3HL$hH9t1L9t,HHD$`HL$ H9L$|$/$fH|$XLHcH$H)HH$H H9]uHu H;uH)HObHHHL(`Hmu HEHP0H$t H$uuH|$pHt H/uHGP0H$Ht+HDŽ$H$HDŽ$HDŽ$[+H$(dH+%(^H8L[]A\A]A^A_DSdEoDKhE?H7 H5HPH8m뛋$LI,$H$t H$}tH|$pHt H/uHGP0H$Ht*HDŽ$H$HDŽ$HDŽ$c*E1H|$XHcD$H)HHHLH)HHEH H9MuHu H;uH)HR`IMLLLD$&^LD$AI(u IPLR0EE1DH$LHHHHtHH|$XLc$$H)HIIHH)HIH - H9MuMu H;E@L)LH_IMFfDLLU]ImuIUD$LR0D$IL9{~jL L9tK?H9$IMID$LP0H$ IzIHD$PHD$ IDHLHEI#fHHHEH>f.HHHEIf.HEI HEIHE1[AWAVAUATIUSHHH|$HHT$LD$(dH%(H$x1tD$ I$D$ HT$Ht$1L$ILIHd1-sIHHD$E1HD$@HXHD$fu I9uH|$@Zt$ I$ML;- t,LL)[ImuIUD$$LR0D$$HD$@H$IH9$H9$KH$Ht H9\$@H$HDŽ$HDŽ$HDŽ$`HtM&HDŽ$H$Ht$LHDŽ$HDŽ$H$$)H8HH)H$H$Lc$H$H)HIHHH)HIHI9wD$EHD$HR H9PuMu H;pL)L[IMt2LLYImuIUD$$LR0D$$fDI.u IFLP0H$t H$nH$Ht H/H$Ht$HDŽ$H$HDŽ$HDŽ$$HDŽ$I,$u ID$LP0E1H$xdH+%(*HĈL[]A\A]A^A_ÐHc$HH|$LHD$HH1LHt$HPH|$HIH/uHGP0MfDSHCvHH|$HLHAIY$H$L9~u$H$HD$HR H9XuMu H;pL)LYHH.HLWHmu HEHP0H$t H$lH$Ht H/uHGP0H$Ht"HDŽ$H$HDŽ$HDŽ$"HDŽ$I,$$H$HD$HQ H9Xu Hx1XIMI~$yLL$LIH/uHGP0I.u IFLP0MH|$({HT$@LH=wH1qI]f.Hl$PLHL$8HD$PHT$LLI|MLHH|H@u M1HyH6?HuH> HfHGAWAVIAUIATIUSHHoL H_(L9tATfHH53UE1HdH%(HD$x1Hl$ HL$HD$LD$H)D$ D$)D$0)D$@)D$P)D$` tVD$LD$Ht$0HL$ HT$H|$ D$ Ht$MEwFHT$IHtHH=~01 YIH|$(tHSHD$xdH+%(uHĈL]A\=ATfHH52UE1HdH%(HD$x1Hl$ HL$HD$LD$H)D$ D$)D$0)D$@)D$P)D$` tVD$LD$Ht$0HL$ HT$H|$ D$ Ht$MEwEHT$IHtHH=~/1 XIH|$(tHRHD$xdH+%(uHĈL]A\<ATfHH51UE1HdH%(HD$x1Hl$ HL$HD$LL$LD$HD$D$)D$ )D$0)D$@)D$P)D$` tZD$LD$Ht$0HL$ HT$H|$ D$ D$Ht$MEjDIHtL$ HT$H1H=1VIH|$(tHQHD$xdH+%(uHĈL]A\:fATfHH50UE1HdH%(HD$x1Hl$ HL$HD$LD$H)D$ D$)D$0)D$@)D$P)D$` tVD$LD$Ht$0HL$ HT$H|$ D$ Ht$ME9HT$IHtHH=n-1UIH|$(tHPHD$xdH+%(uHĈL]A\9ATfHH5/UE1HdH%(HD$x1Hl$ HL$HD$LD$H)D$ D$)D$0)D$@)D$P)D$`tVD$LD$Ht$0HL$ HT$H|$ D$ Ht$ME8HT$IHtHH=n,1TIH|$(tHOHD$xdH+%(uHĈL]A\8ATfHH5.UE1HdH%(HD$x1Hl$ HL$HD$LD$H)D$ D$)D$0)D$@)D$P)D$`tVD$LD$Ht$0HL$ HT$H|$ D$ Ht$ME7HT$IHtHH=n+1SIH|$(tHNHD$xdH+%(uHĈL]A\7ATfHH5-UE1HdH%(HD$x1Hl$ HL$HD$LL$LD$HD$D$)D$ )D$0)D$@)D$P)D$`tZD$LD$Ht$0HL$ HT$H|$ D$ D$Ht$MEz6IHtL$ HT$H1H=,RIH|$(tHuMHD$xdH+%(uHĈL]A\6fATfHH5-UHxdH%(HD$h1Hl$HL$HD$H)D$)D$ )D$0)D$@)D$Pt_HT$Ht$ H|$K/HT$ HHt>H=)1 RIH|$tHLHD$hdH+%(uHxL]A\fE16fDATfHH54UHxdH%(HD$h1Hl$HL$HD$H)D$)D$ )D$0)D$@)D$Pt_HT$Ht$ H|$GHT$ HHt>H=(1PQIH|$tHKHD$hdH+%(uHxL]A\fE1F5fDATfHH5+UHxdH%(HD$h1Hl$HL$HD$H)D$)D$ )D$0)D$@)D$Pt_HT$Ht$ H|$;OHT$ HHt>H='1PIH|$tH KHD$hdH+%(uHxL]A\fE1v4fDATfHH5*UHxdH%(HD$h1Hl$HL$HD$H)D$)D$ )D$0)D$@)D$PCt_HT$Ht$ H|$HT$ HHt>H=%'1OIH|$tH=JHD$hdH+%(uHxL]A\fE13fDATfHH5*UHxdH%(HD$h1Hl$HL$IHH$HD$)D$)D$ )D$0)D$@)D$PhttH$1Ht$ H; HL$HDH|$/HT$ HHtBH=9&1NIH|$tHQIHD$hdH+%(uHxL]A\fDE12fDATfHH5*)UHxdH%(HD$h1Hl$HL$HD$H)D$)D$ )D$0)D$@)D$Pt_Ht$ H|$@5HT$ HHtCH=j%1MIH|$tHHHD$hdH+%(uHxL]A\E11fDAUHH5u(ATUHĀdH%(HD$x1HL$HT$HD$Hڮ Hl$H5H8 )uuHE} x HfHxRHHt$ HHt=Ht$ HH=HLe4HHtLH=J$1L1HT$xdH+%(uxH]A\A]@Ld$ 1HLA1EuLl$0H|$ L3HtHLH=#1iLLHD$FHD$D{xq0ATHH5!'H dH%(HD$1HL$HT$HD$dtPH|$HL$11Lg!HHt1LH=E#1KHT$dH+%(uH A\f1/ATHH5&H dH%(HD$1HL$HT$HD$tHH|$Ht$LgHHt-LH="14KHT$dH+%(uH A\D1?/ff.@ATHH5&H dH%(HD$1HL$HT$HD$LD$D$tKH|$Ht$T$Lg8HHt,LH=!1JHT$dH+%(uH A\@1.ff.@ATHH5f%H dH%(HD$1HL$HT$HD$ttPH|$Ht$Lg(8HHt0LH=T!1IHT$dH+%(uH A\1-ATHH5$H dH%(HD$1HL$HT$HD$tPH|$Ht$Lg7HHt0LH= 1?IHT$dH+%(uH A\1G-ATHH5P$H dH%(HD$1HL$HT$HD$LD$D$'tKH|$Ht$T$Lg\BHHt,LH= 1HHT$dH+%(uH A\@1,ff.@ATHH5#H dH%(HD$1HL$HT$HD$tPH|$Ht$LgAHHt0LH=d1GHT$dH+%(uH A\1+ATHH5(#H dH%(HD$1HL$HT$HD$tPH|$Ht$LgAHHt0LH=1OGHT$dH+%(uH A\1W+ATHH5"H dH%(HD$1HL$HT$HD$Dt@H|$LgHHt*LH=.1FHT$dH+%(u H A\f1*ATHH5'"H dH%(HD$1HL$HT$HD$t@H|$Lg"1HHt*LH=1)FHT$dH+%(u H A\f17*ATHH5!H dH%(HD$1HL$HT$HD$$tHH|$Ht$LgFHHt-LH= 1EHT$dH+%(uH A\D1)ff.@ATHH5(!H dH%(HD$1HL$HT$HD$tHH|$Ht$Lg2HHt-LH=i1DHT$dH+%(uH A\D1(ff.@ATHH5 H dH%(HD$1HL$HT$IHD$H$tUH4$1H|$H;5 HT$HDLgAHHt)LH=18DHT$dH+%(u H A\Ð1G(HHH5dH%(HD$1H+A1Et H<$HT$dH+%(uH'fH(HH5dH%(HD$1HL$HT$t;Ht$H|$'u(H HHT$dH+%(uH(1g'HHH5=dH%(HD$1H*A1Et H<$ HT$dH+%(uH 'fHH2uHU HH@1HÐH= [2ff.HGHG(HH?HHHHHBHHx 5ff.H@Hx 5fDH Hff.H0s5HFUHH~+H<HHu HuH]65fD1H]%5D1]ff.H(Hɠ HH5dH%(HD$1HL$LD$tDHt$H|$HCNx2H HHT$dH+%(u1H(f.1@H H8t0)%fUHHHtHG H8t3v0HmtHX HH]fDHEHP0@HEHP1HUHuHUHD$HR0HD$ff.@UHSHHGHf.H(tHHuHH[]2fHPHR0@USHHHoH5 H9t$H{H;-< H;-" „tt'HSH:H;]  H[]fDH H5H8"3ff.HGH9HuLG(HGJDHHPH9twHO(IIL1LA?HI9~)HGHtHHuJDHfHLHG HH)tfDHHuJDHDLG0HG JDHfDHHş H5H8.21HHG Hw(H9p8uVHG0Ht}HWHOHLDHHG0HWH@uH ILDHHGHGHH HG0H5V!H811HE1LÐHG0Ht[HW Hw(H9r8uUHWHOHLDHHG0HWHyHILfDHHG?HGE1LÐHH HG0H5 H801HHFHH~\USHHH;HH9Ht.HH~&HHH4f.HHHHR0H9uH[]D19fH(HdH%(HD$1LD$LL$HD$H5  A1EtHt$H|$HT$dH+%(uH( fH(HdH%(HD$1LD$LL$H5A1EtHD$H9D$t'H( HHT$dH+%(uH(H f.H(HdH%(HD$1LD$LL$H5A1EtHD$H9D$t'H( HHT$dH+%(uH(Hq jf.AUH=.ATH*IHtiL-̚ H5NHIELIELLH5TH' H5WLH|H H55LHbHLA\A]fDH(HdH%(HD$1LD$LL$H5A1EtHt$H|$HT$dH+%(uH(RfAWAVAUATUSHH~H^IHIHE1E1H9Cu H92H"7zL1A$0IHHXHHH"HHMt)I~t"HxMt$IHHDIl$HEHEHu HEHP0Mt L Hu2MI}uZIEMl$ HL[]A\A]A^A_L@ID$ Mt3HI,$u ID$LP0E1fDLID$ Hu@H{(LsL{ H[@HLHID$HE}Hf9ID$ @HA H5E1H8+%fH! H5E1H8+fLHID$ ;HHEHEHP0UHsH}0tHH}HtH/tuH}HtH/tVH} HtH/t7H}(HtH/tHEH]H@HGP0HGP0HGP0HGP0UHSHH]H9HEH@HmHmH}@Ht H/H}HHt H/H}XHtH/thHHtH/tFH}`Hu HH[H/uHGP0HuHEHH@H[]fHGP0HGP0HGP0m@HGP0J10ff.fUHH}HtH/t H]HGP0H]f.UHcH}HtH/tTH}HtH/t5H} HtH/tH]DHGP0H]xHGP0HGP0UHH} HtH/t H]+HGP0H]UHH}0HtHE0H/tH H]H@0HGP0ff.@SHHHHtHCh[AWAVAUATUHSHHHLnHGHugLvE1H{ 'HusHtHEH{MHLLIHt HmHL[]A\A]A^A_MLwH{ E1IHtH{ &IHHHHL.^MtI/u IGLP0I,$u ID$LP0E1]HEHP0GHLI/IIGLP0f{E1IHf.HMxI/nIGLP0ff.AWAVAUIATUSH8dH%(HD$(1tbx0HD$(dH+%(H8H=[]A\A]A^A_fE1HD$(dH+%(H8L[]A\A]A^A_H=DIHtjHD$IUHZH~d1L5HD$HHD$H9~MIUIHTL1LI,$Hu ID$LP0HuE1L,EHHD$Lt$ Ld$H\$L=3eHL$ HT$1HLHEHmuHUHD$HR0HD$H|$ H/uHWHD$R0HD$HcHI} LLHuIEIUHH= Hp1HmI"HEHP0ff.fATUHHt)xgHEH=nHpH1]A\jf.H}HJH=0HUHEHEHp16HI++HL]A\E1HL]A\fAUATUSHHHP PXHH{0HHts}H=bIH{0*Mt`1HH= LI,$Iu ID$LP0Hmu HEHP0HL[]A\A]H{07/IfHmu HEHP0HE1[L]A\A]fDH=6LI_@HHG(Ht/HHWHwPLO 1LGHH= 9H@H HW Hw1HJH+O0H=Jff.USHHdH%(HD$8HF_H1HL$(HHT$0LL$LD$ H5J/H|$0+LD$(I@H|$ H-Ñ H9tHW H; L(H|$ HD$(H5H9H H9GHD$ HHD$0HT$HH9HH{HCH/uHGP0H{HD$(HCH/uHGP0H{ HD$ HC H/uHGP0H{(HD$HC(Ht H/uHGP0HEHH H5 H8 1HT$8dH+%(uyHH[]fIHHD$%f-fD1@H|$(HD$H/uHWR0HD$wfSH dHHHHV HdH%(HD$1IXA1Et)H=grHtHSHHPH$HHPHT$dH+%(uH[*f.HHH HdH%(HD$1IHA1Et%H=HtH$HHPH@HT$dH+%(uHH(HdH%(HD$1LD$LL$H5=A1EtHt$H|$1HT$dH+%(uH(0H(HdH%(HD$1LD$LL$H5EA1EtHt$H|$wHT$dH+%(uH(ff.fH(HdH%(HD$1LD$LL$H5YA1EtHt$H|$HT$dH+%(uH(=ff.fH(HdH%(HD$1LD$LL$H5EA1EtHt$H|$wHT$dH+%(uH( ff.fH(HdH%(HD$1LD$LL$H5eA1EtHt$H|$HT$dH+%(uH(= ff.fH(HdH%(HD$1LD$LL$H5EA1EtHt$H|$wHT$dH+%(uH( ff.fATAUHSHH dH%(HD$1H=HvH9EHCH{HUHHHT$H1ɺH$HHtfH5DHHmIt"HD$dH+%(~H L[]A\fHEHP0@H H5b H81E11HBH,HI H5%E1H81n{ ff.AWAVAUATUHSHHHT$dH%(HD$81HHHSHD$HHHD$HHЋT$HEIHVHD$ LCM1@HTHITHL9uLD$ H|$tsH=Lt$(Ll$0Ld$ HKDIHD$ &fDHD$0HKDHD$(IHKDLLLHLD$LD$uD$HD$ HSH~.LLHH fDJDIH@HKDI9uH|$tOHD$ K\Lt$(Ll$0Ld$ fDHD$(HH@HHCLLLHuHD$8dH+%(uFHHL[]A\A]A^A_@H|BTfDHD$HWH9E1K ff.AUHATH5UH(dH%(HD$ 1HD$HD$P1LL$ LD$?ZYH$HtHH|$>IHJHH@HEH~HHEHHtdLIHH$H1HLHH|$1HH$HuHmu HEHP0H<$Ht H/uHGP0Imt;E1HD$dH+%(H L]A\A]H$'IELP0@sHyHmu HEHP0H<$tcImu IELP0L,$xH-9 H}u#H<$HTH/JHGP0AH}H5H H5H8yfAWAVIAUIATUSHHWxuMu HHLLeHHH1IHH{XHHU IHt-HHCpHmu HEHP0HL[]A\A]A^A_Ð+HuvH{HLLg IHt_H{XLHH-xHmtRHChI,$uID$LP0fDHmu HEHP0E1tHmuW@HEHP0@AWAVIAUIATUSHHWxuMu HHLL%HHHIHdH{XHH IHt]HPH@HBHPHCLcL`ID$I\$Md$0HCpI$Hmu HEHP0HL[]A\A]A^A_DHH{HLLIHLkI9IUIEL5 H{XHBIu(HPIU LHL9HHH(uH@P0ME(Mu0M} LIm(H{XLHMe0LD$4LD$HCLkLhIEI]I$I(u I@LP0I.IFLP0DHmDE1H=)IHLx HPHh(L`0H@HHHH{XHHIEH HIMHIIMHHLHPLGxcHCH{XLkLhIEI]I$H9C8HChHm%HEHE1P0ImIELE1P0H(uH@P0Imu IELP0HmuHEHP0Hmu HEHP0I,$ID$LP0ImuIELP0LD$I(u I@LP0I.fIFLE1P0HCLkLhIEI]HmuyH=e#AUH sATUSHHHHHHdH%(HD$81HD$ PHD$$P1LL$8LD$@ZY*H|$0ZH|$(H;= HGH@`HHHҀ H0HHHL-kHTLD;IH1H0HHT$(L`XH@H@Hh8HHP@HT$0HHPHT$LhPPxHT$ H@pH@hHHP`HT$8dH+%(HH[]A\A]f.HQ{ H5H81fDL-YH-DL-|H1Hz H5H81bI,$HD$uIT$LR0HD$>fHtH;5P t) fHHSHHXOHKhHSpH5H{`LC@I1[ff.fSH_LGXH9tiHGH@HHHGhHGpLJLxHtHH[H/uHGP0HuH{~ H[HGhHGpLJL#ϐH5yAUH=~ATHS HL-cIL(LLH5H;L-LxSLLH5HnپL-³Lx&LLH5bH謾HLA\A]E1HLA\A]ÐAUH=NATSH dH%(HD$HHD$HD$_ HtvH=y 1I)H*HtHHL%30I|$.HmI$LLHpL#Mt LyImu IELP0E1HD$dH+%(u H L[A\A]ff.@ATHH5USHdH%(H$1HHT$MH|$HGt}L$IPtl Ax H|$G @H4$V @ HNLGH0 H0L DHHH:Hl$`1H$dLd$H<$1Lx|$4HL$ HT$pHt$H|$`脸H*L"Hc(Hw H5bH8 H1H$dH+%(H[]A\DH$HJHHt H:HPHIH5Hu H81ZtL$[DH9w H5H8B HJLBKDL 0fHHSHvH7HQu H5H8 DH^ff.HH0tHcHo1HÐH(HdH%(HD$1LD$LL$H55A1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5ŽA1EtHt$H|$HT$dH+%(uH(BfH(HdH%(HD$1LD$LL$H5<UA1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5A1EtHt$H|$\HT$dH+%(uH(bfH(HdH%(HD$1LD$LL$H5muA1EtHt$H|$LHT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5 A1EtHt$H|$lHT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5蕻A1EtHt$H|$HT$dH+%(uH(fH$@H@H@H@H@H(HdH%(HD$1LD$LL$H5պA1EtHt$H|$HT$dH+%(uH(RfH(HdH%(HD$1LD$LL$H5eA1EtHt$H|$HT$dH+%(uH(fHH`tHcH1HÐH(HdH%(HD$1LD$LL$H5ŹA1EtHt$H|$\HT$dH+%(uH(BfH(HdH%(HD$1LD$LL$H5UA1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5A1EtHt$H|$LHT$dH+%(uH(bfH(HdH%(HD$1LD$LL$H5uA1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5MA1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5蕷A1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5}%A1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5赶A1EtHt$H|$HT$dH+%(uH(2fH(HdH%(HD$1LD$LL$H5EA1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5QյA1EtHt$H|$HT$dH+%(uH(RfH(HdH%(HD$1LD$LL$H5eA1EtHt$H|$\HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5A1EtHt$H|$|HT$dH+%(uH(rfH(HdH%(HD$1LD$LL$H5腴A1EtHt$H|$lHT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5A1EtHt$H|$茼HT$dH+%(uH(fH(HdH%(HD$1LD$LL$H5O襳A1EtHt$H|$輼HT$dH+%(uH("fH(HdH%(HD$1LD$LL$H55A1EtHt$H|$輿HT$dH+%(uH(fH(HdH%(HD$1LL$LD$H5Ųt1H|$Ht$Hct蕽HT$dH+%(u H(17H(HdH%(HD$1LL$LD$H5 Et9H|$Ht$HHt!HT$dH+%(uH(1ff.@H(HdH%(HD$1LL$LD$H5赱t9H|$Ht$rHHt!HT$dH+%(uH(1ff.@H(HdH%(HD$1LD$LL$H5%A1EtHt$H|$HT$dH+%(uH(fH(HdH%(HD$1LL$LD$H5走t9Ht$H|$t%Hk HHT$dH+%(uH(D1ff.@H0HdH%(HD$ 1HD$H5P1LL$LD$ ZYt?H$Ht$H|$Tt'Hk HHT$dH+%(uH(1ff.@H(HdH%(HD$1LD$LL$H5腯A1EtHj Ht$H|$HT$dH+%(uH(ff.H(HdH%(HD$1LD$LL$H5A1EtHj Ht$H|$uHT$dH+%(uH({ff.H4@UHH5H dH%(HD$1HL$HT$HD$EtCHt$H|$rHHt!HAHT$dH+%(uH ]Ht1DATSHH=HIHt5HCLID$HC(ID$HC8HID$(HCI\$ ID$0HL[A\ff.ATHH0H5SH(dH%(HD$1HL$LD$HD$< H=MH\$IHHCLID$HC(ID$HC8HID$(HCI\$ ID$0H|$1ifID$0HIT$IL$HH|HID$0IT$H~H@uHID$ID$H?uHGP0HH9\$~DID$ It$(H9p8tHf H5CID$0H8zI|$0t I,$t!E1HD$dH+%(uH(L[A\ID$LE1P0DATSHH=_HIHt5HC LID$HC0ID$HC8HID$(HCI\$ ID$0HL[A\ff.ATHH0H5SH(dH%(HD$1HL$LD$HD$<$H=H\$IHHC LID$HC0ID$HC8HID$(HCI\$ ID$0H|$~|1nfDIT$ It$(H9r8|IT$IL$HH|HID$0IT$HyH~HID$?ID$H?uHGP0HH9\$~ ID$0HuHD$dH+%(uSH(L[A\Hyd H5*ID$0H8aI|$0tI,$tfE1ID$LE1P0fDATH=!IHSHdH%(HD$1I\$H~PL$$H=EPIHtH$LHID$I\$HD$dH+%(u;HL[A\1IH5LrufDE1ff.AVAUATIUHSHLodH%(HD$1HL5)HLts1ILLtUILIHt;M~91fDIDHI9t!HEH<$Ht谼HuI,$t4E1HD$dH+%(uCHL[]A\A]A^ÐL5|]@ID$LE1P0HuH<$SIfHHWHwt 1aH=$1fATUSHdH%(HD$1H~HFHH$H@H=H.IHHEHH$HH$ID$HtHI\$ HUHvID$Ht,LTHD$dH+%(uoHL[]A\I,$u ID$LP0E1fH] H5"E1H8DHa] H5E1H8AWH=AVAUATUSHXHt$HdH%(HD$H1HD$H@HD$ HH|$ 0HD$0HH|$ HD$8E1HD$(fHD$J|HGH|$8G O LoAA HW0LGH@IDIM~711AAA<.€HI9uՅHH|$(/HD$0HT$8JTIL9d$ AH=JH)HT$0Ht$ HH$HPHpNH$DA<.ofAfHT$Ht$1H=H$H9\$IDHH} LLLyuH9\$~H=(IHLH藥ImItEMHEHULH=Hp1臯I.IIFLP0IELP0HU H5H8VH(HJHPHR0;HE17[ff.ATH5SHHIHt^HIHt~HS@HsHx!HLH=1[A\ fHH1L[H=A\DHyU H8qt/8L%!U I$yI,$u ID$LP0H1[A\@AUATUHSH(H dH%(HD$1HtHHEHXH{GHHHEHHBH~!HE1@HtHHHtH9uHD$dH+%(HuH(H=1[]A\A]fH=}DIHH5рHyI,$Iu ID$LP0MtoHEHM HLH$HEHD$ImItDHULH=ײ1KHHD$dH+%(u(H(H[]A\A]f.1IELP0ff.AT10HIHOHtjHHH8HHtcID$ID$ LID$ID$( ID$0ID$8ID$@ID$HA\fFHuLI,$t E1LA\@ID$LP0ff.ATUSHWHHHHHC(LdHHC8HC(HSH@tL[]A\HuHC( LHC0[]A\H)HHLHHI1HML9IOH9HO1H)H)I)MLMDIIHH9uHy LM??MH5]DH??LH)L@MLH)HH9HOH9HOM1HHIIIHH9uH@u LM1Mx1Ht'HRH>H HHU(HtQHEHHuHU(HNHML|H9woHE8LAIHuHL[]A\A]A^A_鞠fDH1xHt\HH!xIHt\HUHH?HE{@1H.H(HAH@P05D6Hu3IHtHHPI,$uIT$HD$LR0HD$H[]A\A]A^A_DHH[]A\A]A^A_f.AVAUATIUSHLoMIHH~IH1HL9wI1IHu&DH(u HPHR0HL9LLHuImHD$1 $I$LH[]A\A]A^HGHW(H\HG8HW@HHdH9HG8LOIM~wE1H-uuDIT$0H??H)LL)H9HOIHt2I|$ H LHHHXHH9uI0IL$0HH\M9|Ml$Ml$LI$H[]A\A]A^I$IEHPLIUHLd$IULR0HD$H[]A\A]A^H)uHtDHHuHDHtCIT$ HHHID$ @ID$0FHuLMl$1~H[]A\A]A^/HG8IfAUATUHωt+x]H=}A\A]ؑE1L]A\A]@H(IHtXHU@HHx4H=1fIH[I,$uID$LP0L]A\A]H={12IDHE1{AUIATUH--uSHHH9tIM@HxNE1LH51bIMtFI\$H9tHHeHL[]A\A]1L1,IMuHE1[L]A\A]11IHtIE@I}ID$@t'LLHHtXH/uHGP0DIEIU(LHt#HfDIEHKH5HPH; H81tI,$UID$LP0EfATIUHHt@HLHjHmItHL]A\DHEHP0HL]A\E1HL]A\f.Hw0H1HHt 1ӑH5> 1‘fATIUHH5L9tKH9H4 HH[]A\A]A^A_H2 HH[]A\A]A^A_fDH95 HH[]A\A]A^A_fDI,$u ID$LP0H1[]A\A]A^A_DI,$u ID$LP0I.u IFLP0tuH14 HADLH2HmtI/uIGLP0HEHP01Ht1I9g1I9Z\$P1MC;D$h@HmtD$NHEHP0D$5UHHH0dH%(HD$(1HHD$HD$H4H$HD$HD$ HH1HL$ILD$H șH<$H;=E5 t#HtHHyDHH}HE@~HHt$HtHHHt\H(t1HT$(dH+%(uvH0]fDH@P011ILD$H5F{yCf˔HuH. H5 H8PfAUIATUHH0H;=64 tTHtO11IHt.HLH@yI,$uID$LP0f.E1L]A\A]@L1HHtHH/ H8HmuHEE1HP0L]A\A]f.AVL53 AUATUSHw0HL9t1Ht,1萟HHu'E1[L]A\A]A^f1ٿHHt1H58_H1IHH IHHsIML1HImItHI,$t!HmqHEHP0[L]A\A]A^ID$LP0HmEIELP0I,$uDI,$u ID$LP0HmHEHE1P0fAWAVIAUIATUSHLg0Ht_HFHtOL~MH^HHL޼HHHt"H1YHH1H<- LLHI]0(HmAt'MtI,$t+HD[]A\A]A^A_fHEHP0@ID$LP0H;91 uNHL'HHNAHLHHGAnH:, H5H8붐ATIUHSHHHt HӅuMH}Ht LӅu;H} Ht LӅu)H}(Ht LӅuH}01Ht LH[]A\[]A\ff.ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.AUIATIUHSHHHt HՅuWAD$1ۅ~$@HcI|(Ht LՅu2A9\$I|$ 1HtHLH[]A\A]f.H[]A\A]DUHSHHHtHEH/E1ۅ~6HcHH|HtHDH/uHGP09]H} HE H-Hu-@Hu*H_ HHG U0HtHHWHH9tHHtH1[]fDR0H1[]@HGP0<@HHHHt1DATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.HHHHt1DAVAUATUSLoHo MtpIEIHHG0H9G1f.H(uH@P0ID$0HID$0I;D$}FLHHuMl$MtID$Imt[1]A\A]A^@IELP0@HAH9|EuLHtIT$IL$(ID$0HH9|H9~EuIL$[]A\A]A^@Il$[]A\A]A^HAH9Et\ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.UH1H0HtHhH@H]fHmuHUHD$HR0HD$ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{ 1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{ 1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{ 1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{(1Ht[LH]A\fD[]A\ff.ATIUHSHH Ht HՅu-H{Ht LՅuH{1Ht[LH]A\@[]A\ff.LGHHwMtI(tH~) HfHI@LP0H[) HHfATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{1Ht[LH]A\fD[]A\ff.ATIUHSHHHt HՅuH{ 1Ht[LH]A\fD[]A\ff.HHHHt1DHGHt~HHGHGH1ff.fATIUHSHH Ht HՅu-H{(Ht LՅuH{01Ht[LH]A\@[]A\ff.LG0HHw0MtI(tH' HfHI@LP0Hk' HHfwfnfvɋ~f8=f~qATUSHHHGHLCHMtrH{ HtYH1L1yIHmt MtcH{I$LcH/tL[]A\HEHP0@HGP0L[]A\ÐHLIIHHCL[]A\DE1[]LA\ff.fUHH HtHH]/1]@AWHAVH5AUATUSH8dH%(HD$(1LL$ LD$jH|$ 詗IHmCIHHD$L-LHxϒL%! LHL躒H5sHD$HD$Hx蠒LH5VH莒H|$H`H;\$UHLH9CHG 2DHHHH|$HHIHLH,IHH|$HHH eI,$u ID$LP0HmOLmHHtPH" H9E_H]HfL@1HT$(dH+%('H8[]A\A]A^A_I.uIFLP0MtI/u IGLP0&HuH# H@L(HHt1YIHI.uIFLP0DH+u HCHP0MtImxIELP0ifHH1L1vHHLHD$襙H|$IH/uHGP0Mt{H|$LH+xgI,$u ID$LP0HmLrkHHv$ IHH|$HLH!1fI.u IFLP0Hmu HEHP0MtI,$u ID$LP0Hf.E1HEHP0Of1E1HEHP01E1E1m1E1c~ff.H(HdH%(HD$1LD$LL$H5fA1EtHt$H|$=HT$dH+%(uH(fAUH=ATH胭HL-UILXkLLH5HU6bL-H LHkLH5dLHaHP LH5|L-SHaLjxZLLH5;HeSaL-QLjx-LLH5HQaHLA\A]E1HLA\A]ÐAUH=ATSHdH%(H$HܭHDŽ$HD$H$HD$HHD$H HD$ H`HD$(HHD$0HHD$8H\HD$@H0HD$HHHD$PHxHD$XH̦HD$`H HD$hHtHD$pHȡHD$xHH$HH$HH$H/H$H  H!4HtSIH\$L%`6fDI|$.HUI$LLHp_LcMtLhyE1H$dH+%(uHİL[A\A]AWAVAUATUSHHHtQH#HHPHYQHHHS(L{HC L-PLcHC@H)HC8L9HCIOHC( HC0I\H,I)H;LsH/uHGP0LH9uHPMtP@M$I9INI^H,I)HMdHMHPfDLMjHrHOL$HH\PH[]A\A]A^A_D讶Hn+H{t1HWH(uHPHR0DHL[]A\A]A^A_jf.ATH CIHHHH dH%(HD$H LL$LD$HD$1L1A$0IHtoH@ H|$H@(H@0HD$ID$H7ID$HtHD$dH+%(u*H LA\I,$uID$LP0fDE1~ff.ATH USHHHH2H0H- dH%(HD$(1LL$LD$ Hl$tnH|$ 脍IHt\1H0HttZH|$ 谌HHtHH|$螌IHt1H0HtFHhL`@HmuHEHP01HT$(dH+%(uGH0[]A\DHmuHUHD$HR0HD$I,$HD$uIT$LR0HD$蒚fUHlH}Ht H/H}HtH/tqH} HtH/tRH}(HtH/t3H}0HtH/tHEH]H@HGP0HGP0HGP0HGP0HGP0d@UHCkH}H/uHGP0H}H/uHGP0H]xjUHkH{H]RjfUHjH}HtH/t4H}HtH/tHEH]H@@HGP0HGP0UHjH}HtH/t4H}HtH/tHEH]H@@HGP0HGP0f.UHjH}HtH/tHEH]H@HGP0UHiH}HtH/t4H}HtH/tHEH]H@@HGP0HGP0UHsiH}HtH/tDH} HtH/t%H}HtwdHEH]H@fDHGP0HGP0UHiH}HtH/tDH} HtH/t%H}HtdHEH]H@fDHGP0HGP0f.UHhH}HtH/tDH}(HtH/t%H}cH} cHEH]H@fHGP0HGP0UHhH} HtH/tTH}HtH/t5H}HtH/tHEH]H@DHGP0HGP0HGP0UHgH}HtH/tHEH]H@HGP0UHSgH} HtH/tTH}(HtH/t5H}0HtH/tHEH]H@DHGP0HGP0HGP0AVAUATUHSH_H{0tfHs(H}TH{(Lc0HC0HtHC(H/t[L]A\A]A^DHGP0[L]A\A]A^DH{\IHtH{H;=4 tbH11gIHtmH{(Ls0Lc(Lk0Ht H/uHGP0M=I.3IFLP0$f.HIE1[]LA\A]A^ImuIELP0"ff.ATUSHHHs(Ht(H{ H/7H{[HHH{H;=/ 1H1eHH{(Lc0HC(Hk0Ht H/uHGP0MiI,$^ID$LP0Hs(HwH{ HOHHs H=Ht$~Ht$HHtkH]HHHuH[Hs(1H~Hmu;HD$HUHR0HD$H[]A\@H#HmHD$t1H[]A\DHs(H{ HHs HNH/DHGP0Hs 4DAUATUHSHHc_Lg8~5I\$ H|HH]I,$ueID$LP0LeE1A9\$~&HcID(H]H[]A\A]fI|$YHtjAD$ID(]ÐIH=AMl$|HHt/@HH@ IELh߫I\$ Le=ID$ H1[]A\A]f.ATSHH=/H|IHt&HCLHID$CID$ AD$hHL[A\ff.fHG HOHWHwHt/LG(Mt&LO0MtHH=ƙP1蒬HDH=v1zf.HOHW1HwH=LRfOHW1HwH=o3HOHW1HwLG H=Tff.HOHW1HwLG H=$ޫff.HOHW1HwH=鲫fHWHwHt/HOHtH=ט1鈫H=ɘ1rfH=I1bfHOHW1HwH=<BfHOHW1HwH="fHWHwHH9tH=U1HO HW1H=ڪf.HOHWHwHxH=1魪DH=<1險f.ATHHЭE1UH5SH dH%(HD$1HL$LD$]t7H=6H\$Hl$7yIHtHhHHEHXH薨HD$dH+%(u H L[]A\%DSH dH%(HD$HFH1HIHL$HT$H5]HD$H{(HHC(Ht H/uHGP0HD$H{0HHC0Ht H/uHGP0H$H{ HHC Ht H/uHGP0H HHT$dH+%(u0H [fDH H5^H8芜1fD1ATHH5AUSH H  dH%(HD$1HT$ILD$\HBHl$HwIH@HH@ HEHh٦HT$HBH9@H~#Hr1H IL(HHH9uAD$H$H9tKH; t I,$t[H  H5kH8}E1HD$dH+%(u?H L[]A\fDH;a tH9ZuHIT$ fDID$LP0ƋfDSH dH%(HD$HFH1HL$HLD$ HH5ДZtwT$ 9wvHD$H{HHCHtH/u HGP0T$ H SHHT$dH+%(uKH [H H56H8b1fD1@H H5>H8:1ъSH dH%(HD$1HFHD$HH+ H1HL$LD$ H5ՓYHD$H{HHCHt H/uHGP0T$ 1HC C(H HHT$dH+%(u0H [fDH H5.H8Z1fD1SH dH%(HD$1HFHD$ H1HL$HHT$H5TX'HT$HBHHH  H9HD$HHpHHH9H{HHSHtH/tcHH{HCHtH/t%Hn HHT$dH+%(H [HGP0H{HHSHtH/uHGP0HD$HufDHa H5H81fDHA H5H8ʗ1i1_T@SHHcϠHtcHc{H~%L@1fHt(HI4HH9uLC Mt!HSHsH=~1[麣f.LI 1[ATUS7yHHxL%HL9t LztgLgrIHt&HELHID$EID$ AD$蹡HmtL[]A\f.HEHP0L[]A\fDLrIHtH=qHHtd@HH@ HEHhDI\$LAD$ID$ %HmhuDE1VID$LE1|W.HHdH%(HD$1IH5JA1Et H<$yHT$dH+%(uH/ff.@SH Ht謁H{HtHCH/t1[ÐHGP01[DUHSWHH]VfATSHHHWHOHt%HwDG(H1[H=+A\XHvIHtrHK Ht-HHH51迍HHt7H(uH@P0HKHsHL[AH=1A\@I,$u ID$LP0H1[A\@ATHH5USH0dH%(HD$(1HL$ HT$HD$ SH|$ H觐IHH|$ u#HD$(dH+%(H0L[]A\H|$uHHtZH-HD$HZ\H|$tqH|$ I|$~DIDHH9\$ ~1H1lHHuI,$uID$LE1P0Wf.E1EH|$HH/t=HHpHq H53E1H8ߒf.HGP0bfAWAVAUATUSHLwG(Lg I^HMI<$LoHy31IDH@HIDH/uHGP0HILIDI|HQITH;PtHD HIDH/I$HL[]A\A]A^A_fDH蘎IHHE H1DILHILHH9uI,$HMWf.H8IHt@HE Hf1!HRHITHH9AITHzufE(E1)HGP0@ID$LMP0DE1I,$tIuAWAVAUATUSHLwG0LoLg M~Ho(_HMcI<$HH LIDH)fDHHHHH4H9tHHZHH9~IDItHHHHH9uH9 7fDHIDI|IDHIDH/uHGP0HH9uI$HL[]A\A]A^A_H舌HtCHC H1@ILHHLHH9uI,$t"HUIfDC0E1@IT$LHD$R0Ld$fDE1^HIHtHC H41ITITHITHH9uI,$tIXAWAVAUATUSHHwG0LoLg L~Lw(/HM3I<$LHIWDHIDH9tHl LxI9~0fDI|M|HEIlH/uHGP0HI9uI$HL[]A\A]A^A_LH4$ԊHtGMHE H4$1@ILHHLHI9uI,$t"I^I3fDE0E1@IT$H4$LHD$R0Ld$H4$fDE1OLH4$4IHtHE M!H4$HVMH 1fITHI9uJ1HKTI,$^Ifff.AWAVAUATUSH8HGW8LoHo HD$H@Lw(H$HG0HD$HMH<$yI>Ld$I`H $Ll$K|Lt$ IHHH\$(ItLHIH?L?L9~HSHwH)uHH$M}HL)KIIKHKtH,$Ll$HLt$ H)IDHl$H0H7HL9~8H\$DKDK|HDHKDH/uHGP0IL9uIH8L[]A\A]A^A_Ld$L?IHtJHC(LM1DIDHIDHH9uI.t|HD$ML`H\$(C8E1E1{HI·IHtHC(LMTHL$1ITHTHITHH9u%IFLMP0I.tI AWAVAUATUSHLoLg(MHII<$uxI$M1ELHT$CHT$HHI|IlH/uHGP0HI9IF HSL|MuIn0HE뿐L訆IH$M~\1/LHT$BHT$HHIlHI9t)IF HSL|MuIn0HEIlHI9uHL[]A\A]A^A_fInHT$YHT$HIn0IF HEHDI/IGLP0fDIntQHT$gYHT$Hu=In0IF HEHDI/IGLP0 fDE15IFI,$uID$LE1P0ff.AUIATUSHHG Hx"HIM IHy~C11DHIDHcH;Y}#HDHu1ڄHt0IM IM0IuHL[H=Y]1A\A]eI,$u ID$LP0H1[]A\A]fDATUHSHH dH%(HD$HH9tt1LD$HH5t@HItHL9uJD7HHD$1H0IHHh HXHXLh(ILx0uHNYIHuHmuHEHP0DE1GH;IVH5z^1;)fDH:HH5"XHOIHtH`:HkHw H5]E1H8[Hmu HEHP0Im\IELP0ff.fUSH/Hŋ@~$1DH}HcH<t;q;]|H EHH[]f.Hs/HcxH&[fDAVAUATIUHSI/P~YHE1@HIcL,Mt6I}Ht LՅu0I}Ht LՅuI}Ht LՅu AD9s1[]A\A]A^ff.USH.Hŋ@~$1DH}HcH<t+p;]|EH1[]USHq.Hŋ@H}~ 1ېHcH<t oH};]|EH[]aATIUS .P~JH1 f9]~9HUHcHHtH8LYx,tH}ރdo9]H H[]A\[1]A\ÐAWH=IAVAUATUSH(dH%(HD$1HD$HHh-Iŋ@pƒHcHH)H&fH(uH@P0HCH9HIEHHtH8HPHpMHHuH|$Ht4H/uHGP0H|$Ht H/ H<$Ht H/IL|$Lt$LLLBH H|$H0VH=Z=>LLL@H$Ht$H|$,4HCH9)AE1ۅ~$fDI}HcH<tmA;]|H|$AEHtH$Ht$7HD$dH+%(u.H([]A\A]A^A_HGP0 @HGP0'HH'I1Mu Hm HH@AVAUIATUHSY+p H9pH}LeL``IHHUH'IFHI$M&MnHI$Mt IEI$HcSH HrsL4I$[L]A\A]A^ÐH8p HcHHt6H}HIH E1H5XH8OV[L]A\A]A^[]A\A]A^H E1H5'FH8V[L]A\A]A^LE1M[ATH=^ESHRHtOHI)HH HC9_HHt!H= BHL[A\f.E1HL[A\fHHH5RQdH%(HD$1HT$4NA1Et|$AJHT$dH+%(uHEH(HH5PdH%(HD$1HT$MA1Et(HcT$J?wEHHHH@HtHHT$dH+%(uDHH H8)@1HfATUHS IHt2HH5EHxImtT1H5ELCtO[L]A\A]A^L-H527L5E1[]LA\A]A^IELP0@H5DLuH5DL}H5DH;HH^HHALs?@HIcHt\H HLHJHAHLH@HAAtAD%HuIcH `HHLHJH QHLHJHMH;.H5CLH5CLqH5CLUH5CL9H5uCLdH5aCLHH5LCL,H58CL H5#CLH5CL H5BLuH5BLY H5BL=H5BLh!H5BLL H5BL0 H5BLH5mBLH5XBLH5DBLyH5/BL]H5BLAH5BLl%H5CLP H5AL4H5ALH5ALH5ALH5AL}H5qALaH5_ALEH5KALp)H57ALT 7BH5#ALHc5h0H5 ALHc1H5@LH5@LH5@L~H 1H=@H0U4HHHtH5@HH:I,$\ID$LE1P0HH=HHH/uHGP0H5;:4ff.*u 1AWAVAUATUSHH9.t1H[]A\A]A^A_1IHH-L5]oL}fDHAtEtLL1N/EIHtOHc1LHLHxgI,$IuHD$ID$LP0LD$MtI(uI@LP0끐)!L-1 =ff.UHH3u H H]1]ff.ATHH5>USH dH%(HD$1HL$HT$ [Hl$Hc\$ tH;C?H;-|H;-gHL%'J%3uWLW8HHHHHBHEHjHu%H HHi H5"CH8?1HT$dH+%(u~H []A\E1vAkDH H5;H8?1fDH H5BH8j?1fDHy H8H1r/DSHH5:=H dH%(HD$1HL$ HT$ t@t$ H|$Åu1u#H H,H H8*H1HT$dH+%(uH [M/ff.fAUHATUSHdH%(H$1L$LyueI{,8u^A1uMLLH:HtLH$dH+%(u)H[]A\A]f1@H H8IG.fHH=8Ht H(HtHfH@H@0HfHu6I"HjH^XH1DHYHfHH9uff.@HH0JHt*H9u-t>%1=@@HD; HuH H5:H8< Hu1H1HÐHHIHt*H9u-t>%1= @HED HuHg H5a:H8@< Hu1H 1HÐHH0IHt*H9u-t>%1=`@HD; HuH H59H8; Hu1H1HÐHHHHt*H9u-t>%1=@HED HuHg H5a9H8@; Hu1H 1HÐHH0HHt*H9u-t>%1=@HD; HuH H58H8: Hu1H1HÐHHGHt*H9u-t>%1=@HED HuHg H5a8H8@: Hu1H 1HÐHH0GHt*H9u-t>%1=@HD; HuH H57H89 Hu1H1HÐHHFHtH9ut.1HS HuHw H5q7H8P9 Ht1Hff.@HH@FHtH9ut.1H[ HuH H57H88; Ht1Hff.@HHEHtH9ut.1HsHuH H56H8p8Ht1Hff.@HH`EHt"H9u%t6%HHDsHuH H56H87SHuH1HfHHDHt"H9u%t6%HH}DHuH H55H8x7HuH@1HfHHHHt1DLGMtHGI(t1fHI@LP01Hff.H HHu HHe HH10Ht#P@@H@ pPHH(HHHt1DLG(MtHG(I(t1fHI@LP01Hff.WуtHm:Hb:HDDtHHJ:HDfDHHtH.:HcHDHtH> HfH H@H(HHHt1DLG(MtHG(I(t1fHI@LP01Hff.HGHh8fHHHHt1DATIUHSHHHt HՅuH1Ht[LH]A\[]A\ff.SHGHHtHCH/t:HHtHǃH/t 1[fHGP01[DHGP0ATE1SHHGHW H9}H)IHxH9|HuE1HL[A\IHW H\ LHHH)HHLEH[LA\ff.GDAVHAUATUSH dH%(HD$1@HH9‰AƉAAĉʼnAAAAA@A AAAAA-tNd@tAlt4b`t'c tpfɃểrA҃ⶃwA浃xA@t$L$滈T$r@|$ɃᶃwA҅sAL$ɈT$@t$rA҃ⶃwEtitH|$ L$T$D$6HT$dH+%(H []A\A]A^SE=s3ൃxⵃxMDHuH H5/H8`1I1MeAAAAA ?rwZ@?sDP!ff.HG G tPwN;?=GWmHÐG vHܚ H54H8M01HfDGm@H H54H801HH H54H8/1HGHHQ H5y4H8/1HH1 H54H8/1%H H5N4H8/1H H5G4H8b/1ff.HGHtHl HHH H54HD$H:/HD$HHGHtH HHHU H53HD$H:.HD$HHGHtH̜ HHH H5t3HD$H:q.HD$HHGHtH\ HHH H5$3HD$H:!.HD$HHGHtH HHHe H52HD$H:-HD$HHH8ALGMtHGI(tH HHf.I@LP0@HQ H55H8Z-1HATH=y)Hx@H582HIY H5!2L=`H5 2L!H51LH51LyH51L]H51LA1H51L(1H51L1H51LfH5y1LJH5e1L.H5Q1LH5=1LH5)1LjH51LN@H51L2H50LH50LjH50LN@H50L28H50L H50LH5v0LnH5b0LRH5N0L6H5:0LH5&0LnH50LRH5/L6H5/LH5/LH5/LrH5/LV H5/L:H5/LH5/LrH5y/LVH5j/L:H5X/L H5H/L1H5;/LyH5'/L]H5/LAH5.L%H5.L u}H5.LueH5.LuMH5.Lu5H5.Lu H5.LtDE1LA\ff.@HcHtfH*^HsHi H5"8H8Z'1HSHHdH%(H$1H5HtXH!8Ht$0HCH H (fHnu"ffH*D$8YH*L$0XCffH*D$YH* $XH$dH+%(H[f.1Ht$0upf$ffH*L$8H*D$0H*\$@YXfH*D$HYXXHtH,HCHSXfH|$HH}Ht_fffH*H*L$H*D$^^XHt |H,HCH^K{HHHHt=HtH 1,HCH H HKfH*^ mH H55H8$1PD1DH1dH%(HD$1HA1ExH<$&HT$dH+%(uHff.ATHH5a+E1H0dH%(HD$(1HT$ t<|$ Ht$=uIffH*D$YJH*L$XIHD$(dH+%(u H0LA\DH H81-jf.ATHH5*E1H0dH%(HD$(1HT$ Ot<|$ Ht$uIffH*D$YH*L$XRIHD$(dH+%(u H0LA\DHI H8,f.UHH5!*H@dH%(HD$81HL$HT$ tZHt$1H|$IxEHl$ H|$Ht.|$ HuH HH H8+1HT$8dH+%(uH@]AUATE1UoyD]A\A]GIxLD]A\A]D+LD HH& DeAH8D+D]A\A]ff.AUATUSHHdH%(HD$81H|$#H|$HH|$Ll$ H|$L$I1111MHxHt:e8u`+uBLH)xLy1DH HHT$8dH+%(uGHH[]A\A]f.H H81*1DHA H51H8 1IfHcx OHH H5'H8n 1HATUHox^1IXLHHxHH]A\fH9 H8H]A\Z)f.Hi H5'H8H1]A\ATSHH=HHHc{IHl^Hc{ID$HLHc{ ID$ >Hc{ID$(0Hc{ID$0"Hc;ID$8ID$@CxHcljHi$IH )Ѝ))HcHc{ID$HHHc{ ID$PH{0H5ID$XH{(ID$`ID$h0Hu HL[A\I,$u ID$LP0E1HL[A\SHH dH%(HD$1HT$HD$5taH|$HtGH;=p t>1Ht$t=HD$HHT$dH+%(u$H [f.1i+1UHH5?%HPdH%(HD$H1HT$3t/ Hl$H|$HuH@1HT$HdH+%(uHP]#UHH5$HPdH%(HD$H1HT$t'Hl$H|$HuHa 1HT$HdH+%(uHP] ff.ATfUSHdH%(HD$1HF0FF HGHF HT$HHPHFHNHPHFLNPHFLF VH5#P1BH0t_D$=l-lkCCkPHc‰Hi$IH )ȍ ))ʉSHaH9UtCHT$dH+%(H[]A\fDHY H5J-H81fDH}`L%݋ 1L9t&H}hHC01L9tmHC(H{fDH H5f H8z1X ff.ATHE1UHHdH%(HD$81HH4t.HD$Hu|$t3fH*IHD$8dH+%(u*HHL]A\H H5A"H8c AVfHH58"AUATUSHPdH%(HD$H1HL$H)D$HD$HD$@)D$ )D$0$H|$Ll$HLALQD$0~D$0H<$FIHHǻHI2@LLHHHI9HHH<5#HHu8E1L&LHGE1HD$HdH+%(uAHPL[]A\A]A^DD$0,HHHIr1 ATH= IUHVHtQHLHHH51 HmItHL]A\fDHEHP0HL]A\E1HL]A\fUH1ҹH5 HPdH%(HD$H1LD$HD$CH|$HHl$H0H@HcT$ HcL$(Hg3H=HH%3H4D$$lPD$PDL$$1DD$(L$,ZYHT$HdH+%(u/HP]D$Ht$H~fD1'HXHH54dH%(HD$H1HT$thH|$Ht$uUHcT$ HcL$(H2H=HHJ2H4D$$lPD$PDL$$1DD$(L$,BZYfD1HT$HdH+%(uHXlff.H1dH%(HD$1H A1ExH<$HT$dH+%(uH ff.H1dH%(HD$1H A1ExH<${&HT$dH+%(uHff.Gx@fDHHU H5H81Hff.@Gx@uDHH H5H8v1Hff.@USHGx/H{HHHHc[]@H H5CH8 H1[]ÐHcH?ff.@@ff.GƒtH=HHDfDtH=HyHDH=ptʨH=HYBHDff.ATHH5UHHdH%(HD$81HT$HHl$H5HD$(HD$ HkHHD$0t H5H]H5HFtrH5H3t_H5H xH|$ H^fI,$u ID$LP01HT$8dH+%(rHH]A\Ht$ H|$xH|$cHHtH/uHGP0 IHtH|$ bHHvHH5%L{Hm`Hc|$(HH:HH5pL?Hmu HEHP0Hc|$,DHHHH5`LHmu HEHP0D$0!HHHH5(LCHmLGI,$IT$HD$LR0HD$vfHt$ H|$V@kHH fHD$(HL$ H AH*^HL$0ZHGfHEHP0I,$txHmHEHP01DHEHP0fHy{ H5H81H H5!H81zaID$LP0xAWL=AVAUATUH1SHxdH%(HD$h1Ll$^LD$H-P DHHLLD$H?HH)HiHHt$@ LHID Ht$Lt$8HD$gaHt$@M IHIDL|$TLm HT$8D$]HHL)HHFH)H=FMcLcA9LH5HeLH5HS1A9HH5AVAUATUSH dH%(HD$1HIZHhHH+H11H HHwIH1 IHtLHLtHkH1E1HHHH5L赸HEHHEu HEHP0H{ 1:HHHH5LlHEHHEH{(1HHwHH5eL)HEEHHEu HEHP0H{01HH.HH5.LHEHHEFMMLH{8lHHHH5L获HEHHEu HEHP0H{@1HHHH5LEHEHHEu HEHP0H{H1HHaHH5wLHE@HHERH{PXHHHH5CL躶HEHHEu HEHP0H{QHHHH5 LrHEHHEu HEHP0H{RHHHH5 L*HEnHHEu HEHP0H{SHHGHH5 LHE&HHEu HEHP0H{T8HHHH5P L蚵HEHHEu HEHP0H{UHHHH5 LRHEHHEu HEHP0H{VHHoHH5 L HENHHEu HEHP0H{W`HH'HH5 L´HEHHEu HEHP0HHt$H|$HT$LH5 tH|$HFHHuHGP0HT$LH5 @H|$HHHuHGP0H<$HHtbHH5a LHEAHHEuOHEHP0CHHEu HEHP0Mtw1LL轾I,$u ID$LP0E1HD$dH+%(HH L[]A\A]A^@L1H{1 HHDLPfD}Lk LHA}Lk(LHA}Ls0LHE1A>@HEHP0_HHEHEHP0HEHP0HEHP0L1Hl H5H8 HH}HGP0qHHuHGP0H|$H/Rff.fAVHH5 AUATUH(dH%(HD$1HT$MH|$Ht$HHH肷H;D$HHHD$H=u}H<IHthHT$HHHH9D$w4LpLJ4RIHHLHMuHL:IL DSE1HHD$dH+%(uGH(L]A\A]A^fE1Hh H5E1H8_Dff.ATHH5ZH dH%(HD$1HL$HT$H$սH|$?LD$L;m tqHLH<$H|$H蘾IH|H1H<$IHtH/tPHD$dH+%(uyH LA\fDH$1@H=yH5ME1HGP0H<$HtH/tH:g H8rHGP0fATH=mSH$H"I1H5HH5LH5LoH5L[H5LGH5L3H5LH5JL 11H=HDHHt\H5LH. 6H5v  HcSLHHsHu2Hu HL[A\fI,$tE1HL[A\ID$LE1P0HHGH5HPHf H81H1HÐHHGH5HPHf H811HÐATUSoGH<@Hx []A\ܺ@1ILHwHxBHHHtjH/uHGP0CσC[]A\zf.Hi H8H@Hd H5H8b[1]A\sc1CAUIATUSHHHHHIHt:HmtHL[]A\A]DHEHP0HL[]A\A]+HHtHi H0tMt&HCH5K LHP1m~IHNHLIOIJff.fH;=Ei ATUSHtLHtAątMH.i HH0KHtHAD[]A\@KE1HuHHEH5 HPH"d H81D[]A\ATIUHSt/HxHHt LՅuH{Ht[LH]A\D1[]A\ÐSft?HxHHtH@H/uHGP0H{HtHCH/uHGP01[ff.ff.HH=g 茻HtHHt HDHf H5 H81HHcHtHxH5n1HH3HtHxH5>1HHHtHxH51HAV1ҹAUATUSHHH5gHdH%(HD$1IH$謫tLkL$$iC/L;%f tVMtQI$LDIHtwI,$E1HD$dH+%(3HL[]A\A]A^D1IJLIMLIMvILSLyhI,$u ID$LP0Hd H8?ID$LE1P0,DHd H8InfKHHxH1E1H5&H_ H5cE1H8'ff.fHHtHxH51HHHtHxH51HHHtHxH51HATSHHHHt>LgL;%nd I$tH~HI$HL[A\HCH/uHGP0H=OIHt91H-HCHtHL[A\fI,$u ID$LP0E1HL[A\A1H1H5t_ff.@GtEHHtHZ LH5cH81EHmu HEHP0E1H$dH+%(HĸL[]A\A]A^A_DLxHHtH@HH\[ LH5H81vD$Af.I|FH-ADH9T$$H$tƄ$xH$EtrHD|$ EtwHDt$EtaH\$D\$A+fDE[\$\$ 2D$$T$Dl$DD$ D$CH|$(t%H|$0t0H|$82*H=Y H5H8DfD$D$D$ D$ D$D$$DL$ED$$ D$ D$uQH\ H5H86D$ƒD$ HdX H5H8kHIX H52H8PH.X H5wH85LL$@DD$LH1H=W H$H5蠯IHHmu HEHP0L˭HH1H5\L1X IH$1A1Et H4$HHT$dH+%(uH]ff.@ATUSHOHtOHWHG HH9}UH)H\ HHI褢Ht H)HIt)[LH]A\@HQ H5hH8j[1]A\U1HSHH5@H(HKW dH%(HD$1LD$H\$ txHEH|$HHGu9H9u\HH赲HHZHT$dH+%(uH([]{HHu Ht1@HPHQ H5>H81\1HP H5XHD$H:UHD$qfDAT10IHt11ID$HtLA\ÐI,$u ID$LP0A\闧AWAVAUATUSHH=U HHIٹ H5LHlH P H=T H-H5HLHO H1葧HCHH`HHLr:H3R H5LHHMH-O H6HEHH5rLH-S HHEHH5qLL-S LʞIELH5xqL諕L5U L蔞\ILH53qLvL=ON LIX ILH5gGL:wH-Q HLHEHH5oGLH=N H-O HL˝HEHH5L謔\H-Q HL莝VHEHH5pLoH-N HLQHEHH5pL2H-KM HLHEHH5$pLH-^Q HLלHEHH5oL踓hH-QM HL蚜bHEHH5WL{+H-,O Hd,HEHH5VoLEH-M H}H- H8CtH5#1[H5Y 1[W~H>A H1H01鮑fDHHM> LGuH5L1HDH5gL1HfW~HA H1H01>fDHH= LGuH5LD1HDH5L)1HfW~H>@ H1H01ΐfDHHm= LGuH5$L1HDH5L1HfW~H&= H1H01^fDHH< LGuH5Ld1HDH5LI1HfW~Hv< H1H01fDHH< LGuH5DL1HDH5L1HfH%C AT1USHH01H~HtqHH< HH0dHmItMx!Lc0L[]A\fHEHP0迡Hu"H@ LH5H81Iff.@H?u鱜H'1HUHxwHEHUHH}HEHEHHUHBHEtHH}HtHEH/tHEH]H@fDHGP0HEtH]DUHG?x{HEHUHH} HEHEHHUHBHEtHRH}(HtHE(H/tHEH]H@f.HGP0]ff.AWAVAUATUHHH5*SHHBA dH%(HD$1HH$J1L4$IHMHZIHt1LfDHLHmHmIu HEHP0Mx0LH)I9LL蚇HHu=HImu IELP0I,$tdE1HD$dH+%(HL[]A\A]A^A_HHHg1H59HHtH(uH@P0fDID$LP0ImuIELP0yfHmQHEHP0B豾AW1ҹAVAUATUHHH5wSH(H= dH%(HD$1LD$H\$贂LuH|$M^HGH9 HD$1IHHUHEE1Ld AfHLIHIu IGLP0HD$IH~I9}:IHHHHt H]HLIHuI.tUE1HD$dH+%(H(L[]A\A]A^A_@{HD$H%H@IFLP0@HIuIGLP0HPH7 H5E1H811bH6 H54H86G̼ff.AUATIHH5UHdH%(HD$1HH$趋H4$H1芎HHHH7 1LH01uH;; It=Ht8H 6 LH0´I,$ItxItJHʉLHIHmu HEHP0HD$dH+%(uvHL]A\A]fD胛HtHmuHEHP0DE1ID$LP0IyfL1H561Iz`HH; H8蹼1HfHH; H8虼1HfATUH(dH%(HD$1Gx HG@u%H^: HHT$dH+%(uwH(]A\fIH|$Ht$H+1LHL貫uH$Ht$H|$۩fH9 H8!tH赡^ff.ATHHH54UHH(H=7 dH%(HD$1IE@H}u9HŅHD$dH+%(H(L]A\HHHHH(uH@P0H蔦MuHT$Ht$H<$jyE1느E}@I,$uID$LE1P0_fDHT$Ht$H螲}dHjHHWHJHxHHH9vHH:~YEHD1H9wffH*Y H*f/rHHHH HHH:HtHXHH7 H5mH8SHHGHtjHw HH~5H8.HH;ptH~/x3HCHH[HHx [fHǧy1H1 H5 HD$H:HD$fDWAUATUSHdH%(H$1GI]A|$1IA|$Ht$H7L= 11Ll$HD$HuTfDHHHHHD$H9X|ZHA|$Ht( H)uHHHH9=Hw HH9HBHD$HH9X}HLeHD$fDHt$@HHH9H?HHH)H9HHH5 H5H8jH|$H/uHGP01H$dH+%(Hĸ[]A\A]ÐK8 uAH~FHD$H9h~H|$H脥xHD$fHi/ H5H81H|$H/uHGP0H4 H^Off.@ATE1UHHH5>SH H6 dH%(HD$1HL$HD$tVEH\$&EHH1蹷HD$Hta}Hp H@Ht*H9ueLd$HD$dH+%(H L[]A\H|$H/uHGP0 ~E1fHIH|$HyH|$HtHD$H/uHGP0D3HtHxHH51@KL%43 I$*f.H- H53H8萳GAUH5-ATUHMIHH{ueE@HGHLL5LDtH=mHL1ЋHII,$u ID$LP0L]A\A]f.A~HEH5MHPH21 H81fDH=1bfHY2 H8QtEE@HHL{LD躋uH=]HA\L1A]fDE1MAWIHHAVHX,AUATUSHdH%(H$HȼHL$0D$HHD$0Hf1 HD$(HD$(P1LL$,LD$8:Y^AWLt$ HD$8l$Ld$(Ll$0xAG@YAGI}H5. H9ÅL~1A…A$,E11E1LH5rfH<+la<w HcH>H* LH5lH81EAGH|$8HtHD$8H/;H$dH+%(QH[]A\A]A^A_EAO @AKEZAGƒbDEWAGEWE1 AGAG D$ AHt$@HHAED$D$X%=@THD$xH~AGLH5Z*LD$^D$HAGAo螛1ILH蒖HD$HD$虴D$HHH/gHGP0[EAO@AEAO@AkfDEAOAA@EAOAi@HGP0@$HD$HD$Ht$8Lut)HD$8D$HH L@SfDH( H5H8rAO@DD$ H $AaL;5J- H $DD$ HDLH5jL1D$7HHHPD$XH(uHR0H;( H5H8ļZ}虯DD$ H $3DD$ H $H<$DI14LAGADD$ xH4- 1D$ID$AGcLęH' H5QH8D$LH+ H8~D$EukD$8 zH% H8D$H"& H5#H8蓻)HD$2D$AGHmuHEHP0AD$1҅谋HH% AWH5dH81 fDHI* H8qD$H3H% LH8蓚Hg% H5H8غ;nnfDAVAUATUSHHH5H dH%(HD$1HL$ HT$D$ LzDcDl$ Hl$EHH}H5i' H9tT?uKHH苊HuL豖HDDI0LH襑HxpH踯fDHQ% H5GH8ڹ1HT$dH+%(uIH []A\A]A^1@H)$ H5H8蚹1fDH( H8f.ATfUSHHH5H`dH%(HD$X1H)$H)D$)D$ )D$0)D$@Pt4{Ct[HT$H4$=IIue tpE1H|$tHHD$XdH+%(H`L[]A\D苜HtHxH5H591mL`I蓴L%|( I$DH" H5E1H8G]ݨff.fHt H@HH" H5H81HAT1ҹUHHH5\H(L%' dH%(HD$1LD$Ld$lHEH|$HH}8HGuYL9LeMx_L;e }Le LHxfL&HT$dH+%(H(]A\f.ۗIHumHu H! LH5NH81̓D1@H# H5jH8ʶ1fDHPH" H5fH81脃1WDH! H5HD$H:}HD$-ff.SHHH5H0dH%(HD$(1HL$HT$ D$A1EtKHCDD$HT$ HHyEthAtBAt|E1HHIHCH讵HT$(dH+%(H0[@HHKH)H9@HDH H5H81X1@HHK H)H9~Hk% H5H8D1oDH H5 HD$H:HD$EH DH5H81Ձ1 艥fATHHUSHHNH5HD1迭Ht}HH@tJLeHSL9|mH;Hu LHmt[L]A\KHEHP0[L]A\2fHmuHP0H H5H8-[1]A\fDH LH5H81HmuHEHP0fHGH8L@ tLGxL鱳AUATAUSHHH蔳HIcH`IHHH# E1HH{H01FqHmIt\I,$tEMH LH0ImItHMxlLc0HL[]A\A]fID$LP0HEHP0I,$uDIELP0Hmu HEHP0I*HuH! LH5IH81jATfUSHHH5zH`dH%(HD$X1H)$H)D$)D$ )D$0)D$@耦t3{Ct[HT$H4$IEMy~ taE1H|$tHHD$XdH+%(H`L[]A\fD軕HtHxHhH5i1~ӭL%! I$DLxIzH  H5E1H8w\ ff.fAVAUATUSHHpdH%(HD$hHGHZH8Ld$HLrHl$ Hu8LHаHT$hdH+%()Hp[]A\A]A^HSHCLt$L,*L;hwqH8Hs H9|~H| LHLkL;k vLk L舷Hw1xHA H5H8J1SLHxDHSHCHs H)H|0 1fHCHSf@L9HIByL1fDHQ H5HD$H:软HD$Nff.AUATUSHHLgMH芑IHu1xHHHmIu HEHP0MtlI,$LgHHuImu IELP0{HuL% I$HL[]A\A]@HE1[L]A\A]ImuIELP0HL[]A\A]ÐID$LP0oH) H5H8蚮ATUSHHtrH{(HHtG*IHtRHSL1HH=HmIu HEHP0L[]A\fDL%1 I$f.HmtE1[]LA\ff.USHHHFH~HH8HG HvHG@HHH(tvH} HGtu8HHHu(H-j HCH9t'HF H{(H~yx>HEHH[]H@P0HPH5H^ H81y1H[]HHHCH5HPH. H81yH1[]HHs(yH H5*H8芬H1[]Ð|HuH H5H8`1ofHPH5CUHGHHWHH8HGHGHHWHBHG~H H5H8̠H}HtHEH/tMH}(HtHE(H/t&H}0tHHEH]H@fDHGP0HGP0ff.@UHGHHh HtH?~ H]+CHH]ATUSLgMtgH8 H1H0HHt:HHHXҊHmItL[]A\HEHP0L[]A\fDE1[]LA\DH1 H5H8袪AUfATE1USHHH5ͶHhdH%(HD$X1I)$L)D$)D$ )D$0)D$@;tILcMtnHKHC Hl$H<$H)It HIH9HOH}HkHIH|$tLHD$XdH+%(u&HhL[]A\A]HI H5H8躩SUSHHHHHdH%(HD$1HH$覞H{8H,$HC HCHtBH;-S t9Hb H9EtLHHHHH(t_HC11HT$dH+%(unH[]H{HEHkHt H/uHGP0HEHC 1DH@P0HC1H H5/H8菨#AUATUSHH_Ht\HCHK IHAH8~HHWx/HCHK HP EE1LHmHC81H[]A\A]øH H5H8UHjH}HtHEH/tHEH]H@HGP0ff.@ATIUSH_p|H9tgHH HI|$hHHt+1Ҿ@B菕H~uR[]A\fD膵H~[]A\@H LH5׳H81s[1]A\LH=1=pH5H}ff.fUHG(说HEHUHHHEHEHHUHBHEEtH贒H}HtHEH/t]H}8Ht cHE8H}hHt lHEhHHtHDžH/t,HEH]H@HGP0H}8HufDHGP0]fDATSHH(WdH%(HD$1HD$NHh1#vHHCpD{(HCpH{hwH 1HH01 cH{h1I}HCpM{I,$H H{1H01bH{8IHt 0bHC8H|$Ht1H$Ht$PcMtI,$uID$LP0fE1HCpH{hvHD$dH+%(H(L[A\DHE1H H8Ct_H5E10fDL%1 I$zHhfDID$LP0H5!E1ѣ@@HHHHt5H(IH@P0=HHt$H|$薍y蛟UHHHxHLE8Mt L`H}xͬHE8HH}hHtilHEhHHExHEpHPHufHuHHHEHI1It H]DD$ ϞD$ H]H H5H8菢H H5[H8rdff.@AUATUH dH%(HD$1H=CLH^ H8fru"HT$dH+%(H ]A\A]@Ll$Ld$HLLHLHL臊Ht$H~@HtH5Kh$Ht$HT$H<$聁1xf.H<$H/uHGP0H|$H/uHGP0H|$Ht H/uHGP0*@H?K轑ff.fAVAUIATUHH5( S蒊HHIHDLxYHHt\HI ktwH31HL1e^IHtHmt|I,$uID$LP0LYHHupHIHIteL%S I$[L]A\A]A^fHmu HEHP0I.tE1[]LA\A]A^HEHP0uIFLP0[L]A\A]A^IFLP0L% I$HIuIFLP0AWAVAUATIHH5USH(H2 dH%(HD$1HL$HD$7_MH5 LH\$L5:h11L- D$ aHHHx HuH90D$ HL1H5 IHHP1H@H~1H<H9f.I/uH $LR0H $LLL1茗IH@H@oIwHHUHHH$qH$_H}MOIw H}(HL聨I/u IGLP0HuHHE(H<0 HH}(pHmHUH$HR0H$fDH9H9HA| uDH9HA| ufDfDH= (@H  HDHmu HEHP01HT$dH+%(urH([]A\A]A^A_ÐHPH5ŴH H81iI/uIGLP0fH= @I/uLP0HuHRH50)fAWAVL5kAUL-ATUSH1H膥IHf. LLH1;HHtcH;, H@H}tnHL胍HmAu HEHP0EyI,$u'ID$L1P0@{sI,$tE1HH[]A\A]A^A_HmuHP0H< LH8QHI,$uID$LP0f.I|$tH(uH@HP0fDI,$u ID$LP0Hmu HEHP0Hn H5H8FfH HHHt1DSHHHtHCH/tYH{HtHCH/t2H{ HtHC H/t 1[HGP01[DHGP0HGP0ff.@HE HH5 HH% HUHHHtHEH/tAH}HtHEH/tHEH]H@fHGP0HGP0SHGH HtHC H/H{(HtHC(H/H{0HtHC0H/pH{8HtHC8H/EH{@HtHC@H/H{xHtHCxH/HHtHǃH/HHtHǃH/H{HHtHCHH/tfHHtHǃH/t9HHtHǃH/t 1[HGP01[DHGP0HGP0HGP0g@HGP06@HGP0@HGP0@HGP0@HGP0@HGP0Y@HGP0.@ATIUHSHH Ht HՅH{(Ht LՅH{0Ht LՅH{8Ht LՅH{@Ht LՅH{xHt LՅuoHHt LՅuZHHt LՅuEH{HHt LՅu3HHt LՅuH1Ht[LH]A\@[]A\ff.MAWAM)AVHLAUHATLcIUSH(MLH$E?t5LAt!A8 „LAu߀8 F Ln LFHE8D|$IIEMII)L9LCLL9t$HfAu#MDD9weI9 LAuL9 At]At_L t& AfA@8 H)HIH([]A\A]A^A_f8 @LAu( w t'I9xLAuLҾ LOHQH)HIHH([]A\A]A^A_@ED9wI9LAuEHV0HH@HDIg@LLD$H)LL$t$OOt$LL$LD$HHthH9vcI~Q,ADAD9u"HI9AuDAD9tI9LH9A9Lt$HH)NHHt6HHL$`H)HIHH(H[]A\A]A^A_DGdHD$`H $HH(H[]A\A]A^A_@HH)HILHAuFfD9w SI9tLAuf8 „:H)HI8 t$LHMSwH~QHHt`S t$H{PtHCHHx HS@H)H[l@C$tH{`uH KH8tH5S1[H5<1[HW~9GuHHDH H5"H81HHa H5"H8ґU1HSHHW tHWPHtHH+G@H9}H HH[]H{@HH{8 HtHk@H[]HHGH5ݛHPH H81(^1HÐATSHHH0t>H 1H01NHǸCpHtUH/At7HD[A\@Hi 1HH H01NH1@HGP0HD[A\Aff.g HH;= tHT 1H01HNHHSW~tGHuJH 1H01NHtH(tHC CHC [HPHR0@Hy H5H81[fDHY H5H8ʏ1[fDAUH5IATU(bHLHGtHA~ IEH5HPHr H81H\Hmu HEHP0L]A\A]fDIEHH=ϪHp1XLItfH H8a_t%(IE]H=A\A]Hp1=XDE1HW~AGuH H5H6afDH) H5ʬH8蚎1HH H5ʠH8zATUSHLMI$HHLJHLJI$HH LH8I,$HtZHL% 軋tgH{ I4$11HKHtHmtfH(u HPHR0H1[]A\@ID$LP0ID$LP0jHmu HEHP0H[]A\HUHD$HR0HD$ff.AVE1IHAUHA 1ATUSHH`dH%(HD$X1HHR"HTIHL- @裊H{Iu1L1JHHtI,$H;- H HH0uHmItKM}M9|xMtHC0HtLHC0HD$XdH+%(H`L[]A\A]A^HEHP0@I,$uBID$LIP0ID$LP0QH. LLH5AH81XItHmIbHEHP0SU|DAWHIAAVHA1AUIATUSHxdH%(HD$h1Hl$HPCH:SIH/iyL5 HDI}1LI61HHŋHtI,$H;- Hi HH0tHmItTMM9MtIE0HtLIE0HD$hdH+%(HxL[]A\A]A^A_fDHEHP0@I,$uJID$LIP0IT$D$ LR0D$ @Hf LLH5ɨH81VIgHmuHUD$ HR0D$ I@zUSHHG$t}HW`HtsHwXH9tjHOHH@HH)HɹHHHH)HHt=sH)HHs8HtRHtEHCXHCXHCHT|x7HsXHS`H9|H\ HCXHC`HH[]Ð1IH1[]H)HH)=HxH)kHHsXHS`f.SHHtbH(HtIS t4H{PtSHCH1HxHs@H)ƺHHCPHtH H[ÐH@P0S u1[@C$1tH{`ufDATSHHOG,u`{udH{h1|uHbHHCpHCpH{hISZHL[A\HptHL H5gE1H8躇HL[A\H! SH8tH5VE1與fDH5E1qy@E1mAWAVIAUATUSHDOT$EnHw,uTouXAN tsMFPItiIv@I)MM~ZHUH}Iv8L9L]Mn@:HotHL H5|E1H8躆YDE1I~h1uLy`AV$IFpIL}IFPIF@M)MD$D$D$u MAF MfPIL)LIv8LHH~[L9I H}Iv@IOINPIv8INHLHBI^@I)IM~KIVxL9vHuLLLTHHt$HuMH|$tIfDLPIIFpI~hWHL[]A\A]A^A_f.1E1&fDL8HHtFH(H@P0f.kH}I~@H[]A\A]A^A_HtME1efHI EFH8EtH5|E1讄MH5E1蚄9E11L% I$ff.AVAUATUHSO,HH.mHC@Lc8S IąttLsPItjI)HI9H L?HL)LHpHwIHt HC@HDHC@[L]A\A]A^fE1L9H{h1uH~]1HCp赌IHQMPC$HCPHSxHHs8IHAH9H{8HCPLNHHCHLHHJ'fDHx H9rLvIHL9HLmtI%HIHL)HHIN]H H5dE1H8节DH)HIvIHLc@LLsH LH8I.IIFLP0LLuIHHLsI$dHI$$HLs@L)HHI^fDIFLP0HL)HHIG@HHHt8H()H@P0fL LpfHHH5fHHH5yfHHH5~YfATHIUH-SHHH,H;E t []A\fDH(u HPHR0H{L[H]A\DATHIUH-SHHH HdH%(HD$1HD$HtzH(HtaH{LHH|$IHt(H$Ht$:MtI,$u ID$LP0E1HD$dH+%(u4H L[]A\ÐH@P0HHt$H|$ex4l@HHtH H0tK@HHe H5H8V{1Hff.@HW~AGuHk H H0HKH H5*H8z1HHi H5*H8zATWGuXH8Ht7H H0JIHtLA\fH H8JtvL% LI$A\fDH H5zE1H8GzDH H5zE1H8'zDAUfATE1UHHH5NH`dH%(HD$X1I)$L)D$)D$ )D$0)D$@mt1LHIH|$tL踀HD$XdH+%(u H`L]A\A]&jfDAUfATE1UHHH5JH`dH%(HD$X1I)$L)D$)D$ )D$0)D$@\mtLH8IH|$tLHD$XdH+%(u H`L]A\A]iAUfATE1UHHH5H`dH%(HD$X1I)$L)D$)D$ )D$0)D$@lt1LHIH|$tLxHD$XdH+%(u H`L]A\A]hfDAUfATE1UHHH5 H`dH%(HD$X1I)$L)D$)D$ )D$0)D$@ltLHxIH|$tL~HD$XdH+%(u H`L]A\A]ChHs[HtHxH5]~w1HHC[HtHxH5-Nw1HH[HtHxH5w1HHZHtHxH5<v1HHZHtHxH5.?v1HATSHHH5HdH%(HD$1HH$H6`{5K,H蒛H{h1菄uHPS$HCpt!H#HHH(uH@P0C LC8tHsPHtHC@H)HHCPHSxLHnHHHCPHCHHC@H{89iIHCpH{hGHD$dH+%(HL[A\fDH{7^H H5=E1H86u@H sH8uWH5`uE1E1jHtHF1?fI<whI9H5E1t/Oeff.@UHHH5H H+ dH%(HD$1HL$HD$04A1EtMHt$~"HHT$dH+%(uMH ]@H HD$H:UtH5~tHD$H59sHD$dATUHHH5܏SH0dH%(HD$(1HT$gA1EuH\$HD$ fHU,H誘H)E tHuPHt H+u@HKH1fHD$ HH}h1hLHEPHHHEpHD$ Hp HEpH}hI7EItqIL9}HD$ HT$(dH+%(H0[]A\H}w[-H H5H8yr1DHPH|$ H/1DE1H|$ LRq11eefMH HD$H:t2H5|qHD$7@H9HHN@H5qHD$fHGP01fH) H5HD$H:qHD$&bfDAWAVAUATUSHHH5*}H8H dH%(HD$(1HL$HD$1DSLl$EICDC,EujHBuiILHH; ItpHD$(dH+%(zH8L[]A\A]A^A_f.H{wYH H5H8zpf.E1H(u H@LP0H{h1~u Ht(JK E1HD$ HCptHCPE1HtH+C@ILM91cHD$ HHh ME1S$HCPMRHL!HJt5HLHHPHiI)IMHHuHKxLHHHH럐H{h1}uHI{ HD$ HCpHkPHH{@H)s$tHHH.H(lL% H{HCPI4$6I4$H{11o,IHH; VH@HH|$ ME1[@1XH DKH8EH5xE1*nUM @H|$ LN;H|$ Ht H/uHGP0E1HCpH{h5@1vIH Ld$ Mt3LL8_H|$ fHtHD$ H/uHGP0H H{1H019+HD$ IHH;a t?H@ID$Ht$HS0HHkHHC0M`두LE1H!I$HtH/teMtI.u IFLP0MImIELP0fH|$ HH/AE1E1HGP0H5~E1ql@H@P0@Hs@LHs8HvM)Ls@]fH|$ IHE1H{8H_HD$ H Hk@DHIHI H5*E1H8kfHC@1HCHHCPI@HL$Hs@J|5Hs8HHKPHKHL9LM)MuL{@MHKPHSxH9~zC tSHtMH)HHs8HHL$IHH H@HHs@J|5Hs8D11fHC@HCHHCPLd$ fDHHHH(H@P0fDE1H|$ LM^H|$ IE1M[[H H5vH8:jH|$ HtH/uE1E1HMH|$ H/uHGP0H H@H LH8wH|$ IIYH H5H8iH|$ Ht>H/uME1E1LsLk@I,$ME1E1zI,$lID$LE1P0\Yff.fATUH- SGHLE~DgEuVHL;RHtH~HCD[]A\@;9Hu=H}AH5UhD[]A\H5цLAhAH5zLA|hf.AUATUSHHH5tH(dH%(HD$1HL$ HT$D$ 'ND[Dd$ Ll$EADK,EH0HkH5 HfHHE LH0DHHmA DC EHC0HHKPHHS@HH)HHEuHsHII)HLHHH)LIII9H9H<2H)H{@H<HfI7@HkHOHm H5iH8ffDE1HD$dH+%(H(L[]A\A]Hؔ{ DH{h1ttyt@s$HCpAHDH荲HHHCH#fIHt{C tHCPHCpH{h{8AfDHh(?s$HCpwHHHtH(]H@P0QfDE1K t!H{PtHCHH2Hk@H)&S$H{`ufH DSH8Et]H5pE1Netf5HUDH DH5~E1H8110DH5AwE1dUAT1ҹSHHH5L>HdH%(HD$H IH$1KL$$H{h1r_>HCpC$tHlHHH(~Hw H{L1H01!IHtlHLHHCpH{ha6HD$dH+%(HL[A\fH8\E1H@P0v@E1H) SH8tH5^ncH5uE1c{@_\ TfAT1ҹSHHH5<HdH%(HD$H< IH$1SL$$~kCH H1H01 HHtbH(uH@P0H H{ 1LH01 HT$dH+%(uMH[A\H H5tH8bf.1@H H5H8bb1RfATUSHHHHXH dH%(HD$1HL$LD$HD$ XHl$HCH5 Ld$H1HH{HEHkHtH/tZLcxHHC >xjHCPH 1H9Kt;CC,1HT$dH+%(u>H []A\fDHGP0Hi H9EDQ@ATUSHHHHH dH%(HD$1HL$LD$HD$ VHl$HCH5 Ld$H3HH{HEHkHtH/trHLcxHHC x|HCXH - 1HC`HC@H9Kt=CC,1HT$dH+%(u@H []A\HGP0H1 H9EDPff.AUATUSHHHHvH(dH%(HD$1HL$LD$HD$ U Hl$L% HCLl$LH^HLHJ/HLH1HH{HEHkHtH/tuHLkxHHC 諻xHCPH 1HCXHC`HC@H9Kt8CC,1HT$dH+%(u;H([]A\A]ÐHGP0@H H9ED,Off.AUfATUSHHH5&HdH%(HD$x1Ll$ )D$ L)D$0)D$@)D$P)D$`XRCDc,EXH@YH{h1=luHA7k HCpEH{P:H{@HCxHT$0H)H9HIHH({ s$tH{`tHCHHx HS@H94Ld$01BHT$0Ht$ HH)HHfHHI)PIL;cxS (HCPMoHCXLc`Lc@HCPHt I9~LcP@HCH\H{EH H5(yE1H8\O@D[$EuwHC@1HCHH H8CH5n?\E1H|$(tL5cHD$xdH+%(?HĈL[]A\A]H{`;yH{P{hH@LP0{ SfHt$ H{8"fDS$HS`HC@EtqHtkH9CXeDHl$0DK HHC@EtHKPHtH9H9~HC`H/[IHCpH{h-fDHCXf.HSxL9{Ht$ H{8HreHCxK HCHHC@tHSPHt H9~HCPHC`H|f.E1lH|$HT$Ht$DH|$HRH H0 6HT$Ht$H|$S:DC EtHCPH{8HsXHS`H+SXHCHS`HCXHCXH)CHHH)C@H)HCxH)H{`HH;D$0 VHT$0Ht$ H{`H{8WdHl$0Hk`Hk@~DMSHCXLc`Lc@fDH5odE1Yg@UfDHCPHt$ H{8LHLcC Lc`HCXLc@jH|$HHT$H|$9DH)HHպH:HAHkHHt$ H{8HWcHk`HHk@mIff.fAVAUATUHSHH dH%(HD$1H$ H H9G1HL$HT$IH5uH3Lt$H- L,$Ld$HL(HHLg*HH=7 LL1H-AH0HCHtgH= LLH1HCHtN1HT$dH+%(u\H []A\A]A^HH=&fH{HtHCH/uHGP0H@HtaUHGHt+ y1]^yHmu HEHP0]HPH| H5vH81#HmuʃfDAWAVAUATUSH(LgML;% HoH P HQ HLE1H01fIL+Ml$ED$ C MEA JID$0I|$HA@HEM DK E|$ DAAADA׾ DL$IDD$DT$L$H<$HT$H<$L$HDT$DD$DL$~AEgHT$ Ht:1ɃHH<$1f7H wT L9|E11H q @AEeID$0ML$HA@LEAL $I^1L $IMuc(f.GA *  I9?AAfAL@HfHLPHruA π A|HDAL97AMAC A AAD C H(L[]A\A]A^A_fDIOH<s< AT$ L HI|$0It$H@HEH<L3^I,$u ID$LP0c MMED$ M~|DDƒ << IT$,ID$DA@HEB< t:IU1L$.HH{I,$JK DE ILmEMl$A I|$H@HIL^E1A@u AAtAEMuLPIHP  h@GIOH<G<_@IHIw0HEH f2F@1Au7 w   L9HHru< wfDID$HHB<( l]I,$ID$LP0fALHA Qf fA|@H g A<1 HAAAOAD fWf DALHk^< AHrnf.  fAT@AHA< 9AHA:AD I,$uID$LT$LL$P0LT$L$LLL$CH<$I MFK E@AD VfAD IA@ fAL@H<7 @ML$HfDfAHW~AGuH 1H51HbFfHɷ H5jkH8:M1HH H5j_H8MHW~AGuH 1H51HEfHY H5jH8L1HH9 H5^H8LHW~AGuH 1H51HEfH H5jH8ZL1HHɶ H5^H8:LHW~AGuH 1H5 1HEfHy H5jH8K1HHY H5^H8KHW~AGuH 1H5=1HDfH H5iH8zK1HH H5]H8ZKG HInHcH>H xH1H5gH=g}WDH=g| @H=hl @HXH5g1H=-H89[1]A\@1H^IHtHI,$tEyH H5WH8b9H٣ H5KH8J9ID$LP0ATUSH0WdH%(HD$(1GH[1贽HHHpHmAt6Et;HԨ HHT$(dH+%(vH0[]A\HEHP0@HD${`H1H5q1z1HHH(thH{ 1H51T1H|$HvHT$ Ht$HD$HD$HtH(uHPHR019fH@P0H{ HH11H5I0HHt|H(5H@P0)fDH H5UH871H H5IH8j71HT$ Ht$H|$\![3'AUATUH dH%(HD$1GHH=SyHD$HtGHGtc~ HEH5KHPH˥ H81H|$HtH/uD1HT$dH+%(H ]A\A]H5٫HIHuHH=mS1I,$IMH|$LH|$H5]HIHHH=S1HI,$Iu ID$LP0Mt~LH|$QHt$Ht~HU(H=R1H|$H/uHWHD$R0HD$HHD$fDI@H H8Y H=OpIG(H@DD$6DD$HfLH'IG0HHH5HIH~H@t1HyZ H5 HsHHtLtHCIGhI,$|ID$LP0l@Hy H8q)4HX H8P&fAWAVAUATUSHHH5!@H(dH%(HD$1HT$/Hl$} PCDkE HI H9C?H5 H HLc0M2HE{\LuOH{PD1AL HH81I/2I/&IGLP0"fAWE1AVAUATUHHH5)SHXdH%(HD$H1HL$$HT$(D$$?EDl$$L|$(bDeEHއ H9E<H5% HH\I}]VAA EH2 H31Le=H H1H01NHHH(uH@P0LIHE1Ht$0HǺIEHIEu IELP0D$/H8v Hl$XHw L|$H|$H51)H8L 0H|$L|$H/L|$HGP0L|$I~8E1L-~DHhHHHt1DLGhMtHGhI(t1fHI@LP01Hff.H HHHt1DL$HH $L9uHH LAdH%(H$@HLH9H9LAH$$LƄ$H9wsH9rnLAH$ Ƅ$LƄ$H9wJH9rEHH$0Ƅ$ H Ƅ$/H9w!H9rƄ$0Ƅ$?'H$@dH+%(uH@H=EATIUHSHt HՅu?H1Hu=DHH0t(HH|HtLՅt[]A\fH=Ht[LH]A\[1]A\fHJ1H9tËB9FHHDHHRE1A;Bu:~>H@H4 H<H9<uH H9t|9|tE1D@ADff.H~H/uHHGP01H1ff.fHHvH=5O1HHGH|0H/uHHGP01H1DHs SH(x C(1[ø[DHt SH(x C01[ø[DAVAUATUHSHGHfH* gHX^f/H,Hv@HH9wLmI9L4LeLU8HEHHL1觽H]MOH{Mt;IHt'LE@HHHJH!I H1H2HHuIM9u[HE@L]A\A]A^\H,H?1Le[]A\A]A^HƒfHH H*XfUSHt?֑HߟHpCt{1HCHðH9uH=HtH/Ht H[]DHGH@0H[]VuH t HfDHGHt HHSH1҉Hs H{HtHCH/tC[@HGP0C[ff.UH dH%(HD$1HHWHH$ DSH>^I[L1fDH>@IHHM@HrLBHDAWAVAUIATUHSHHLD$MM1MyH$HAIHt~H$HfHH9wHHH$I$ID$Il$I\$ AH$HID$Ht^1wHD$Ml$(Mt$8ID$0M|$@HL[]A\A]A^A_@L=r L5p EDqLE1ADIE1HѺfHG HGHHGHHDHfAUHIATUHSHW(HUHHEHH!L$Mu9fM$$Mt'I9\$uLLHU0tHL[]A\A]fHE1[L]A\A]ff.@AWHIAVAUMATUHSHHL$W(H} H}IHEHL`M!U8HLpHUHxLH] MtHEHT$LH|B HEJHHHHEHHExCfH*HEHxSfH*1^/<wcH[]A\A]A^A_f.HƒfHH HEH*XHyHƒfHH 1H*X^/8<vHH1[]A\A]A^A_øzH(HHdH%(HT$1L@HVD$HH HT$ NDHT$ HT$dH+%(uH(;ff.ATIULSHE1HtHSHHtL A[D]A\AWHIAVE1AUATUSHHHL$L$W(IIL`IGM!J,HuHEIHHL;muHHLAW0tIWHEMIH<$IoHtIGHT$Ht HAW@IGHxifH*IHxyfH*^ kZf/vLH[]A\A]A^A_1H[]A\A]A^A_HƒfHH IH*XHyHƒfHH H*XrfJHHL }Ht$dH%(HD$81tNHt$HT$LD$ |$ Lt HD$ H)!HD$8dH+%(u'HH@HT$LD$ LϾ|DH?tZAVIAUE1ATIUHSIFJHu #HHtLHLՅt[]A\A]A^IM9.w[1]A\A]A^1fAUATUHSHH?tHHWE1fN,J*HHt@HHU@HuHUJ*HIL9ewHEHH[]A\A]ATUHH}SHt6E1JHtHHU@HuH}IL9ewU@[HE@H]A\@AWLO8AVIAUATUSHLg HoHO(LG0HLHyIHtSI>tME1IFJHuQfHHt@IFHSLHLLDtLE1nHL[]A\A]A^A_@IM9.wff.fATAUH-,HHp~u8HA!H=w%H5HE1BH:~AHD]A\fAVAUIATUHSL6HMt=I>~7E11IDHpHtLzAIcI;|HCHtHpHtLLHC HtHpHt L*tfLcMt3I<$~,11fIDHpHt Lt6HcI;$|HtHLڪt[]A\A]A^[AmH]A\A]A^fHBHLHH8I(uI@LH@0ff.@G utATIUSHG HHtC~1HcH@HCHu);k|IcD$ IT$HAL$ H[]A\fDHxLfff.@ATILW(USLOHMaLH!III9(H;5Yh J,3H=|RH{II9 I ¿HuifDHHC [IH@HD]A\IDIH;5g Lt H= RH{HL(HufDI4 HtHHLHDH!I~II4JfI9~ I4DIc4f.H;5Qg K, I BrDH;51g J,fDIc DIH~eE11D)+AA?DHAH9uL9}+t'fD?H@tL9|ff.IH~P11DDDAA?DHH9uL9}"tf?HtL9|HH~:IuHe HH@Hb H5KH81fDHb H5B H81ff.HH~:IuHe HH@H1b H5H81fDHb H5 H81ff.HH~:IuHe HH@Ha H5kH821fDHa H5b H81ff.HH~:IuHe HH@HQa H5H81fDH1a H5H81ff.HcGp#HHOpHǸwxHfDHHmc H5H8F1Hff.@UHSHHW(HHHHH9v;H^HH>uvH}H4MHt~H](E1HEHD[]E1H9wffH*Y H*f/rHHHH HHH\@He H5%H8rAA}f.ATUHo8SHHC0HtCHIvu"LHuLC0[]A\@I,$u ID$LP0E1[]LA\ATUSHH8GIHt|L`HHLxNHs1LHHHEt8HAHEt D[]A\@HEHP0D[]A\fDHEHHEu HEHP0AATIUSHHPHyHS`IHHt'Hia HLH0GI,$HH} DLeHSHL)H9{0HC *I4H9H94LC(HC1HI)H4LHLcLcL;c ~Lc HEL`LeMu,HEHP0L[]A\f.ID$LP07E1[]LA\DHx2HSHC H9_fDHb H5jH8Hmu HEHP0I[]LA\fHS`HHH} H:H9t;HuHSHC fHKH)1HH<:HSH{8H4ZHH~RIu,0tHW HwH`HHY\ H5H81HH9\ H5H8AVAUATUSHHo dH%(HD$HGH9HWH)HH9L,HHWXHNHMHIHHD$MdE4$A$MwJKPE4$LHXYHHHHSnHT$dH+%(u3H[]A\A]A^ÐHD$dH+%(uH11[]A\A]A^VfDHHHp98t"HH9uW?w2HDHq_ H5H81>1HHZ H5JH8:1HUSH8dH%(HD$(1Hl$H\$HtkH@HHHD$lHH52HH)H)H9H^ HBHL$H81茼HD$(dH+%(u'H81[]HHD$zf.tHHuDH9tHHZ HOH5H811HATUHHIH0t xaHZ H9EtbH;` 1HH01茬IHt6H@I|$t HL]A\I,$u ID$LP0E1HL]A\HHIHuHX H5sE1H87DHX H5jE1H8wfHPH5] H5H81ԺI,$k[@AUATUHHFHtU~ Iy4A|$IulLmM~HLXHx]LA\A]ffDH(t]1A\A]@HPHX H5>H81,f.HW H5cH8*HW H5ZH8 HH~:IuHHHQW H5H81HH1W H5H8S1HGI]A1ExYH{8H{XHtHCXH/tkH{`HtHC`H/tDH{PHtHCPH/tH>\ H[HGP0H"\ H@HGP0HGP0ff.@UHGHHWHHGHGHHWHBHGGHHHt HEH}8+H}XHtHEXH/H}`HtHE`H/tqH}PHtHEPH/tJH}hHtHEhH/t#H}ptH\HEH]H@HGP0HGP0HGP0HGP0\ff.UHSHW~'1f.Hc1HHEH0P;]|E uH1[]DH}跧H1[]ff.HcUHH(HH}H/uHGP0H}H/uHGP0H}HtH/t H]PHGP0H]@AT10IHt1cID$Ht LA\I,$u ID$LP0A\GAVAUATUSHGHVLlLH=HJ<IHH1LHH_IHt^HCLLH\H)H8IHu5fD.u/HuHHH)H\IH1[L]A\A]A^DkE1[]LA\A]A^ff.UH1SHH(oH{dH%(HT$1H|$$փH$H>t H$/vHt$HVHT$H>uH)HfH~G1 D΃Hs HH HH9~# /vHsHNHKHH HH9HT$dH+%(u%H([]H<[Hua1XAWAVAUATIUSHHL5W L9IHXHBOHHHMAM9A tID$-CHL{8L輚H{XHtHCXH/uHGP0H{`HtHC`H/uHGP0H{PHtHCPH/uHGP0HH1HCXHUCKCJ} uHC`HHHC Eu[1H9L詡u}C0HC1fSHH[]A\A]A^A_@H-q@LH~1Hx%C0LHHCHyfD떐1yffCJH=R LH5&1ʧHCPH < tT< t(HO LH5H81E E< uȀ}@1@}uDHPH5% HvP H81'HPH5, fATUSHIH0HW Hw%HHH{hHtP[IHHSXHKHtKM1H=HHmIu HEHP0L[]A\fL%YT HSXHKI$HuH@T fDHiHN H5;E1H8DHqN H52E1H8f.HmaE1cff.fUHHHHH dH%(HD$1HL$LD$HD$HD$ft2HT$Ht$HHT$dH+%(uH ]f.@AUATUSH(dH%(HD$1IHFHHH~~1HdzIH?1HL$LD$HH%1HD$HD$HT$Ht$HjI,$u ID$LP0LkL̬IHMmHLyH}JLL]H{(Lm HGt`H HHs0HQ HEH9t'HF H}hHx)HH"@HPH55HL H81\1HT$dH+%(H([]A\A]HHHEH5HPHL H811HK H5SH81fDHHuh^I,$yID$LP01i;HVHKK H5H8;L1'HPH5u+ff.H~HIL@HHJ H5H8N1HHc=kHc=jHH~RIu,HPHtHLK H0HHO HHHYJ H5H81fDH9J H5H81fDAT1ҹUSHHH5MHL%O dH%(HD$1IL$$M{HH,$G{IHL9HKHC H)E1HLIS0tGuPHCLH4LHKVHT$dH+%(H[]A\fI9u HHx&HKHEH5MHPHI H81`1@HN HH0IHt}HKHC H)M0I91"HH H5[H8"15HHS HS fDHyH H5:H81;H1ffDAT1ҹUHHH5SHHM dH%(HD$1IH$m}HL$$}IuY}0t Hsx_Lu[I9HHHT$dH+%(H[]A\fDHG H5+H8f1@HL LH0HHu(Ht1ID$H5dHPH H H81w1eH G H5H8z1Hff.AT1ҹUSHHH5˵HH-IL dH%(HD$1IH,$ {HL$${ILEI9u`HkHH;k }%{0t HxcHHxTHk HHT$dH+%(H[]A\ID$H54HPHF H81G1@HiK LH0HHU蔫HuHE HH5 H811eDHE H5+H81CHaE H5"H81#ffDATE1SHHH5H(dH%(HD$1HL$ HT$D$ NtR{HT$ H|${IHyOHtBtTH{ IHD$dH+%(H(L[A\fuuH{H{IDH{ f.HID H5H8H)D H5H81xkH D HH5 H81UHHC H5H8Z-DHyH H5E1H87 ff.fHwHt;HOHtHyuH= 1ED/H= 1-DH= Lff.ATUHH x [xWLe1AH.L軨HuHEHH]A\DHLHpH]A\:f.1ff.AWAVAUIHATUSHgHI}HHoHmIM=bHbL55I} H蜷HmIu HEHP0MH;tVHLL1HHuI,$uID$LP0@1H[]A\A]A^A_HEHP0PI$HPI$HuIT$D$ LR0D$ DI,$u ID$LP01CH[]A\A]A^A_AVIAUATUSHHHHsHHŹ/H=1IHt\H{ H萕I,$At6ExAuOHmt[D]A\A]A^@HEHP0[D]A\A]A^fID$LP0EyHmAuɐHKHsI/H=81rIHtHmAuAuff.fUHHH5HdH%(HD$1H肤t^H4$HrtNt)1@{HT$dH+%(u/H]DH$H=͂H51G1HHH5dH%(HD$1HT$t`|$gtSH=HtOHcD$E1HH@HHNjtLcL軔HT$dH+%(u HfD1@HQB HFfDSHHH5HdH%(HD$1HT$0t,D$C(HnD HHT$dH+%(uH[@1SHHH5qHdH%(HD$1HT$t,D$C0HC HHT$dH+%(uH[@1gUHӕH}HtH/tTH}HtH/t5H} HtH/tHEH]H@DHGP0HGP0HGP0USHHH5H(dH%(HD$1HL$HT$HD$H$蹡tUHl$HHtAtDHHHT$dH+%(uyH([]fD1tܾH=1@HHH…t,~ʃtuH<$H/uHGP0HpB fDHaB pATUHHH5H8dH%(HD$(1HL$ HT$HD$ HD$跠tkLd$HLtWtZHH=J1yfHT$(dH+%(H8]A\@1tپH=x1@HT$LH…tR~ȃtuHl$H5bA 1H=HHmvHUHD$HR0HD$]DH5!A H=1賾>fAWAVAUATUSHH $HH5dH%(H$1IIHHHюt4L脆HHt#L$PLL讻HtXH=}LH5?1 LE1H$dH+%(DHĘL[]A\A]A^A_f$PPK$`$\L$H9<H9!H)HgH9aIHe1HL؍CH)D$4H\$8L|$Ll$L.L谺H$PPKH.$X$nfD$$ZfD$"$\fD$$^fD$ $`D$0$dD$,$hD$($lÉ$pË$zD$$9D$Ll$@Lf9LFHIڹH9u/D,@9wAD9LuL|$Ll$H={LH531LI/IGLP0HH=Z{LH5 1њL@H7 H8!H={LH51!w@H*H71HfD$H1LlHHx xH'Ht$H/1H=~HHD$$T$"HH=L$8QL$0QL$6QHL$XDD$HL L$L1蔺H IHH|$HHHmu HEHP0Imu IELP0iD$4H= 1HHH@xP@PÅH{HDLL|$Ll$詠uWH.7 H5 H8/LL|$LI/HmHEHE1P0H6 LH8|uHL$H=!yH1H5L|$菘LgvLL|$Ll$PH9 M8Ht$4LH=1.L|$'Ho< H5H81L|$IGLP0 fDAWAVAUIH=+ATUHHSHdH%(H$1әH5 1HL$HH5nHl$} LuMHEMH\$ZHmu HEHP0H|$LA1Ҿ/uIHH|$H1 HHtTHH膊AăuH|$H/Hmu=HEHAP01fDH=1wH5H|$H/uHGP0AH$dH+%(<HĸD[]A\A]A^A_fH(tHl$fD$(%=t0Hm2DH=vH5-[} xHH=SvH˨HHHI] ImM9H|$IwHW訣HHH|$IEG ‰ HO,@HWDHHDBH& H5H8诨ID$LP0ff.@AVAUATUSHHH5RH dH%(HD$1HT$HD$phHt$~ xHELHt$HL$HT$HHHH|$OHHHH5HIyiT$H|$u\HT$1HvHmIu HEHP0H|$MH\% H/HGP0@IHtSHKHsI/1H=ImIu IELP0MtLH=1#IHuSHmu HEHP0H|$Ht H/uHGP0E1HD$dH+%(umH L[]A\A]A^DHH5LFhImu IELP0uH|$DHt$H1H=ztH|$[ff.UHHH57H dH%(HD$1HT$@tTHt$HHL$HT$HHt5H(tHD$HT$dH+%(uH ]@H@P01迥ff.@UHHH5HdH%(HD$1H袃A1EtH4$11HHT$dH+%(uH]Mff.fH=PL˰ff.AUL-3RATLHnH=1QJ?/W?/~IHH 1H=H0蚥HkaHHtcHH5L(exLLH5qLHQ ex.HaHHtHH5LdyE1HLA\A]fAUH+ L-|HATUHLHlImH L%FLHGrmx^LfmxRLZmxFLH5HHqFt@H>HrHt HtHEHD1H9AWAVAUATUSHhL5?|$Ht$HT$dH%(HT$X1҉|$IG JffnIE f8=fA~GHtH@`HtHPHD$@tx yH=>L^HH@HD$@HD$@IG NfDL|$(L%=AGT$tH-{>HHT$H=Z>HHWHL$HTH4>H+HL$@Ld$HfoT$@H\$H1H;>H>vH=HT$XdH+%(Hh[]A\A]A^A_f.Ha LL$@1ҾL6H o HD$@H HD$H贊HHCH==HH5ǎZ9H=k=gH-_=yHHT$4 ˓H=<=HHD$Ld$HHD$@BHT$4LD$@ mH<Mg HcЉCBAxV4H@HXBMtfI<$I |IAD$L1I1LHHM9uI|M/HT$(H=R<HH@HD$(Ld$(M>HT$LD$@l%f.HD$@E11LH=4;Hl*H|$@H/wHGP0kHD$(H=T;@HH@L$L?;HD$@HHIHt$(LAE11HT$@H=X;lxHD$@HD$(As5Ht$@H=::Heff.@AUAIATUHSHHH>EtRHHUIMt2IH=:l1LHH=9x$_`HL[]A\A]ÐHHUI뫐;`H}LE1U HL[]A\A]AUIATUHSHHH?SIHt>H=x9Ht>ٛL9t H1認1LLMH=F9_HL[]A\A]蛛1LLH=9x_HL[]A\A]{_LH;E1S ff.fuH HHQHHH5 =蚁%=1舁H H0HVHHfAUIATIUH=HrHtHEH}LL]A\A]fH5 =LLH=1IL]A\A]fATIUHH=trHtHEH}HL]A\H5 =覀LH1d=~1I脀HL]A\fAUIATIUH=HqHtLLH]A\A]H5 =&LLH=1IL]A\A]ff.@AUATIUH=vqHtHEH}L]A\A]H5 =rLHA1\DI1I=k1tL]A\A]ff.AVAUIATIUHH=2pHt HEH}HL]LA\A]A^DH5q =qqLLHAƿDIH=1~HL]A\A]A^@AVAUIATIUHH==pHt HLLH]A\A]A^H5 =[f~pLLHADIG=/18~HL]A\A]A^fAVAUATUHtWIIjpH=5AfLLH=4AZ[DrGHD]A\A]A^AATUSH dH%(HD$6E1H541QU|FAă&H=R4H- I11H/ MLH H,$H\$M11L~H,$H e~H3H\$ԁH,$MH4H\$Ll H 1Ҿ蔁H=3Hm4H=?4HH=[1 HHu3HH=e3E1H=V3d3f3H=W3Vs IG3L1H5xV4HiCBH|H3HD$dH+%(H D[]A\fDL}H R1Ҿ 血@3PH2HGH H5AH8虆+HAjA_Hn H5wAH8Y>Hm H8襏*vff.ATH=>YHtI~:@1@IT$HHH9tA/uHHL]A\;Ht׃}.tHHL]A\f}/uH@AWMAVIAUIATUHSHHHDgLHKH}(LEM9HUHLEHHu0MD$`HK tyH~tH=E 16fAIDFAwDHH9}3HAuL  O Hu0HHK H9|@LE8HHs MLE@MHU1HH[]A\A]A^A_ÐMWAfAgU HC A>AfAGLEHHC MHs H;LLhT$`HMHs HHH= 1/DAIDFDHHH9~H0AuL   Hs HMfDHLMPLLjHD$hHpHD$pp'H H_Hu0LmHDHs L$PH;PHEHC Hw L$PLL$H?L$'HELL$HC L$Hs L$P$H;HU$HS H[]A\A]A^A_Hs H;LLHE@HC HD$XH;1IHHE8HC DH H55H8iH[]A\A]A^A_fDAHs HUHHS @IWDFfDLf.AHC ifAVILAUATUSHHdH%(HD$L|$@Ll$HHl$PLd$XL)L)ȅuI}HHHCHHsHC DE H{8HK@HCHCHC(A pA+-HC(AHT+S L49E1H0=IH9UuLMM)LKPHqHC0IHUL)H)HE=^<LSHsHfAn$fnMf8?fA~$Ht9IE@ @u<t<EA$9BA$IHCLHLHHT$dH+%(qH[]A\A]A^ÐHCH1HHsf.HHsLSHH L 1E1H@-A -HC(AEHAS @E1-}C -HAHC(bHI11HT$ 1R1AuAu#H HC0H fAn$H{8fnL$LC(f8?HK@fA~$L 8:HSHLSHcDHHLSHH)HHH HsL H0f.HSIHsHUUSHHHGH HWHuH[]fHj1H"*A1ExHtHC H@HDHCAUATUSHHHoHtvG;G tPSH[]A\A]DHcH RIIHIMLG HgHtmHCLJ< 1L)ZCD&NHCHt;HxC HHHǀxH)HHCD%;HcATAHUSH7H{pHcHfHCHtHcHЍJ D h[]A\H=(Kdff.AVAUATIHUHAHLHH?CHHtG".IHmtHL]A\A]A^fHEHP0HL]A\A]A^{3HuFLNAHIbIHt+HHLnx6I.uIFLP0u@Hmu HEHP0I[Hmu HEHP0I.uIFLIP0.fDUHSHHHvHt_trHsHtuH͋t]HsHtH賋tCHﾅTH[]fDHG0H5 Hx THHyDH1[]HE0H5 Hx ,HHxؾdHgTfDdHKTtHsH5AUATUHSH(dH%(HD$1Ll$uOHHt41Ҁ}0LHDHHD$D tHjHT$:uYHVHT$dH+%(H([]A\A]{XHy thHD$8t^fDAAJuf1LHHbf.}f(zuD$0L$HulfHnrgfD11HH?IqHH+5g7HHA(IHA H @7@$p HHqyJHPHPHBHBMHH+=7HAIHI@$x HHyquHI H 6HtHA(닿?@.H nAH=z6DD$ (H$H( =6DD$ HQ6D9AˍqEPE1L)K[H %2d %sbefore minimizingRename state %d to %d. after minimizinginput line too longObject is not writable.can't re-enter readlinecan't allocate lockisisOOOutf-8iso-8859-1utf-8-iso-latin-1iso-8859-1-iso-latin-1-encoding problem: %sencoding problem: %s with BOM>>|^&<<@//%<<=|=^=&=>>=-=@=//=+=%=**=BufferErrorBuffer error.Base class for lookup errors.IndexErrorSequence index out of range.TypeErrorInappropriate argument type.SystemErrorValueErrorUnicodeErrorUnicode related error.exception encodingexception objectexception startexception endexception reasonUnicodeDecodeErrorUnicode decoding error.exception msgexception linenoexception offsetexception textexception print_file_and_lineSyntaxErrorInvalid syntax.tb_nexttb_frametb_lastitb_lineno__dir__symbolsnestedsymtable entryzipfilterweakcallableproxy__bytes__weakproxy__callback____length_hint____setstate__str_iteratorjoincapitalizecasefoldrfindrindexswapcasestartswithendswithislowerisupperistitleisspaceisdecimalisdigitisnumericisalphaisalnumisidentifierisprintableformat_map__sizeof____getnewargs__tuple_iteratorellipsisstepindicesset_iterator__contains__copyintersectionisdisjointissubsetissupersetsymmetric_differenceunionfrozensetdiscardintersection_updatesymmetric_difference_updatelongrange_iterator__reversed__PyCapsuleNotImplementedTypetypes.SimpleNamespacemoduledef__doc____name____qualname____self____text_signature____module__objnbytesreadonlyitemsizendimshapestridessuboffsetsc_contiguousf_contiguoustobytestolistcast__enter____exit__managedbuffer__delitem____eq____iter____ne____repr____setitem__collections.OrderedDictodict_keysodict_valuesodict_itemsodict_iteratordict_valueiteratordict_keyiteratordict_itemiterator__getitem__extendreverselist_reverseiteratorlist_iteratorcallable_iterator__isabstractmethod____func__staticmethodclassmethod__code____defaults____kwdefaults____annotations____closure____globals__f_localsf_linenof_tracef_backf_codef_builtinsf_globalsf_lastirealimagconjugate__trunc____round__as_integer_ratiois_integer__getformat__True if the file is closedEncoding of the fileString giving the file modeflushfilenostderrprinteraiter_wrapperasync_generator_wrapped_valuename of the generatorgi_yieldfromgi_framegi_runninggi_codename of the coroutinecr_awaitcr_framecr_runningcr_codeasync_generator_asendasync_generator_athrowname of the async generatorag_awaitag_frameag_runningag_codeacloseasync_generatorreversedwrapper_descriptorgetset_descriptormember_descriptorclassmethod_descriptor__objclass__method-wrapperD.keys() -> list of D's keysfgetfdelsetterdeleterco_argcountco_kwonlyargcountco_nlocalsco_stacksizeco_flagsco_codeco_constsco_namesco_varnamesco_freevarsco_cellvarsco_nameco_firstlinenoco_lnotabinstancemethodcell_contentsbytes_iteratorbytearray_iterator__alloc____thisclass__the class invoking super()__self_class____class__the object's classhelper for pickle__subclasshook____init_subclass__default object formatternumeratordenominatorbit_length__floor____ceil____bases____abstractmethods____basicsize____itemsize____flags____weakrefoffset____base____dictoffset____mro__mro__subclasses____prepare__characters_writtenPOSIX exception codeexception strerrorfilename2second exception filenameNoneTypeOSErrorMemoryErrorOut of memory.RuntimeErrorUnspecified run-time error.__traceback____context__exception context__cause__exception cause__suppress_context__with_tracebackBaseExceptionArithmeticErrorOverflowErrorMSTARTRULERHS ALTITEMATOMbuiltin_function_or_methodENDMARKERNAMESTRINGNEWLINEINDENTDEDENTLPARRPARLSQBRSQBCOLONCOMMASEMIPLUSMINUSVBARAMPERLESSGREATERPERCENTLBRACERBRACEEQEQUALNOTEQUALLESSEQUALGREATEREQUALTILDECIRCUMFLEXLEFTSHIFTRIGHTSHIFTDOUBLESTARPLUSEQUALMINEQUALPERCENTEQUALAMPEREQUALVBAREQUALCIRCUMFLEXEQUALLEFTSHIFTEQUALRIGHTSHIFTEQUALDOUBLESTAREQUALDOUBLESLASHDOUBLESLASHEQUALATEQUALRARROWELLIPSISAWAITBAAA B8BAAAPBpBABABAAAAAAAAAAAABBCA0CAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@CAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA0BBBB@BBBBBBBBBBBBBB`BB BB.zfill(width) -> copy of B Pad a numeric string B with zeros on the left, to fill a field of the specified width. B is never truncated.B.upper() -> copy of B Return a copy of B with all ASCII characters converted to uppercase.B.title() -> copy of B Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.B.swapcase() -> copy of B Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.B.startswith(prefix[, start[, end]]) -> bool Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of bytes to try.B.rjust(width[, fillchar]) -> copy of B Return B right justified in a string of length width. Padding is done using the specified fill character (default is a space)B.rindex(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raise ValueError when the subsection is not found.B.rfind(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.lower() -> copy of B Return a copy of B with all ASCII characters converted to lowercase.B.ljust(width[, fillchar]) -> copy of B Return B left justified in a string of length width. Padding is done using the specified fill character (default is a space).B.isupper() -> bool Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B.istitle() -> bool Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.B.isspace() -> bool Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.B.islower() -> bool Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.B.isdigit() -> bool Return True if all characters in B are digits and there is at least one character in B, False otherwise.B.isalpha() -> bool Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.B.isalnum() -> bool Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.B.index(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the subsection is not found.B.find(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.expandtabs(tabsize=8) -> copy of B Return a copy of B where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.B.endswith(suffix[, start[, end]]) -> bool Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of bytes to try.B.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.center(width[, fillchar]) -> copy of B Return B centered in a string of length width. Padding is done using the specified fill character (default is a space).B.capitalize() -> copy of B Return a copy of B with only its first character capitalized (ASCII) and the rest lower-cased.8 !5 5555555555 5155555555555555555555555555 5 5555555555555555555555555555no mem to build parser accelerators XXX too high nonterminal number! no mem to add parser accelerators Can't translate NAME label '%s' Can't translate STRING label %s tok_backup: beginning of buffers_push: parser stack overflow Re-calculating FIRST set for '%s' ??? no mem for new sym in calcfirstsetno mem to resize sym in calcfirstsetno mem to resize dfa in adddfano mem to resize state in addstateno mem to resize arc list in addarcno mem to resize labellist in addlabelCompiling (meta-) parse tree into NFA grammar NFA '%s' has %d states; start %d, finish %d no mem for xx_state in makedfaError: nonterminal '%s' may produce empty. PyBuffer_FillInfo: view==NULL argument is obsoletenull argument to internal routineexpected a writable bytes-like objecta bytes-like object is required, not '%.100s'both destination and source must be bytes-like objectsdestination is too small to receive data from sourcebad operand type for unary -: '%.200s'bad operand type for unary +: '%.200s'bad operand type for unary ~: '%.200s'bad operand type for abs(): '%.200s'object of type '%.200s' has no len()'%.200s' object does not support indexing'%.200s' object does not support item assignmentNon-UTF-8 code starting with '\x%.2x' in file %U on line %i, but no encoding declared; see http://python.org/dev/peps/pep-0263/ for details%U: inconsistent use of tabs and spaces in indentation __length_hint__ must be an integer, not %.100s__length_hint__() should return >= 0Format specifier must be a string, not %.200sType %.100s doesn't define __format____format__ must return a str, not %.200sunsupported operand type(s) for %.100s: '%.100s' and '%.100s'. Did you mean "print(, file=)"?unsupported operand type(s) for %.100s: '%.100s' and '%.100s''%.200s' object can't be concatenated'%.200s' object cannot be interpreted as an integer__index__ returned non-int (type %.200s)__index__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.cannot fit '%.200s' into an index-sized integersequence index must be integer, not '%.200s''%.200s' object is not subscriptable'%.200s' object does not support item deletioncan't multiply sequence by non-int of type '%.200s'__trunc__ returned non-Integral (type %.200s)int() argument must be a string, a bytes-like object or a number, not '%.200s'%.50s.__float__ returned non-float (type %.50s)%.50s.__float__ returned non-float (type %.50s). The ability to return an instance of a strict subclass of float is deprecated, and may be removed in a future version of Python.PyNumber_ToBase: index not int'%.200s' object can't be repeated'%.200s' object is unsliceableBase class for warning categories.Base class for warnings about deprecated features.Internal error in the Python interpreter. Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.Inappropriate argument value (of correct type).__dir__() -> list specialized dir() implementationthe real part of a complex numberthe imaginary part of a complex numberReturn self, the complex conjugate of any float.Return the Integral closest to x between 0 and x.Return the Integral closest to x, rounding half toward even. When an argument is passed, work like built-in round(x, ndigits).Return True if the float is an integer.A wrapper object for __aiter__ bakwards compatibility.qualified name of the generatorobject being iterated by yield from, or Nonequalified name of the coroutineobject being awaited on, or NoneA wrapper object implementing __await__ for coroutines.qualified name of the async generatorD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.values() -> list of D's valuesD.items() -> list of D's (key, value) pairs, as 2-tuplesD.copy() -> a shallow copy of Dthe function (or other callable) implementing a methodthe instance to which a method is boundthe instance invoking super(); may be Nonethe type of the instance invoking super(); may be None__sizeof__() -> int size of object in memory, in bytes__dir__() -> list default dir() implementationobject() -- The most base typethe numerator of a rational number in lowest termsthe denominator of a rational number in lowest termsReturns self, the complex conjugate of any int.Truncating an Integral returns itself.Flooring an Integral returns itself.Ceiling of an Integral returns itself.Rounding an Integral returns itself. Rounding with an ndigits argument also returns an integer.Returns size in memory, in bytesmro() -> list return a type's method resolution order__subclasses__() -> list of immediate subclasses__prepare__() -> dict used to create the namespace for the class statement__instancecheck__() -> bool check if an object is an instance__subclasscheck__() -> bool check if a class is a subclass__dir__() -> list specialized __dir__ implementation for types__sizeof__() -> int return memory consumption of the type objectBase class for I/O related errors.Common base class for all exceptionsCommon base class for all non-exit exceptions.Base class for arithmetic errors.Result too large to be represented.'%.200s' object doesn't support item deletion'%.200s' object doesn't support slice assignment'%.200s' object doesn't support slice deletion%R returned NULL without setting an error%s returned NULL without setting an error%R returned a result with an error set%s returned a result with an error set'%.200s' object is not callable while calling a Python objectattribute of type '%.200s' is not callableisinstance() arg 2 must be a type or tuple of typesissubclass() arg 1 must be a classissubclass() arg 2 must be a class or tuple of classes'%.200s' object is not iterableiter() returned non-iterator of type '%.100s'argument of type '%.200s' is not iterablesequence.index(x): x not in sequencemaketrans arguments must have same length%s first arg must be bytes or a tuple of bytes, not %sbytearray_getbuffer: view==NULL argument is obsoleteNegative size passed to PyByteArray_FromStringAndSizesequence item %zd: expected a bytes-like object, %.80s foundsequence changed size during iterationExisting exports of data: object cannot be re-sizedcannot add more objects to bytearraycan't set bytearray slice from %.100stranslation table must be 256 characters longbytearray indices must be integers or slices, not %.200scan assign only bytes, buffers, or iterables of ints in range(0, 256)attempt to assign bytes of size %zd to extended slice of size %zdencoding or errors without sequence argumentstring argument without an encodingencoding or errors without a string argumentbytearray object is too large to make reprComparison between bytearray and stringdeallocated bytearray object has exported buffersBase class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.Signal the end from iterator.__next__(). in __instancecheck__ in __subclasscheck__o.keys() are not iterableo.items() are not iterableo.values() are not iterablecount exceeds C integer sizeindex exceeds C integer sizeTrueFalse|O:boolbyte must be in range(0, 256)y*y*:maketranssubsection not foundbytearray index out of rangeU:fromhex|i:__reduce_ex__(O(Ns)N)(O(y#)N)(O()N)y*y*|n:replacereplace bytes are too longreplace bytes is too longempty separator can't concat %.100s to %.100scan only join an iterablejoin() result is too longn|c:ljustn|c:rjustn|c:centern:zfillnO&:insertO&:append|n:poppop from empty bytearraypop index out of rangevalue not found in bytearray|Oss:bytearraynegative count|i:expandtabsresult too longbytearray(bstr() on a bytearray instanceBytesWarningkeependsmaxsplitdeletegenerator return valueStopIterationAttributeErrorAttribute not found.tabsize0123456789abcdef|i:splitlines|On:rsplit|On:splitO|O:translate2[p[[[[0[![K[K[![![K[  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?(y#)N(O)nN(N)GC object already trackedCell is emptybyte string is too longrepeated bytes are too longbyte string is too largey*:partitiony*:rpartitionexpected bytes, %.200s foundembedded null bytestr() on a bytes instance%ld%lu%zu%u%ia numberformat requires a mappingincomplete format key* wants intwidth too bigprec too bigincomplete format%c arg not in range(256)Trailing \ in stringstrictignoreinvalid escape sequence '\%c'|Oss:bytesN(ON)self must not be Nonefree PyMethodObjectgetattr/builddir/build/BUILD/Python-3.6.15/Objects/bytearrayobject.c/builddir/build/BUILD/Python-3.6.15/Objects/bytesobject.c/builddir/build/BUILD/Python-3.6.15/Objects/cellobject.c/builddir/build/BUILD/Python-3.6.15/Objects/classobject.cNegative size passed to PyBytes_FromStringAndSizebytes object is too large to make reprComparison between bytes and stringComparison between bytes and intbyte indices must be integers or slices, not %.200sfloat argument required, not %.200sPyBytes_FromFormatV(): %c format expects an integer in range [0; 255]not enough arguments for format string__bytes__ returned non-bytes (type %.200s)%%b requires a bytes-like object, or an object that implements __bytes__, not '%.100s'%%%c format: %s is required, not %.200s%c requires an integer in range(256) or a single byteunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during bytes formattinginvalid \x escape at position %ddecoding error; unknown error handling code: %.400snon-hexadecimal number found in fromhex() arg at position %zdbytes must be in range(0, 256)cannot convert '%.200s' object to byteserrors without a string argumentencoding without a string argumentfirst argument must be callableLPPPPPPPPPPjPPPPP@PPPPPPPPPPpPPlll</builddir/build/BUILD/Python-3.6.15/Objects/codeobject.ccan't take floor or mod of complex number.can't take floor of complex number.can't convert complex to float.__name__ is not a unicode object.__objclass__.__qualname__ is not a unicode object__traceback__ may not be deleted__traceback__ must be a traceback or None__context__ may not be deletedexception context must be None or derive from BaseExceptionexception cause must be None or derive from BaseException0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ_abcdefghijklmnopqrstuvwxyzname tuples must contain only strings, not '%.500s'%.200s attribute must be unicode%.200s attribute must be bytescode: argcount must not be negativecode: kwonlyargcount must not be negativecode: nlocals must not be negativedescriptor '%V' for '%s' objects doesn't apply to '%s' objectattribute '%V' of '%.100s' objects is not readabledescriptor '%V' for '%.100s' objects doesn't apply to '%.100s' objectattribute '%V' of '%.100s' objects is not writable__complex__ should return a complex object0.0 to a negative or complex powercomplex() arg is a malformed stringcomplex() can't take second arg if first is a stringcomplex() second arg can't be a stringcomplex() second argument must be a number, not '%.200s'float(r) didn't return a floatcomplex() first argument must be a string or a number, not '%.200s'descriptor '%V' for type '%s' needs either an object or a typedescriptor '%V' for type '%s' needs a type, not a '%s' as arg 2descriptor '%V' for type '%s' doesn't apply to type '%s'descriptor '%V' of '%.100s' object needs an argumentdescriptor '%V' requires a type but received a '%.100s'descriptor '%V' requires a subtype of '%.100s' but received '%.100sdescriptor '%V' requires a '%.100s' object but received a '%.100s'mappingproxy() argument must be a mapping, not %swrapper %s doesn't take keyword arguments'%.200s' object is not reversibleSecond argument to a division or modulo operation was zero.mappingproxy(%R)%s%Rcan't mod complex numbers.can't convert complex to int%S.%S__cause__ may not be deletedargs may not be deletednon-string found in code slotcode: varnames is too small[Errno %S] %S: %R -> %R[Errno %S] %S: %R[Errno %S] %S%.200s attribute not setiiiiiSO!O!O!UUiS|O!O!:codecan't delete attributecan't set attribute(%s%s%sj%scomplex division by zerocomplex modulocomplex exponentiationabsolute value too large(dd)O(OO)O(On)O(O)nO(())U:__format__|OO:complexN(OO)O:mappingproxyunreadable attributeOOOO|OOOO:propertyO|O:enumeratereversed()state is not a dictionary|$OO:ImportErrortuple index out of range%S (%U, line %ld)%S (%U)%S (line %ld)BlockingIOErrorI/O operation would block.ZeroDivisionErrordoc__complex__pVHVPV8V`V0V??O!O!nnO!su#nnssy#nnsO!OnnO!StopAsyncIterationGeneratorExitSystemExitKeyboardInterruptModuleNotFoundErrorEnvironmentErrorEOFErrorRecursionErrorNotImplementedErrorNameErrorUnboundLocalErrorIndentationErrorTabErrorKeyErrorUnicodeEncodeErrorUnicodeTranslateErrorAssertionErrorFloatingPointErrorReferenceErrorUserWarningPendingDeprecationWarningSyntaxWarningRuntimeWarningFutureWarningImportWarningUnicodeWarningResourceWarningConnectionErrorerrmap insertion problem.BrokenPipeErrorChildProcessErrorConnectionAbortedErrorConnectionRefusedErrorConnectionResetErrorFileExistsErrorFileNotFoundErrorIsADirectoryErrorNotADirectoryErrorInterruptedErrorPermissionErrorProcessLookupErrorTimeoutError%U (%s: %S) end=" "print exec writeobject with NULL filecoroutine already executinggenerator already executingisisssi(i)EOF when reading a linebackslashreplacefloat division by zerofloat modulo-0x0.0p+0-0x%sp%c%dfloat divmod()%s0%se%dexception messagemodule pathTimeout expired.Process not found.Not enough permissions.Interrupted by signal.File not found.File already exists.Connection reset.Connection refused.Connection aborted.Child process error.Broken pipe.Connection error.Assertion failed.Unicode translation error.Unicode encoding error.Mapping key not found.Improper indentation.Name not found globally.Recursion limit exceeded.Read beyond end of file.Module not found.Program interrupted by user.'%U' codec can't encode character '\x%02x' in position %zd: %U'%U' codec can't encode character '\u%04x' in position %zd: %U'%U' codec can't encode character '\U%08x' in position %zd: %U'%U' codec can't encode characters in position %zd-%zd: %U'%U' codec can't decode byte 0x%02x in position %zd: %U'%U' codec can't decode bytes in position %zd-%zd: %Ucan't translate character '\x%02x' in position %zd: %Ucan't translate character '\u%04x' in position %zd: %Ucan't translate character '\U%08x' in position %zd: %Ucan't translate characters in position %zd-%zd: %Uexceptions bootstrapping error.Module dictionary insertion problem.Cannot allocate map from errnos to OSError subclassesCould not preallocate MemoryError objectMissing parentheses in call to 'print'. Did you mean print(%U%s)?Missing parentheses in call to 'exec'__name__ must be set to a string object__qualname__ must be set to a string object__await__() returned a coroutine__await__() returned non-iterator of type '%.100s'object %.100s can't be used in 'await' expressioncannot create 'stderrprinter' instancesnull file for PyFile_WriteStringasync generator already executingcan't send non-None value to a just-started coroutinecan't send non-None value to a just-started generatorcan't send non-None value to a just-started async generatorcoroutine raised StopIterationgenerator raised StopIterationasync generator raised StopIterationcannot reuse already awaited coroutinegenerator '%.50S' raised StopIterationasync generator raised StopAsyncIterationcoroutine ignored GeneratorExitgenerator ignored GeneratorExitasync generator ignored GeneratorExitcoroutine '%.50S' was never awaitedthrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes or instances deriving from BaseException, not %s/builddir/build/BUILD/Python-3.6.15/Objects/fileobject.cobject.readline() returned non-stringfileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)could not convert string to float: %Rfloat() argument must be a string or a number, not '%.200s'must be real number, not %.50spow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative powerrounded value too large to representhexadecimal string too long to converthexadecimal value too large to represent as a floatinvalid hexadecimal floating-point stringcannot convert Infinity to integer ratiocannot convert NaN to integer ratioOperation only works on directories.Operation doesn't work on directories.Base class for warnings about resource usage.Base class for warnings about Unicode related problems, mostly related to conversion problems.Base class for warnings about probable mistakes in module importsBase class for warnings about constructs that will change semantically in the future.Base class for warnings about dubious runtime behavior.Base class for warnings about dubious syntax.Base class for warnings about features which will be deprecated in the future.Base class for warnings generated by user code.Weak ref proxy used after referent went away.Floating point operation failed.Improper mixture of spaces and tabs.Local name referenced but not bound to a value.Method or function hasn't been implemented yet.Import can't find module, or can't find name in module.Request to exit from the interpreter.Request that a generator exit.Signal the end from iterator.__anext__().p `  <0@C@?|O:float(d)XXX block stack overflowXXX block stack underflowfrexp() result out of rangedoubleunknownIEEE, little-endianIEEE, big-endianss:__setformat__free PyFloatObjectfree PyFrameObjectfree PyListObjectnon-tuple default argsnon-dict annotationsan integer is requiredO!O!|OOO:functionarg 5 (closure) must be tupleiter index too largeN(())O|O&O&:index%R is not in listnO:insertlist index out of range[...], can only assign an iterablepop from empty listlist.remove(x): x not in listargument must be iterable|O:list|Oi:sortlist modified during sortlineno must be an integerlineno out of rangetoo many digits in integermax_expmax_10_expmin_expmin_10_expDBL_DIG -- digitsmant_digepsilonradixroundsFLT_ROUNDS -- rounding modeargdefsclosure__builtins__sys.float_infofloat too large to pack with e formatfloat too large to pack with f formatfloat too large to pack with d formatcan't unpack IEEE 754 special value on non-IEEE platformcannot clear an executing frame__defaults__ must be set to a tuple object__kwdefaults__ must be set to a dict object__annotations__ must be set to a dict objectuninitialized staticmethod objectint has too many bits to express in a platform size_t__getformat__() argument must be string, not %.500s__getformat__() argument 1 must be 'double' or 'float'insane float_format or double_format__code__ must be set to a code object%U() requires a code object with %zd free vars, not %zd__setformat__() argument 1 must be 'double' or 'float'__setformat__() argument 2 must be 'unknown', 'IEEE, little-endian' or 'IEEE, big-endian'can only set %s format to 'unknown' or the detected platform value/builddir/build/BUILD/Python-3.6.15/Objects/frameobject.cco_varnames must be a tuple, not %s/builddir/build/BUILD/Python-3.6.15/Objects/funcobject.cnon-dict keyword only default argsexpected tuple for closure, got '%.100s'/builddir/build/BUILD/Python-3.6.15/Objects/listobject.clist assignment index out of range/builddir/build/BUILD/Python-3.6.15/Objects/longobject.cPython int too large to convert to C ssize_tcan't convert negative value to unsigned intPython int too large to convert to C unsigned longcan't convert negative value to size_tPython int too large to convert to C size_targ 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be None or tuple%U requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %suninitialized classmethod object/builddir/build/BUILD/Python-3.6.15/Objects/iterobject.ccannot add more objects to listcan only concatenate list (not "%.200s") to listmust use keyword argument for key functionlist indices must be integers or slices, not %.200smust assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zdan integer is required (got type %.200s)__int__ returned non-int (type %.200s)__int__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.can't jump from the 'call' trace event of a new framef_lineno can only be set by a trace functioncan only jump from a 'line' trace eventline %d comes before the current code blockline %d comes after the current code blockcan't jump from a yield statementcan't jump to 'except' line as there's no exceptioncan't jump into or out of a 'finally' blockcan't jump into the middle of a blockPython int too large to convert to C longPython int too large to convert to C intcannot convert float infinity to integercannot convert float NaN to integerbyte array too long to convert to intDBL_MAX -- maximum representable finite floatDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representableDBL_MAX_10_EXP -- maximum int e such that 10**e is representableDBL_MIN -- Minimum positive normalized floatDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalizedDBL_MANT_DIG -- mantissa digitsDBL_EPSILON -- Difference between 1 and the next representable floatFLT_RADIX -- radix of exponent]]]]]]@`AApA>p>0>P?can't convert negative int to unsignedhuge integer: number of bits overflows a Py_ssize_tint too large to convert to floatint() arg 2 must be >= 2 and <= 36int string too large to convertinvalid literal for int() with base %d: %.200Rinteger division or modulo by zeropow() 2nd argument cannot be negative when 3rd argument specifiedpow() 3rd argument cannot be 0intermediate overflow during divisioninteger division result too large for a floatnon-integer arguments in divisionint() base must be >= 2 and <= 36, or 0int() can't convert non-string with explicit base'signed' is a keyword-only argumentbyteorder must be either 'little' or 'big'length argument must be non-negativesize in bytes of the C type used to represent a digitint too big to convertint too large to formatnegative shift count|OO:intint() missing string argumentnU|O:to_byteslittleOU|O:from_bytesfree PyDictObjectbits_per_digitsize of a digit in bitssizeof_digitsys.int_infobyteordersignedbaseP` p8@A<?P ^4@C%X?/builddir/build/BUILD/Python-3.6.15/Objects/dictobject.ccannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is requireddictionary changed size during iterationmemoryview assignment: lvalue and rvalue have different structuresoperation forbidden on released memoryview object%s() requires a dict argument, not '%s'Not enough memory to allocate new values arraypopitem(): dictionary is emptyneed more than 0 values to unpackneed more than 1 value to unpacktoo many values to unpack (expected 2)OrderedDict mutated during iterationOrderedDict changed size during iterationupdate() takes at most 1 positional argument (%d given)expected at most 1 arguments, got %dmemoryview has %zd exported buffer%s_memory_release(): negative export countPyBuffer_ToContiguous: len != view->lenmemoryview: number of dimensions must not exceed 64PyMemoryView_FromBuffer(): info->buf must not be NULLmemoryview: a bytes-like object is required, not '%.200s'underlying buffer is not writablewritable contiguous buffer requested for a non-contiguous object.{...}dict mutated during update%s(%R)This object has no __dict__O|O:fromkeysO|p:move_to_end%s()O|O:pop|p:popitemdictionary is emptyO|O:setdefaultO:memoryviewlast__missing__rrsub-views are not implementedmemoryview: invalid slice keycannot delete memorydeallocating Nonedeallocating NotImplementedNoneType takes no argumentsN(Os)free PyCFunctionObjectCan't initialize object typeCan't initialize type typeCan't initialize weakref typeCan't initialize int typeCan't initialize bool typeCan't initialize 'str'Can't initialize list typeCan't initialize None typeCan't initialize super typeCan't initialize range typeCan't initialize dict typeCan't initialize set typeCan't initialize str typeCan't initialize slice typeCan't initialize complex typeCan't initialize float typeCan't initialize tuple typeCan't initialize StdPrinterCan't initialize code typeCan't initialize frame typeCan't initialize method typeCan't initialize wrapper typeCan't initialize capsule typeCan't initialize cell typeU|O:module.__init__nameless modulemodule filename missing# clear[1] %s # clear[2] %s # destroy %S _module_repr in comparison<%s object at %p> object : structStructunpack_from%S.%sassign tomodule has no attribute '%U'namespace%s(...)%s(%S)didn't expect a NULL pointerbad trailing pad bytebad leading pad byte at p-%d: 0x%02x *** OUCH at tail+%d: 0x%02x Data at p: %02x ...FORBIDDENBYTE, as expected. API '%c' closefdreadalltellseekable_dealloc_warn__getstate___io.FileIOTrue if the file is closed.writelinesgetbuffergetvalue_io.BytesIOPy_Repr==!=__file____spec____loader____package__memoryview: underlying buffer is not writablememoryview: underlying buffer is not C-contiguousmemoryview: underlying buffer is not Fortran contiguousmemoryview: underlying buffer is not contiguousmemoryview: underlying buffer requires suboffsetsmemoryview: cannot cast to unsigned bytes if the format flag is presentindex out of bounds on dimension %d__dict__ must be set to a dictionary, not a '%.200s'memoryview: format argument must be a stringmemoryview: casts are restricted to C-contiguous viewsshape must be a list or a tuplememoryview: cast must be 1D -> ND or ND -> 1Dmemoryview: destination format must be a native single character format prefixed with an optional '@'memoryview: cannot cast between two non-byte formatsmemoryview: length is not a multiple of itemsizememoryview.cast(): elements of shape must be integersmemoryview.cast(): elements of shape must be integers > 0memoryview.cast(): product(shape) > SSIZE_MAXmemoryview: product(shape) * itemsize != buffer sizememoryview: cannot cast view with zeros in shape or stridesmemoryview: format %s not supportedmemoryview: unsupported format %sinvalid indexing of 0-dim memorymulti-dimensional sub-views are not implementedmemoryview: invalid type for format '%s'memoryview: invalid value for format '%s'cannot index %zd-dimension view with %zd-element tuplemulti-dimensional slicing is not implementedcannot modify read-only memorymemoryview slice assignments are currently restricted to ndim = 1PyObject_CallFinalizerFromDealloc called on object with a non-zero refcount/builddir/build/BUILD/Python-3.6.15/Objects/methodobject.cNotImplementedType takes no arguments%.200s() takes no keyword arguments%.200s() takes no arguments (%zd given)%.200s() takes exactly one argument (%zd given)Bad call flags in PyCFunction_Call. METH_OLDARGS is no longer supported!/builddir/build/BUILD/Python-3.6.15/Objects/moduleobject.ccannot hash writable memoryview objectmemoryview: hashing is restricted to formats 'B', 'b' or 'c'Can't initialize callable weakref proxy typeCan't initialize weakref proxy typeCan't initialize bytearray typeCan't initialize NotImplemented typeCan't initialize traceback typeCan't initialize dict keys typeCan't initialize dict values typeCan't initialize dict items typeCan't initialize OrderedDict typeCan't initialize odict_keys typeCan't initialize odict_items typeCan't initialize odict_values typeCan't initialize odict_keyiterator typeCan't initialize static method typeCan't initialize frozenset typeCan't initialize property typeCan't initialize managed buffer typeCan't initialize memoryview typeCan't initialize enumerate typeCan't initialize reversed typeCan't initialize builtin function typeCan't initialize function typeCan't initialize dict proxy typeCan't initialize generator typeCan't initialize get-set descriptor typeCan't initialize method wrapper typeCan't initialize ellipsis typeCan't initialize member descriptor typeCan't initialize namespace typeCan't initialize long range iterator typeCan't initialize instance method typeCan't initialize class method descr typeCan't initialize method descr typeCan't initialize call iter typeCan't initialize sequence iterator typeCan't initialize coroutine typeCan't initialize coroutine wrapper typeattribute name must be string, not '%.200s''%.50s' object has no attribute '%U'execution of module %s failed without setting an exceptionexecution of module %s raised unreported exceptionmodule %s initialized with unknown slot %ino positional arguments expected/builddir/build/BUILD/Python-3.6.15/Objects/object.c'%s' not supported between instances of '%.100s' and '%.100s'memoryview: internal error in richcompare while getting the repr of an object__repr__ returned non-string (type %.200s) while getting the str of an object__str__ returned non-string (type %.200s)str() or repr() returned '%.100s' type : %s refcount: %ld address : %p .__class__.__qualname__ is not a unicode object%.200s.__dict__ is not a dictionary'%.100s' object has no attributes (%s .%U)'%.100s' object has only read-only attributes (%s .%U)module functions cannot set METH_CLASS or METH_STATICPython import machinery not initializedPython C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.module %s: PyModule_Create is incompatible with m_slotsmodule %s: m_size may not be negative for multi-phase initializationmodule %s has multiple create slotsmodule %s uses unknown slot ID %icreation of module %s failed without setting an exceptioncreation of module %s raised unreported exceptionmodule %s is not a module object, but requests module statemodule %s specifies execution slots, but did not create a ModuleType instancemodule '%U' has no attribute '%U''%.100s' object has no attribute '%U''%.50s' object attribute '%U' is read-onlydir(): expected keys() of locals to be a list, not '%.200s'object does not provide __dir__Python memory allocator called without holding the GILbad ID: Allocated using API '%c', verified using API '%c' %zu bytes originally requested The %d pad bytes at p-%d are Because memory is corrupted at the start, the count of bytes requested may be bogus, and checking the trailing pad bytes may segfault. The %d pad bytes at tail=%p are The block was made by call #%zu to debug malloc/realloc. not all FORBIDDENBYTE (0x%02x): Debug memory block at address p=%p:True if the file descriptor will be closed by close().ݡ!Уd.ݢ¢Iwwdwdwwdd44t444444444ħ4444444444444444ԧ44$44,4444D0000X((Hh ̰ܰld\L<PPPPPPP(@PPPPPPPPPPPPPPPPPPP P@P(@PPPPPTTTTT %d %ss * %zd bytes each%48s %5u %6u %11zu %15zu %13zu # times object malloc called# arenas allocated total# arenas reclaimed# arenas highwater mark# arenas allocated current%zu arenas * %d bytes/arena# bytes in allocated blocks# bytes in available blocks%u unused pools * %d bytes# bytes lost to pool headers# bytes lost to quantizationTotalfree %d-sized PyTupleObjectpop from an empty setslice(%R, %R, %R)slice step cannot be zero%R is not in rangerange(%R, %R)range(%R, %R, %R)(O(OOO))length should not be negative(NNN)O(OOO)N(N)iN(N)Orange_iterator()%s({%U}){%U}deallocating frozenset()range()EllipsisO|O:structseq(O(OO)) typeunnamed fieldn_unnamed_fieldsn_sequence_fieldsn_fieldsSmall block threshold = %d, in %u size classes. class size num pools blocks in use avail blocks ----- ---- --------- ------------- ------------ # bytes lost to arena alignmentPyCapsule_New called with null pointerPyCapsule_GetPointer called with invalid PyCapsule objectPyCapsule_GetPointer called with incorrect namePyCapsule_GetName called with invalid PyCapsule objectPyCapsule_GetDestructor called with invalid PyCapsule objectPyCapsule_GetContext called with invalid PyCapsule objectPyCapsule_SetPointer called with null pointerPyCapsule_SetPointer called with invalid PyCapsule objectPyCapsule_SetName called with invalid PyCapsule objectPyCapsule_SetDestructor called with invalid PyCapsule objectPyCapsule_SetContext called with invalid PyCapsule objectSet changed size during iterationPyCapsule_Import could not import module "%s"PyCapsule_Import "%s" is not validrange too large to represent as a range_iteratorslice indices must be integers or None or have an __index__ methodrange object index out of rangerange indices must be integers or slices, not %.200srange_iterator(): creating instances of range_iterator by calling range_iterator type is deprecatedlll;range_iterator() requires 3 int argumentsrange_iterator() arg 3 must not be zeroEllipsisType takes no arguments/builddir/build/BUILD/Python-3.6.15/Objects/setobject.c/builddir/build/BUILD/Python-3.6.15/Objects/tupleobject.crange() arg 3 must not be zerotuple assignment index out of rangeconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given)In structseq_repr(), member %d name is NULL for type %.500s+`@Jn_unnamed_fieldsn_fieldsn_sequence_fields) -- ,)can't set %s.%scan't delete %s.%s|O:tuple<%U.%U object at %p>bases must be typesduplicate base class %Uduplicate base classobject() takes no parameterstype() takes 1 or 3 argumentsUO!O!:type.__new____slots__ must be identifiers__weakref__invalid slot offsetcan't pickle %.200s objects|i:__reduce__newlinesdetach_io._TextIOBase_io._BufferedIOBase_io._RawIOBase_CHUNK_SIZEline_bufferingreset_io.IncrementalNewlineDecoder_io.BufferedRWPairraw_io.BufferedRandom_io.BufferedWriter_io.BufferedReader_checkClosed_checkSeekable_checkReadable_checkWritable_io._IOBase__getnewargs_ex___slotnames__slotnames____newobj_ex____newobj__copyreg__set_name____classcell____slots____getattribute____getattr____setattr____delattr____hash____str____lt____le____gt____ge____next____get____set____delete____del____await____aiter____anext____add____radd____sub____rsub____mul____rmul____mod____rmod____divmod____rdivmod____pow____rpow____neg____neg__($self, /) -- -self__pos____pos__($self, /) -- +self__abs____bool____invert____lshift____rlshift____rshift____rrshift____and____rand____xor____rxor____or____ror____int____float____iadd____isub____imul____imod____ipow____ilshift____irshift____iand____ixor____ior____floordiv____rfloordiv____truediv____rtruediv____ifloordiv____itruediv____index____matmul____rmatmul____imatmul____len__This object has no __weakref__metaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its bases/builddir/build/BUILD/Python-3.6.15/Objects/typeobject.ccan only concatenate tuple (not "%.200s") to tuplecan only assign string to %s.__qualname__, not '%s'%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'can't delete __class__ attribute__class__ must be set to a class, not '%s' object__class__ assignment only supported for heap types or ModuleType subclassestuple.index(x): x not in tupletuple indices must be integers or slices, not %.200stype_traverse() called for non-heap type '%.100s'can only assign string to %s.__name__, not '%s'type name must not contain null characterstype.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 argumentsobject.__init__() takes no parameterscannot create '%.100s' instancesCannot create a consistent method resolution order (MRO) for basestype '%.100s' is not an acceptable base typemultiple bases have instance lay-out conflictCannot extend an incomplete type '%.100s'Can't instantiate abstract class %s with abstract methods %Umro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')can only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of classes, not '%s'a __bases__ item causes an inheritance cyclethis __dict__ descriptor does not support '%.200s' objectstype object '%.50s' has no attribute '%U'nonempty __slots__ not supported for subtype of '%s'__slots__ items must be strings, not '%.200s'__dict__ slot disallowed: we already got one__weakref__ slot disallowed: either we already got one, or __itemsize__ != 0%R in __slots__ conflicts with class variabletype __qualname__ must be a str, not %s__classcell__ must be a nonlocal cell, not %.200RError calling __set_name__ on '%.100s' instance %R in '%.100s'Type spec does not define the name field.builtin type %.200s has no __module__ attributecan't set attributes of built-in/extension type '%s'Out of memory interning an attribute name__getnewargs_ex__ should return a tuple, not '%.200s'__getnewargs_ex__ should return a tuple of length 2, not %zdsecond item of the tuple returned by __getnewargs_ex__ must be a dict, not '%.200s'__getnewargs__ should return a tuple, not '%.200s'%.200s.__slotnames__ should be a list or None, not %.200scopyreg._slotnames didn't return a list or None__slotsname__ changed size during iterationfirst item of the tuple returned by __getnewargs_ex__ must be a tuple, not '%.200s'unsupported format string passed to %.200s.__format__dictionary for instance variables (if defined)list of weak references to the object (if defined)__repr__($self, /) -- Return repr(self).__hash__($self, /) -- Return hash(self).__call__($self, /, *args, **kwargs) -- Call self as a function.__str__($self, /) -- Return str(self).__getattribute__($self, name, /) -- Return getattr(self, name).__setattr__($self, name, value, /) -- Implement setattr(self, name, value).__delattr__($self, name, /) -- Implement delattr(self, name).__lt__($self, value, /) -- Return selfvalue.__ge__($self, value, /) -- Return self>=value.__iter__($self, /) -- Implement iter(self).__next__($self, /) -- Implement next(self).__get__($self, instance, owner, /) -- Return an attribute of instance, which is of type owner.__set__($self, instance, value, /) -- Set an attribute of instance to value.__delete__($self, instance, /) -- Delete an attribute of instance.__init__($self, /, *args, **kwargs) -- Initialize self. See help(type(self)) for accurate signature.__new__(type, /, *args, **kwargs) -- Create and return new object. See help(type) for accurate signature.__await__($self, /) -- Return an iterator to be used in await expression.__aiter__($self, /) -- Return an awaitable, that resolves in asynchronous iterator.__anext__($self, /) -- Return a value or raise StopAsyncIteration.__add__($self, value, /) -- Return self+value.__radd__($self, value, /) -- Return value+self.__sub__($self, value, /) -- Return self-value.__rsub__($self, value, /) -- Return value-self.__mul__($self, value, /) -- Return self*value.__rmul__($self, value, /) -- Return value*self.__mod__($self, value, /) -- Return self%value.__rmod__($self, value, /) -- Return value%self.__divmod__($self, value, /) -- Return divmod(self, value).__rdivmod__($self, value, /) -- Return divmod(value, self).__pow__($self, value, mod=None, /) -- Return pow(self, value, mod).__rpow__($self, value, mod=None, /) -- Return pow(value, self, mod).__abs__($self, /) -- abs(self)__bool__($self, /) -- self != 0__invert__($self, /) -- ~self__lshift__($self, value, /) -- Return self<>value.__rrshift__($self, value, /) -- Return value>>self.__and__($self, value, /) -- Return self&value.__rand__($self, value, /) -- Return value&self.__xor__($self, value, /) -- Return self^value.__rxor__($self, value, /) -- Return value^self.__or__($self, value, /) -- Return self|value.__ror__($self, value, /) -- Return value|self.__int__($self, /) -- int(self)__float__($self, /) -- float(self)__iadd__($self, value, /) -- Return self+=value.__isub__($self, value, /) -- Return self-=value.__imul__($self, value, /) -- Return self*=value.__imod__($self, value, /) -- Return self%=value.__ipow__($self, value, /) -- Return self**=value.__ilshift__($self, value, /) -- Return self<<=value.__irshift__($self, value, /) -- Return self>>=value.__iand__($self, value, /) -- Return self&=value.__ixor__($self, value, /) -- Return self^=value.__ior__($self, value, /) -- Return self|=value.__floordiv__($self, value, /) -- Return self//value.__rfloordiv__($self, value, /) -- Return value//self.__truediv__($self, value, /) -- Return self/value.__rtruediv__($self, value, /) -- Return value/self.__ifloordiv__($self, value, /) -- Return self//=value.__itruediv__($self, value, /) -- Return self/=value.__index__($self, /) -- Return self converted to an integer, if self is suitable for use as an index into a list.__matmul__($self, value, /) -- Return self@value.__rmatmul__($self, value, /) -- Return value@self.__imatmul__($self, value, /) -- Return self@=value.__len__($self, /) -- Return len(self).__getitem__($self, key, /) -- Return self[key].__setitem__($self, key, value, /) -- Set self[key] to value.__delitem__($self, key, /) -- Delete self[key].__contains__($self, key, /) -- Return key in self.__iadd__($self, value, /) -- Implement self+=value.__imul__($self, value, /) -- Implement self*=value.ZNf6B8@xhP`XpH(  (0P0x@x(H8XH@wstrlegacy UCS2legacy asciilegacy latin1legacy UCS4(nO)surrogateescapesurrogatepassxmlcharrefreplace__len__() should return >= 0, NULL>|O!O:supersuper(): no current framesuper(): no code objectsuper(): no argumentssuper(): arg[0] deletedsuper(): bad __class__ cellsuper(): empty __class__ cell_reduce_exO|UU:maketrans&#%d;size must be positiveinvalid kindstring index out of rangehow_many cannot be negativePyArg_UnpackTuple() argument list is not a tupleexpected %d arguments, got %zd__get__(None, None) is invalid__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()'%.200s' object is not a container__bool__ should return bool, returned %s, <%s object>>super(type, obj): obj must be an instance or subtype of typeobject %.50s does not have __await__ methodobject %.50s does not have __aiter__ methodobject %.50s does not have __anext__ method__hash__ method should return an integer__init__() should return None, not '%.200s'super(): __class__ is not a type (%s)super(): __class__ cell not foundOut of memory interning slotdef namesdeletion of interned string failedImmortal interned string died.Inconsistent interned string state.first maketrans argument must be a string if there is a second argumentthe first two maketrans arguments must have equal lengthif you give only one argument to maketrans it must be a dictstring keys in translate table must be of length 1keys in translate table must be strings or integersencoded result is too long for a Python stringNegative size passed to _PyUnicode_Newinvalid maximum character passed to PyUnicode_NewNegative size passed to PyUnicode_Newcharacter U+%x is not in range [U+0000; U+10ffff]/builddir/build/BUILD/Python-3.6.15/Objects/unicodeobject.cCannot write %zi characters at %zi in a string of %zi charactersCannot modify a string currently usedCannot copy %s characters into a string of %s charactersNegative size passed to PyUnicode_FromStringAndSizeType does not define the tp_name field.method cannot be both class and statictype '%.100s' is not dynamically allocated but its base type '%.100s' is dynamically allocatedtype '%.100s' participates in gc and is a base type but has inappropriate tp_free slot__new__($type, *args, **kwargs) -- Create and return a new object. See help(type) for accurate signature.invalid widening attemptcharacter out of rangesy#nnOembedded null charactersOnnOutf-32-leutf-32-betruncated datautf-16-leutf-16-beunexpected end of dataillegal encodingillegal UTF-16 surrogateunexpected special characterutf7unterminated shift sequenceutf-32surrogates not allowedutf-16us_asciiiso_8859_1iso8859_1invalid start byteinvalid continuation byteprecision too big%llu%li%lli%zidecoding str is not supportedchr() arg not in range(0x110000)string is longer than the bufferCan't convert '%.100s' object to str implicitlyPyUnicode_AsDecodedObject() is deprecated; use PyCodec_Decode() to decode from strPyUnicode_AsDecodedUnicode() is deprecated; use PyCodec_Decode() to decode from str to str'%.400s' decoder returned '%.400s' instead of 'str'; use codecs.decode() to decode to arbitrary typesPyUnicode_AsEncodedObject() is deprecated; use PyUnicode_AsEncodedString() to encode from str to bytes or PyCodec_Encode() for generic encodingPyUnicode_AsEncodedUnicode() is deprecated; use PyCodec_Encode() to encode from str to str'%.400s' encoder returned '%.400s' instead of 'str'; use codecs.encode() to encode to arbitrary typesonly 'strict' and 'surrogateescape' error handlers are supported, not '%s'mbstowcs() encountered an invalid multibyte sequenceImpossible unicode object state, wstr and str should share memory already.wcstombs() encountered an unencodable wide characterO!n;decoding error handler must return (str, int) tupleexception attribute object must be bytesposition %zd from error handler out of boundscode point in surrogate code point range(0xd800, 0xe000)code point not in range(0x110000)partial character in shift sequencenon-zero padding bits in shift sequenceABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/encoder %s returned bytearray instead of bytes; use codecs.encode() to encode to arbitrary types'%.400s' encoder returned '%.400s' instead of 'bytes'; use codecs.encode() to encode to arbitrary typescharacter argument not in range(0x110000)PyUnicode_FromFormatV() expects an ASCII-encoded format string, got a non-ASCII byte: 0x%02xdecoding to str: need a bytes-like object, %.80s foundpath should be string, bytes, or os.PathLike, not %.200s&&h@8================F=U============truncated \UXXXXXXXX escapetruncated \xXX escapetruncated \uXXXX escape\ at end of stringillegal Unicode charactermalformed \N character escapeunicodedata.ucnhash_CAPI\Uxxxxxxxx out of rangerawunicodeescapetruncated inputunicode_internalsOnnsmust be str, not %.100sordinal not in range(256)ordinal not in range(128)character maps to charmapEncodingMapunknown Unicode character name\N escapes not supported (can't load unicodedata module)fill character is bigger than the string maximum characterillegal code point (> 0x10FFFF)unicode_internal codec has been deprecatedOn;encoding error handler must return (str/bytes, int) tuplecharacter mapping must be in range(0x%lx)character mapping must return integer, None or strcharacter mapping must be in range(256)character mapping must return integer, bytes or None, not %.400scharacter mapping must be in range(0x%x)O!n;translating error handler must return (str, int) tupleinvalid decimal Unicode stringseparator: expected str instance, %.80s foundsequence item %zd: expected str instance, %.80s foundjoin() result is too long for a Python stringReturn the size (in bytes) of this objectS'$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#%$#$#$#$#g&$#$#$#$#$#$#$#$#########$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#p%$#$#$#$#$#$#['$#$#$#$#$#$#+$$#$#$#$#$l$$#$#$#$$#$#$#$#$#$#$#/%$#$#$#%$#&&&'$#l' JKII;IK JHpadded string is too longreplace string is too longn|O&:centerThe fill character must be a unicode character, not %.100sThe fill character must be exactly one character longCan't compare %.100s and %.100s'in ' requires string as left operand, not %.100sstrings are too large to concatUU|n:replacesubstring not foundunexpected '{' in field nameunmatched '{' in format specnew string is too longn|O&:ljustrepeated string is too longn|O&:rjustidentifier not ready%s arg must be None or strMissing ']' in format stringMax string recursion exceededexpected str, got %sfieldnameiteratorformatteriterator|O:lstrip|O:rstrip|O:stripmust be str or None, not %.100sSingle '}' encountered in format stringSingle '{' encountered in format stringend of string while looking for conversion specifierexpected ':' after conversion specifierexpected '}' before end of stringtuple for startswith must only contain str, not %.100sstartswith first arg must be str or a tuple of str, not %.100stuple for endswith must only contain str, not %.100sendswith first arg must be str or a tuple of str, not %.100sstring is too long to generate reprToo many decimal digits in format stringOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringcannot switch from manual field specification to automatic field numberingcannot switch from automatic field numbering to manual field specificationFormat string contains positional fieldsUnknown conversion specifier %cUnknown conversion specifier \x%xstring indices must be integersstartswith`P@0 pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp"ppppppp`P@0 ppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp`P@0 pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp`P@0 pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp`P@0 pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp`P@0 wne\SP`ptDdTtDdT|l\L<, hHpXhHpXhHpX \|lL\|lLXHX8(XHX8(/A8& XHX8(;2) XHX8(;2) J\XSe@0 PPPPPP@0 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP@0 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP@0 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP@0 PPPPPP@0   6-$?  6-$?  6-$?000000000000000000000000000000000000000000000000000000000000000000000000000000 6-$? 000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000   xhXH8(y000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000y000000000000000000000000000000 000000000000000000000000000000000y000000000000000000000000000000000000000|sjaXOF=4+"cxofXCiLcHul~irببببببببببببUHXiHXiH~XccccXXXXXiHHHHH{ببببببببببببببببب^UبببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببcxofXCiLcHulببببببببببببببببببببببببببببببببببببXبببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببcXiبببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببببب^cxofLķ<\Lķ<\Lķ<\L<\L<\ķDT$4ddШ`pؤ4DTdTpػȻhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhpػȻhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhpػȻhhhhhhhhhhhhhhhhhhhhhhpػȻhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhpػȻP`СОlԜ|ԜԜԜԜԜԜ, ̵ܵ, ̵ܵ, ̵ܵ< \L<,|l44۶Ҷ44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444< \L<,|lɶ4444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444< \L<,|l44444444@ gCAC gFDF gIGI gLJL gOMO gRPR gUSU gXVX g[Y[ g^\^ ga_a gdbd ggeg gjhj gmkm gpnp gsqs gvtv gywy g}z  g  g  g0 g0 g  g  g  g  g  g  g  g(' '"' '$  !"#$%&'(()*+(,-./0.1234445567877779:;9:;9:;<=9:;>?@ABCDDEFGHIJKLMMNOPMQRSTUVTWXVYZ[\]]^]_``ab7cdeeeeeeeeefffffffeeffffffffffffeeeeeffgfh222ijkkklmmnopppqrsttuvwxxxyz{|}~@@@f77777777777777777777777777777777777777777777777777777777777777f7777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777ff77 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777fff7777777777777777777777fff777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 f777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777f 777777777777777777777777777777777777f 77777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777 7777777777777777777777777777777777777777777f77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777f7  77777777777777777777777777777777777f7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777  f777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777 777 777777777777777777777777777777ffffff7777777777eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee           !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFFGHIJKLMNNNNOPQRSTTUVW~XYZZ[\]^_``aabcedefghiecdefghieeeeeeeeeeeeexxxxxxxxxjxxxxxxkxlmxxjxxnx7777xxxoppppppppppppppppqqqqqqqqqqqqqqqqdefghidefghidefghirrrrrrrrrrrrrrrrrrrrrrrrrrsssssssssssssssssssssssssscdefghicdefghidefghidefghituvwxyz{|ee}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~77777777777777777777777777777777777777777777777777777777f7777777777777777777777777777777777777777777777777777777777777777777777777777777f7ffffff777777777777777777777777777777777777777777777777777777777777777777777777777777777777777ff7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777fff7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777f777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777ffffff777777777777f7777777777777777 777fee7777777777777777777777777777777777777777777777777777777777777777777777fffffffffef77ee7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777f 77777f777777777 777777777777777777777777777777777777777777777777777777777 7777777777777777f777777777777777777777777777777777777777777777777777777777777777777777f777777777777ff77777777777777777777777777777777eeee77777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777f777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777d7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777lllllllllllllllllllllllllllllllllllllllllllllllllllsssssssssssssssssssssssssssssssssssssssssssssssssssdefghi77777777777777777777777777777777777777777777777777777defghi 7777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777 77777777777777777777777777  777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777ffff 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777ffffffffffffff77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx     777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777ccdefghi7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777  !""#$%&'"""()*+,-./0123456789:;<=>?@@@ABC@@@@DE@@@@@@FGHIJKLM@NOPQRST@@UV""""""W"""""X""""""""""""""""""""""""""""""""""""YZ[\"""]"""^_"""""`"""a""""""""""bcd""""""ef""""""""g""""""""""""""h""""""""i""""e""""""""""""""""""""h""""""j""""""""""""""""kl"""""""""""""""""mn"""""""""""""""""op""""""""q""rstuvwxyz{|}"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""~"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""‘đ@ȑɑ@@@@ӑԑ"֑ؑݑ@@@@@@呑"""""""""""""""W""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""󑑑"""ssSSSsi0InNsSj J Ee5R5pqrstuvwxyz{|}~24>A!B"B"J*cbKJh1H1tTw W y Y aAa`ssPRTVBB           (!)"*#+$,%-&.'/ (!)"*#+$,%-&.'/`haibjckdlemfngo`haibjckdlemfngopEEBBBBBEtEEBBBBBEBBBBBBBB|EEBBBBBEpqrstuvwxyz{|}~ffFFFffiFIFiflFLFlffiFFIFfifflFFLFflstSTStstSTSttvDFDvteD5DetkD;Dk~vNFNvtmD=Dmweakly-referenced object no longer existsstring too large in _PyUnicode_FormatLong%%%c format: an integer is required, not %.200s%%%c format: a number is required, not %.200snot all arguments converted during string formattingCan't initialize encoding map typeCan't initialize field name iterator typeCan't initialize formatter iter typereleasing %zd interned strings total size of all interned strings: %zd/%zd mortal/immortal cannot create weak reference to '%s' objectsplit the argument as a field nameparse the argument as a format stringprecision too large%c arg not in range(0x110000)%c requires int or char|Oss:strCan't initialize 'unicode'Can't create empty stringcould not ready string :__call__weak object has gone awayref()posixpwd_sre_codecs_functools_operator_collectionsitertoolsatexit_signal_stat_locale_iozipimportfaulthandler_tracemalloc_symtablexxsubtypemarshal_imp_astsysgc_warnings_stringformatter_field_name_splitformatter_parserstring helper module࿚?UUUUUU??y??UUUUUU????UUUUUU?$I$I??qq?$@?Y@@@@j@.AחA _BmB&@UUUUUU?@(@*@@,@.@@1@!@2@3@UUUUUU??4@i@@@@jA5@^ A6@7@8@9@:@;@<@=@@??333333??333333??333333?>@r@p@L@OA?@@@@@A@A@B@B@C@C@@?D@y@@@@jAD@E@E@^AF@F@G@G@H@H@@?@?I@@@@j@A@N@@p@L@O"A@? @?Q@@X@@\%A @T@@@@@j(A"@@V@ @@@@w+A/builddir/build/BUILD/Python-3.6.15/Objects/weakrefobject.c'registry' must be a dict or None_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tupleaction must be a string, not '%.200s'_warnings.defaultaction must be a string, not '%.200s'warnings.onceregistry must be a dictUnrecognized action (%R) in warnings.filters: %Rwarnings._showwarnmsg() must be set to a callableunable to get warnings.WarningMessagecategory must be a Warning subclass, not '%s'%.400s constructor takes %s%zd positional argument%sAST identifier must be of type strfield body is required for Expressionfield name is required for FunctionDeffield args is required for FunctionDeffield name is required for AsyncFunctionDeffield args is required for AsyncFunctionDeffield name is required for ClassDeffield value is required for Assignfield target is required for AugAssignfield op is required for AugAssignfield value is required for AugAssignfield target is required for AnnAssignfield annotation is required for AnnAssignfield target is required for Forfield iter is required for Forfield target is required for AsyncForfield iter is required for AsyncForfield test is required for Whilefield test is required for Assertfield value is required for Exprfield op is required for BoolOpfield left is required for BinOpfield op is required for BinOpfield right is required for BinOpfield op is required for UnaryOpfield operand is required for UnaryOpfield args is required for Lambdafield body is required for Lambdafield test is required for IfExpfield body is required for IfExpfield orelse is required for IfExpfield elt is required for ListCompfield elt is required for SetCompfield key is required for DictCompfield value is required for DictCompfield elt is required for GeneratorExpfield value is required for Awaitfield value is required for YieldFromfield left is required for Comparefield func is required for Callfield value is required for FormattedValuefield value is required for NameConstantfield value is required for Constantfield value is required for Attributefield attr is required for Attributefield ctx is required for Attributefield value is required for Subscriptfield slice is required for Subscriptfield ctx is required for Subscriptfield value is required for Starredfield ctx is required for Starredfield ctx is required for Namefield ctx is required for Listfield ctx is required for Tuplefield value is required for Indexfield target is required for comprehensionfield iter is required for comprehensionfield value is required for keywordfield name is required for aliasfield context_expr is required for withitem_bootstraps(O){sOss}filtersalways_showwarnmsgonce:%d: lost sys.stderr WarningMessage__warningregistry____main__O|OnO:warnOOUi|OOOO:warn_explicitunknown action_onceregistry_defaultactioneither 0 or O()O()O_attributesModuleInteractiveExpressionSuiteAsyncFunctionDefClassDefReturnDeleteAugAssignAnnAssignAsyncForWhileAsyncWithRaiseTryAssertImportImportFromGlobalNonlocalExprPassBreakContinueBoolOpBinOpUnaryOpLambdaIfExpSetListCompSetCompDictCompGeneratorExpAwaitYieldYieldFromCompareCallFormattedValueJoinedStrNameConstantAttributeSubscriptStarredListTupleexpr_contextDelAugLoadAugStoreParamExtSliceIndexboolopMatMultModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertUAddUSubcmpopNotEqLtLtEGtGtEIsIsNotNotInexcepthandlerExceptHandleraliaswithitemfield test is required for Iffield n is required for Numfield s is required for Strfield s is required for Bytesfield id is required for Namefield arg is required for arg_filters_mutatedcontext_exproptional_varsasnamecol_offsetvarargkwonlyargskw_defaultskwargtargetifsis_asyncdimseltsctxconversionformat_specfunckeywordsopseltgeneratorsorelseoperandhandlersfinalbodyexcsimpletargetsbasesdecorator_listreturns_ast.ASTcategorymodule_globalsstacklevelunknown expr_context foundunknown operator foundunknown boolop foundunknown unaryop foundunknown cmpop foundinvalid integer value: %RPyCF_ONLY_ASTexpected %s node, got %.400sL\l|< 0@P`pxXHxXXxp(p5%ueUEJpP Php@@ required field "lineno" missing from stmtrequired field "lineno" missing from exprExtSlice field "dims" must be a list, not a %.200sExtSlice field "dims" changed size during iterationrequired field "dims" missing from ExtSlicerequired field "value" missing from Indexexpected some sort of slice, but got %Rrequired field "iter" missing from comprehensioncomprehension field "ifs" must be a list, not a %.200scomprehension field "ifs" changed size during iterationrequired field "ifs" missing from comprehensionrequired field "is_async" missing from comprehensionrequired field "target" missing from comprehensionrequired field "value" missing from keywordrequired field "name" missing from aliasrequired field "context_expr" missing from withitemModule field "body" must be a list, not a %.200sModule field "body" changed size during iterationrequired field "body" missing from ModuleInteractive field "body" must be a list, not a %.200sInteractive field "body" changed size during iterationrequired field "body" missing from Interactiverequired field "body" missing from ExpressionSuite field "body" must be a list, not a %.200sSuite field "body" changed size during iterationrequired field "body" missing from Suiteexpected some sort of mod, but got %Rexpected some sort of operator, but got %Rrequired field "col_offset" missing from exprexpected some sort of boolop, but got %Rrequired field "op" missing from BoolOpBoolOp field "values" must be a list, not a %.200sBoolOp field "values" changed size during iterationrequired field "values" missing from BoolOprequired field "left" missing from BinOprequired field "op" missing from BinOprequired field "right" missing from BinOpexpected some sort of unaryop, but got %Rrequired field "op" missing from UnaryOprequired field "operand" missing from UnaryOprequired field "args" missing from argumentsrequired field "args" missing from Lambdarequired field "body" missing from Lambdarequired field "test" missing from IfExprequired field "body" missing from IfExprequired field "orelse" missing from IfExpDict field "keys" must be a list, not a %.200sDict field "keys" changed size during iterationrequired field "keys" missing from DictDict field "values" must be a list, not a %.200sDict field "values" changed size during iterationrequired field "values" missing from DictSet field "elts" must be a list, not a %.200sSet field "elts" changed size during iterationrequired field "elts" missing from Setrequired field "elt" missing from ListCompListComp field "generators" must be a list, not a %.200sListComp field "generators" changed size during iterationrequired field "generators" missing from ListComprequired field "elt" missing from SetCompSetComp field "generators" must be a list, not a %.200sSetComp field "generators" changed size during iterationrequired field "generators" missing from SetComprequired field "key" missing from DictComprequired field "value" missing from DictCompDictComp field "generators" must be a list, not a %.200sDictComp field "generators" changed size during iterationrequired field "generators" missing from DictComprequired field "elt" missing from GeneratorExpGeneratorExp field "generators" must be a list, not a %.200sGeneratorExp field "generators" changed size during iterationrequired field "generators" missing from GeneratorExprequired field "value" missing from Awaitrequired field "value" missing from YieldFromrequired field "left" missing from CompareCompare field "ops" must be a list, not a %.200sexpected some sort of cmpop, but got %RCompare field "ops" changed size during iterationrequired field "ops" missing from CompareCompare field "comparators" must be a list, not a %.200sCompare field "comparators" changed size during iterationrequired field "comparators" missing from Comparerequired field "func" missing from CallCall field "args" must be a list, not a %.200sCall field "args" changed size during iterationrequired field "args" missing from CallCall field "keywords" must be a list, not a %.200sCall field "keywords" changed size during iterationrequired field "keywords" missing from Callrequired field "n" missing from NumAST string must be of type strrequired field "s" missing from Strrequired field "value" missing from FormattedValueJoinedStr field "values" must be a list, not a %.200sJoinedStr field "values" changed size during iterationrequired field "values" missing from JoinedStrAST bytes must be of type bytesrequired field "s" missing from BytesAST singleton must be True, False, or Nonerequired field "value" missing from NameConstantrequired field "value" missing from Constantrequired field "value" missing from Attributerequired field "attr" missing from Attributerequired field "ctx" missing from Attributerequired field "value" missing from Subscriptrequired field "slice" missing from Subscriptrequired field "ctx" missing from Subscriptrequired field "value" missing from Starredrequired field "ctx" missing from Starredrequired field "id" missing from Namerequired field "ctx" missing from NameList field "elts" must be a list, not a %.200sList field "elts" changed size during iterationrequired field "elts" missing from Listrequired field "ctx" missing from ListTuple field "elts" must be a list, not a %.200sTuple field "elts" changed size during iterationrequired field "elts" missing from Tuplerequired field "ctx" missing from Tupleexpected some sort of expr, but got %Rrequired field "lineno" missing from argrequired field "col_offset" missing from argarguments field "args" must be a list, not a %.200srequired field "arg" missing from argarguments field "args" changed size during iterationarguments field "kwonlyargs" must be a list, not a %.200sarguments field "kwonlyargs" changed size during iterationrequired field "kwonlyargs" missing from argumentsarguments field "kw_defaults" must be a list, not a %.200sarguments field "kw_defaults" changed size during iterationrequired field "kw_defaults" missing from argumentsarguments field "defaults" must be a list, not a %.200sarguments field "defaults" changed size during iterationrequired field "defaults" missing from argumentsrequired field "col_offset" missing from stmtrequired field "name" missing from FunctionDefrequired field "args" missing from FunctionDefFunctionDef field "body" must be a list, not a %.200sFunctionDef field "body" changed size during iterationrequired field "body" missing from FunctionDefFunctionDef field "decorator_list" must be a list, not a %.200sFunctionDef field "decorator_list" changed size during iterationrequired field "decorator_list" missing from FunctionDefrequired field "name" missing from AsyncFunctionDefrequired field "args" missing from AsyncFunctionDefAsyncFunctionDef field "body" must be a list, not a %.200sAsyncFunctionDef field "body" changed size during iterationrequired field "body" missing from AsyncFunctionDefAsyncFunctionDef field "decorator_list" must be a list, not a %.200sAsyncFunctionDef field "decorator_list" changed size during iterationrequired field "decorator_list" missing from AsyncFunctionDefrequired field "name" missing from ClassDefClassDef field "bases" must be a list, not a %.200sClassDef field "bases" changed size during iterationrequired field "bases" missing from ClassDefClassDef field "keywords" must be a list, not a %.200sClassDef field "keywords" changed size during iterationrequired field "keywords" missing from ClassDefClassDef field "body" must be a list, not a %.200sClassDef field "body" changed size during iterationrequired field "body" missing from ClassDefClassDef field "decorator_list" must be a list, not a %.200sClassDef field "decorator_list" changed size during iterationrequired field "decorator_list" missing from ClassDefDelete field "targets" must be a list, not a %.200sDelete field "targets" changed size during iterationrequired field "targets" missing from DeleteAssign field "targets" must be a list, not a %.200sAssign field "targets" changed size during iterationrequired field "targets" missing from Assignrequired field "value" missing from Assignrequired field "target" missing from AugAssignrequired field "op" missing from AugAssignrequired field "value" missing from AugAssignrequired field "target" missing from AnnAssignrequired field "annotation" missing from AnnAssignrequired field "simple" missing from AnnAssignrequired field "target" missing from Forrequired field "iter" missing from ForFor field "body" must be a list, not a %.200sFor field "body" changed size during iterationrequired field "body" missing from ForFor field "orelse" must be a list, not a %.200sFor field "orelse" changed size during iterationrequired field "orelse" missing from Forrequired field "target" missing from AsyncForrequired field "iter" missing from AsyncForAsyncFor field "body" must be a list, not a %.200sAsyncFor field "body" changed size during iterationrequired field "body" missing from AsyncForAsyncFor field "orelse" must be a list, not a %.200sAsyncFor field "orelse" changed size during iterationrequired field "orelse" missing from AsyncForrequired field "test" missing from WhileWhile field "body" must be a list, not a %.200sWhile field "body" changed size during iterationrequired field "body" missing from WhileWhile field "orelse" must be a list, not a %.200sWhile field "orelse" changed size during iterationrequired field "orelse" missing from Whilerequired field "test" missing from IfIf field "body" must be a list, not a %.200sIf field "body" changed size during iterationrequired field "body" missing from IfIf field "orelse" must be a list, not a %.200sIf field "orelse" changed size during iterationrequired field "orelse" missing from IfWith field "items" must be a list, not a %.200sWith field "items" changed size during iterationrequired field "items" missing from WithWith field "body" must be a list, not a %.200sWith field "body" changed size during iterationrequired field "body" missing from WithAsyncWith field "items" must be a list, not a %.200sAsyncWith field "items" changed size during iterationrequired field "items" missing from AsyncWithAsyncWith field "body" must be a list, not a %.200sAsyncWith field "body" changed size during iterationrequired field "body" missing from AsyncWithTry field "body" must be a list, not a %.200sTry field "body" changed size during iterationrequired field "body" missing from TryTry field "handlers" must be a list, not a %.200srequired field "lineno" missing from excepthandlerrequired field "col_offset" missing from excepthandlerExceptHandler field "body" must be a list, not a %.200sExceptHandler field "body" changed size during iterationrequired field "body" missing from ExceptHandlerexpected some sort of excepthandler, but got %RTry field "handlers" changed size during iterationrequired field "handlers" missing from TryTry field "orelse" must be a list, not a %.200sTry field "orelse" changed size during iterationrequired field "orelse" missing from TryTry field "finalbody" must be a list, not a %.200sTry field "finalbody" changed size during iterationrequired field "finalbody" missing from Tryrequired field "test" missing from AssertImport field "names" must be a list, not a %.200sImport field "names" changed size during iterationrequired field "names" missing from ImportImportFrom field "names" must be a list, not a %.200sImportFrom field "names" changed size during iterationrequired field "names" missing from ImportFromGlobal field "names" must be a list, not a %.200sGlobal field "names" changed size during iterationrequired field "names" missing from GlobalNonlocal field "names" must be a list, not a %.200sNonlocal field "names" changed size during iterationrequired field "names" missing from Nonlocalrequired field "value" missing from Exprexpected some sort of stmt, but got %Rexpression which can't be assigned to in %s contextexpression must have %s context but has %s insteadBoolOp with less than 2 valuesNone disallowed in expression listDict doesn't have the same number of keys as valuesCompare has a different number of comparators and operandsgot an invalid type in Constant: %scomprehension with no generatorsmore positional defaults than args on argumentslength of kwonlyargs is not the same as kw_defaults on argumentsAnnAssign with simple non-Name targetRaise with cause but no exceptionTry has neither except handlers nor finalbodyTry has orelse but no except handlersNone disallowed in statement listSuite is not valid in the CPython compiler(unknown)Compare with no comparatorsnon-numeric type in Numnon-string type in Strnon-bytes type in Bytesunexpected expressionempty %s on %sunknown slice nodeNegative ImportFrom levelunexpected statementimpossible module node`xثت+1ڰΰ°B LD,t \|ү-$_8zqh xh@Pи0p8punicodedatanormalize(OiiN)Non-statement found: %d %d__debug__assignment to keywordlambdafunction callgenerator expressionyield expressionawait expressionlist comprehensionset comprehensiondict comprehensionliteralconditional expressioncan't %s %sunexpected import name: %dinvalid escape sequence \%c\U%08xf-string: unterminated stringf-string: expecting '}'unicode errorvalue errorinvalid comp_op: %sinvalid comp_op: %s %sunhandled factor: %dstring to parse is too long(%s) %sunhandled atom %dunhandled expr: %d(%s) unknown errormore than 255 argumentskeyword argument repeatedunexpected nodeinvalid augassign: %sillegal target for annotationunexpected flow_stmt: %dfinallymalformed 'try' statementinvalid async stament: %sO|U:formati:chrcompile(): unrecognised flagsexecevalsinglestring, bytes or ASTdivmodglobals must be a dictlocals must be a mappingstring, bytes or codehasattrsetattrdelattrinput(): lost sys.stdininput(): lost sys.stdoutinput(): lost sys.stderrsumisinstanceissubclassU|OOOi:__import__filter()dont_inheritoptimizemetaclassOO&s|iii:compileNFKCunicodedata.normalize() must return a string, not %.200s'async' and 'await' will become reserved keywords in Python 3.7unexpected expression in assignment %d (line %d)f-string: single '}' is not allowedf-string: expressions nested too deeplyf-string expression part cannot include a backslashf-string expression part cannot include '#'f-string: mismatched '(', '{', or '['f-string: invalid conversion character: expected 's', 'r', or 'a'f-string: unexpected end of stringf-string: empty expression not allowedinvalid comp_op: has %d children/builddir/build/BUILD/Python-3.6.15/Python/ast.cbytes can only contain ASCII literal characters.cannot mix bytes and nonbytes literalsdict unpacking cannot be used in dict comprehensionlogic error in count_comp_forsiterable unpacking cannot be used in comprehensionGenerator expression must be parenthesized if not sole argumentpositional argument follows keyword argument unpackingpositional argument follows keyword argumentiterable argument unpacking follows keyword argument unpackinglambda cannot contain assignmentkeyword can't be an expressionnon-default argument follows default argumentnamed arguments must follow bare *unexpected node in varargslist: %d @ %dillegal expression for augmented assignmentonly single target (not list) can be annotatedonly single target (not tuple) can be annotatedassignment to yield expression not possibletrailing comma not allowed without surrounding parenthesesUnexpected node-type in from-importunknown import statement: starts with command '%s'improper number of parts to 'assert' statement: %dunhandled small_stmt: TYPE=%d NCH=%d unexpected token in 'if' statement: %swrong number of tokens for 'while' statement: %dwrong number of children for 'except' clause: %dinvalid node %d for PyAST_FromNodecompile(): invalid optimize valuecompile() mode must be 'exec', 'eval' or 'single'globals must be a real dict; try eval(expr, {}, mapping)eval must be given globals and locals when called without a framecode object passed to eval() may not contain free variablesglobals and locals cannot be NULLexec() globals must be a dict, not %.100slocals must be a mapping or None, not %.100scode object passed to exec() may not contain free variableshasattr(): attribute name must be stringsum() can't sum strings [use ''.join(seq) instead]sum() can't sum bytes [use b''.join(seq) instead]sum() can't sum bytearray [use b''.join(seq) instead]__build_class__: args is not a tuple__build_class__: not enough arguments__build_class__: func must be a function__build_class__: name is not a string%.200s.__prepare__() must return a mapping, not %.200s__class__ not set defining %.200R as %.200R. Was __classcell__ propagated to type.__new__?__class__ set to %.200R defining %.200R as %.200RP صxhXȸȸH8(ظظȸȸȸȸȸxXXDD$$\Tt`9X@X@ lalllllllllllllllllllllllllllllllll|4xPPP PPPPPPPPPPPP x k i __   |$OO%s() arg is an empty sequence|OOOO:printO|O:roundO|Oi:sortedzip()PyCOND_INIT(gil_cond) faileddrop_gil: GIL is not lockedtake_gil: NULL tstatePyCOND_WAIT(gil_cond) failedPyCOND_FINI(gil_cond) failedthreading__build_class__anybinhashoct_after_forkndigits%s() arg 1 must be a %s objectsource code string cannot contain null bytesgetattr(): attribute name must be stringmap() must have at least two arguments.'%.200s' object is not an iteratoriter(v, w): v must be callableCannot specify a default for %s() with multiple positional argumentsord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd foundsep must be None or a string, not %.200send must be None or a string, not %.200stype %.100s doesn't define __round__ methodvars() argument must have __dict__ attributezip argument #%zd must support iterationPyMUTEX_INIT(gil_mutex) failedPyMUTEX_INIT(switch_mutex) failedPyCOND_INIT(switch_cond) failed/builddir/build/BUILD/Python-3.6.15/Python/ceval_gil.hCannot recover from stack overflow.maximum recursion depth exceeded%sPyMUTEX_LOCK(gil_mutex) failedPyCOND_SIGNAL(gil_cond) failedPyMUTEX_UNLOCK(gil_mutex) failedPyMUTEX_LOCK(switch_mutex) failedPyCOND_WAIT(switch_cond) failedPyMUTEX_UNLOCK(switch_mutex) failedPyCOND_SIGNAL(switch_cond) failedPyEval_AcquireLock: current thread state is NULLPyMUTEX_FINI(gil_mutex) failedPyCOND_FINI(switch_cond) failedPyMUTEX_FINI(switch_mutex) failedPyEval_AcquireThread: NULL new thread statePyEval_AcquireThread: non-NULL old thread statePyEval_ReleaseThread: NULL thread statePyEval_ReleaseThread: wrong thread statePyEval_SaveThread: NULL tstatePyEval_RestoreThread: NULL tstateceval: tstate mix-upceval: orphan tstate__annotations__ not foundlost sys.displayhookbad RAISE_VARARGS oparg'finally' pops bad exception__build_class__ not foundno locals when deleting %Rname '%.200s' is not definedno locals when loading %R__import__ not found%U.%Ucannot import name %RXXX lineno: %d, opcode: %d unknown opcodePyEval_EvalFrameExpositionalkeyword-only%U and %U, %U, and %U__all____aenter____aexit__local variable '%.200s' referenced before assignmentno locals found when storing annotationNo active exception to reraisecalling %R should have returned an instance of BaseException, not %Rexceptions must derive from BaseExceptionexception causes must derive from BaseException'async for' requires an object with __aiter__ method, got %.100s'async for' received an invalid object from __aiter__: %.100s'%.100s' implements legacy __aiter__ protocol; __aiter__ should return an asynchronous iterator, not awaitable'async for' requires an iterator with __anext__ method, got %.100s'async for' received an invalid object from __anext__: %.100s'async with' received an object from __aenter__ that does not implement __await__: %.100s'async with' received an object from __aexit__ that does not implement __await__: %.100scoroutine is being awaited alreadypopped block is not an except handlerno locals found when storing %Rno locals found when setting up annotationsbad BUILD_CONST_KEY_MAP keys argument'%.200s' object is not a mapping%.200s%.200s argument after ** must be a mapping, not %.200s%.200s%.200s keywords must be strings%.200s%.200s got multiple values for keyword argument '%U'catching classes that do not inherit from BaseException is not allowedno locals found during 'import *'from-import-* object has no __dict__ and no __all__cannot 'yield from' a coroutine object in a non-coroutine generatorerror return without exception set%U() missing %i required %s argument%s: %U!fZ{qƒ!f!f!fčDo!f!f8!f،!fF6؉xy!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f'z3j!f!fkk!f٬b>Sqq rrksut!fuu`DTV :mn oSm4T,]ܠ\!!f$eIvvjww"xuy|ɡ>Ҝ-!f!fSgSgSg!f3pp(!f!f&!f{"||!f!f}}vĎN؏gh"g8iiUl}gūҫ008800P0888@Tt<?BA@  |}~789;CKLONM'continue' not supported inside 'finally' clause'continue' not properly in loopwaswere%U() keywords must be stringsfrom %zd to %zdframe does not existargument list must be a tuplecompile.c compiler unitcompiler_exit_scope()compiler_make_closure()'yield' outside function'await' outside function'return' outside functioninvalid subscript kind %d__future__'break' outside loopno symtablesuite should not be possible.PyEval_EvalCodeEx: NULL globals%U() got an unexpected keyword argument '%S'%U() got multiple values for argument '%S' positional argument%s (and %zd keyword-only argument%s)%U() takes %U positional argument%s but %zd%U %s givencoroutine wrapper %.200R attempted to recursively wrap %.200Rnot enough values to unpack (expected %d, got %d)not enough values to unpack (expected at least %d, got %d)too many values to unpack (expected %d)not enough values to unpack (expected at least %d, got %zd)keyword list must be a dictionaryfree variable '%.200s' referenced before assignment in enclosing scopeslice indices must be integers or have an __index__ method%.200s%.200s argument after * must be an iterable, not %.200sprivate identifier too large to be mangledunknown scope for %.100s in %.100s(%s) symbols: %s locals: %s globals: %slookup %s in %s %d %d freevars of %s: %s param invalid for deref variableparam invalid for local variableparam invalid for global variableparam invalid for name variableunary op %d should not be possible'yield from' inside async function'await' outside async functionUnrecognized conversion characterparam invalid in attribute expressionparam invalid in subscript expressionstarred assignment target must be in a list or tuplecan't use starred expression heretoo many expressions in star-unpacking assignmenttwo starred expressions in assignmenttoo many statically nested blocksasynchronous comprehension outside of an asynchronous function'return' with value in async generatorinplace binary op %d should not be possibleinvalid node type (%d) for augmented assignmentextended slice invalid in nested sliceinvalid node type (%d) for annotated assignmentassertion is always true, perhaps remove parentheses?from __future__ imports must occur at the beginning of the filemodule kind %d should not be possibledefault 'except:' must be lastUnmatched right paren in format stringUnmatched left paren in format stringdon't know how to handle %.200s in error callbackexception %R not a BaseException subclassOut of memory and PyExc_MemoryError is not initialized yetencoder must return a tuple (object, integer)decoder must return a tuple (object,integer)can't initialize codec error registrycan't initialize codec registryunknown error handler name '%.400s'codec must pass exception instancebad argument type for built-in operationno codec search functions registered: can't find encodingcodec search functions must return 4-tuplesexpected a subclass of ImportError%s:%d: bad argument to internal functionbad argument to internal functionPyErr_NewException: name must be module.class'%.400s' is not a text encoding; use %s to handle arbitrary codecsmaximum recursion depth exceeded while normalizing an exceptionCannot recover from MemoryErrors while normalizing exceptions.Cannot recover from the recursive normalization of an exception.Unable to decode the command line argument #%i future feature %.100s is not definedmust be %d-item sequence, not %.50smust be sequence of length %d, not %zdinteger argument expected, got floatunsigned byte integer is less than minimumunsigned byte integer is greater than maximumsigned short integer is less than minimumsigned short integer is greater than maximumsigned integer is greater than maximumsigned integer is less than minimum(unknown parser marker combination)encoded string too long (%zd, maximum length %zd)encoded string without null bytes(invalid use of 'w' format character)too many tuple nesting levels in argument format string%.200s%s takes at least one argumentold style getargs format uses new featuresnew style getargs format but argument is not a tuple%.150s%s takes %s %d argument%s (%ld given)%s%s takes at most %d argument%s (%zd given)Invalid format string (| specified twice)Invalid format string ($ before |)Invalid format string ($ specified twice)Function takes %s %d positional arguments (%d given)More keyword list entries (%d) than format specifiers (%d)Argument given by name ('%s') and position (%d)Required argument '%s' (pos %d) not foundmore argument specifiers than keyword list entries (remaining format:'%s')'%U' is an invalid keyword argument for this function/builddir/build/BUILD/Python-3.6.15/Python/getargs.ckeyword arguments must be stringsArgument given by name ('%U') and position (%d)Required argument '%U' (pos %d) not foundImplements the 'strict' error handling, which raises a UnicodeError on coding errors.Implements the 'ignore' error handling, which ignores malformed data and continues.Implements the 'replace' error handling, which replaces malformed data with a replacement marker.Implements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.Implements the 'backslashreplace' error handling, which replaces malformed data with a backslashed escape sequence.Implements the 'namereplace' error handling, which replaces an unencodable character with a \N{...} escape sequence.impossibleCP_UTF8RUNNING_ON_VALGRINDincrementaldecoderincrementalencoder(Nn)(Cn)unexpected slice kind%s with '%s' codec faileddecodinghandler must be callableencodingsargument must be callableunknown encoding: %sOs(iOOiO)(iOO)(iO)expected a message argumentsOOException ignored in: codecs.encode()codecs.decode()rb(OiiO)(zO)out of memory PYTHONINSPECTPYTHONUNBUFFEREDPython %s %s __main__ not frozennested_scopesdivisionabsolute_importwith_statementprint_functionunicode_literalsbarry_as_FLUFLgenerator_stopbracesnot a chanceread-only bytes-like objectcontiguous buffermust be %.50s, not %.50sstr or Nonestr, bytes or bytearrayis not retrievablea byte string of length 1a unicode charactersize does not fit in an int(unicode conversion error)(buffer is NULL)(AsCharBuffer failed)(encoding failed)(buffer_len is NULL)(unspecified)read-write bytes-like object(impossible)exactlyat leastat mostexcess ')' in getargs formatmissing ')' in getargs format%.200s%s takes no argumentsbad format string: %.200sEmpty keyword parameter nameEmpty parameter name after $%s: '%s'strict_errorsignore_errorsxmlcharrefreplace_errorsbackslashreplace_errorsnamereplacenamereplace_errors_is_text_encodinghdXdbbbbbbbbbbbbbbbbbbbbbbbbcccbbbccbccbbcH(oaCs((( ($(((((((((l(((((((HV#(}(`(c( (((l(p( [GCC 11.4.1 20230605 (Red Hat 11.4.1-2)]%s expected %s%zd arguments, got %zdunpacked tuple should have %s%zd elements, but has %zd%s does not take keyword arguments%s does not take positional argumentsNo such frozen object named %RPyImport_GetModuleDict: no module dictionary!Can't initialize import variablesinitializing sys.meta_path, sys.path_hooks, or path_importer_cache failedPyImport_ReInitLock failed to create a new lock/builddir/build/BUILD/Python-3.6.15/Python/import.cimport %U # previously loaded (%R) import: deleting existing key in sys.modules failedLoaded module %R not found in sys.modulesPyImport_ExecCodeModuleWithPathnames: no interpreter!__package__ != __spec__.parent__spec__.parent must be a stringcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__attempted relative import with no known parent packageattempted relative import beyond top-level package%R not in sys.modules as expectedobject too deeply nested to marshalread() returned too much data: %zd bytes requested, %zd returnedEOF read where object expectedbad marshal data (long size out of range)bad marshal data (unnormalized long data)bad marshal data (digit out of range in long)bad marshal data (bytes object size out of range)bad marshal data (string size out of range)bad marshal data (tuple size out of range)NULL object in marshal data for tuplebad marshal data (list size out of range)NULL object in marshal data for listbad marshal data (set size out of range)bad marshal data (index list too large)NULL object in marshal data for setbad marshal data (invalid reference)bad marshal data (unknown type code)XXX readobject called with exception set NULL object in marshal data for objectf.read() returned not bytes but %.100sExcluded frozen object named %Rfrozen object %R is not a code objectNULL object passed to Py_BuildValuebad format char passed to Py_BuildValue# can't import zipimport.zipimporter PyModule_AddObject() needs module as first argPyModule_AddObject() needs non-NULL valuedynamic module does not define module export function (%s_%s)initialization of %s failed without raising an exceptioninitialization of %s raised unreported exceptioninit function of %s returned uninitialized objectinitialization of * did not return PyModuleDefinitialization of %s did not return an extension module.cpython-36m-x86_64-linux-gnu.solinuxat least at most %.200s() argument %zd, item %d %.256sunmatched paren in format3.6.15%.80s (%.80s) %.80sO!U:_fix_co_filenameU:is_frozen_packageU:is_frozenU:is_builtinCan't backup builtins dictmeta_pathpath_importer_cachenot holding the import lock# clear builtins._ # clear sys.%s # restore sys.%s # cleanup[2] removing %U # cleanup[3] wiping %U # cleanup[3] wiping sys # cleanup[3] wiping builtins _bootstrap_external_RAW_MAGIC_NUMBEREmpty module namemodule name must be a stringlevel must be >= 0'__name__' not in globalspackage must be a string__name__ must be a string_call_with_frames_removedtoo many objectsutf8unmarshallable objectOO|i:dumpO|i:dumpsEOF read where not expectedmarshal data too shortrecursion limit exceededy*:loadsU:get_frozen_object__path__U:init_frozenUnmatched paren in formatBad dict format{OO}OOOOiunable to get sys.path_hooks# installing zipimport hook # can't import zipimport # installed zipimport hook initializing zipimport failedmodule '%s' has no __dict__PyInitPyInitUspec.name must be a stringpunycodeccorigincreate_dynamicextension_suffixeslock_heldacquire_lockrelease_lockcreate_builtinexec_dynamicexec_builtin_frozen_importlib_frozen_importlib_external__hello____phello____phello__.spamreloadparent_handle_fromlist_find_and_load_lock_unlock_module_initializing_fix_up_module_get_sourcefilecpython-36__stdin____stdout____stderr__ps1ps2last_typelast_valuelast_traceback__interactivehook__.abi3.soa_[[[[][c[[[[[[[[[[[[[[[[pc[[[[\[[\[[[[[[[[[\\[[[[[Pc^[[[[[ c[ b[[p_(\[pa[[`[[[[[a@_`chb[[](]bP^h(xhPPhh PІc@sdZd[Zd\ZeeZddZddZdd Zd d Zd d ZddZ ddZ ddZ ddZ d]ddZ ee jZdjdddZejedZdZdZdgZd gZeZZd^d!d"d#d$Zd%d&Zd'd(Zd)d*Zd+d,Z d-d.Z!d/d0Z"d_d1d2Z#d`d3d4Z$dad6d7Z%d8d9Z&e'Z(dbd!e(d:d;d<Z)Gd=d>d>Z*Gd?d@d@Z+GdAdBdBe+Z,GdCdDdDZ-GdEdFdFe-e,Z.GdGdHdHe-e+Z/gZ0GdIdJdJe-e+Z1GdKdLdLZ2GdMdNdNZ3GdOdPdPZ4GdQdRdRZ5dcdSdTZ6dUdVZ7dWdXZ8dYdZZ9d!S)da^Core implementation of path-based import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. wincygwindarwincs<tjjtr0tjjtrdndfdd}ndd}|S)NZ PYTHONCASEOKs PYTHONCASEOKcs tjkS)z5True if filenames must be checked case-insensitively.)_osZenviron)keyr& _relax_case%sz%_make_relax_case.._relax_casecSsdS)z5True if filenames must be checked case-insensitively.Frrrrrr)s)sysplatform startswith_CASE_INSENSITIVE_PLATFORMS#_CASE_INSENSITIVE_PLATFORMS_STR_KEY)rr)rr_make_relax_cases  r cCst|d@jddS)z*Convert a 32-bit integer to little-endian.llittle)intto_bytes)xrrr_w_long/srcCs tj|dS)z/Convert 4 bytes in little-endian to an integer.r)r from_bytes)Z int_bytesrrr_r_long4srcGstjdd|DS)zReplacement for os.path.join().cSsg|]}|r|jtqSr)rstrippath_separators).0partrrr ;sz_path_join..)path_sepjoin) path_partsrrr _path_join9s rcCs`ttdkr$|jt\}}}||fSx2t|D]&}|tkr.|j|dd\}}||fSq.Wd|fS)z Replacement for os.path.split().)Zmaxsplit)lenr rpartitionrreversedrsplit)pathZfront_tailrrrr _path_split?s  r(cCs tj|S)z~Stat the path. Made a separate function to make it easier to override in experiments (e.g. cache stat results). )rZstat)r%rrr _path_statKsr)c Cs0y t|}Wntk r dSX|jd@|kS)z1Test whether the path is the specified mode type.Fi)r)OSErrorst_mode)r%modeZ stat_inforrr_path_is_mode_typeUs  r-cCs t|dS)zReplacement for os.path.isfile.i)r-)r%rrr _path_isfile^sr.cCs|s tj}t|dS)zReplacement for os.path.isdir.i@)rgetcwdr-)r%rrr _path_isdircsr0cCsdj|t|}tj|tjtjBtjB|d@}y2tj|d}|j |WdQRXtj ||Wn:t k rytj |Wnt k rYnXYnXdS)zBest-effort function to write data to a path atomically. Be prepared to handle a FileExistsError if concurrent writing of the temporary file is attempted.z{}.{}iZwbN) formatidrZopenZO_EXCLZO_CREATZO_WRONLY_ioFileIOwritereplacer*Zunlink)r%datar,Zpath_tmpZfdfilerrr _write_atomicjsr:i3 rs Z __pycache__zopt-z.pyz.pycN) optimizationc Cs|dk r4tjdt|dk r(d}t||r0dnd}tj|}t|\}}|jd\}}}tj j } | dkrrt ddj |r~|n||| g} |dkrtj jdkrd}ntj j}t|}|dkr|jstd j|d j| t|} t|t| tdS) aGiven the path to a .py file, return the path to its .pyc file. The .py file does not need to exist; this simply returns the path to the .pyc file calculated as if the .py file were imported. The 'optimization' parameter controls the presumed optimization level of the bytecode file. If 'optimization' is not None, the string representation of the argument is taken and verified to be alphanumeric (else ValueError is raised). The debug_override parameter is deprecated. If debug_override is not None, a True value is the same as setting 'optimization' to the empty string while a False value is equivalent to setting 'optimization' to '1'. If sys.implementation.cache_tag is None then NotImplementedError is raised. NzFthe debug_override parameter is deprecated; use 'optimization' insteadz2debug_override or optimization must be set to Noner r.z$sys.implementation.cache_tag is Nonez{!r} is not alphanumericz{}.{}{}) _warningswarnDeprecationWarning TypeErrorrfspathr(r"rimplementation cache_tagNotImplementedErrorrflagsoptimizestrisalnum ValueErrorr2_OPTr_PYCACHEBYTECODE_SUFFIXES) r%Zdebug_overrider<messageheadr'ZbaseseprestZtagZalmost_filenamerrrcache_from_sources0    rScCstjjdkrtdtj|}t|\}}t|\}}|tkrNtdj t||j d}|d krptdj |nV|dkr|j ddd }|j t stdj t |tt d}|jstd j ||jdd }t||td S) anGiven the path to a .pyc. file, return the path to its .py file. The .pyc file does not need to exist; this simply returns the path to the .py file calculated to correspond to the .pyc file. If path does not conform to PEP 3147/488 format, ValueError will be raised. If sys.implementation.cache_tag is None then NotImplementedError is raised. Nz$sys.implementation.cache_tag is Nonez%{} not bottom-level directory in {!r}r=r;z!expected only 2 or 3 dots in {!r}z9optimization portion of filename does not start with {!r}z4optimization level {!r} is not an alphanumeric valuer>>r;rT)rrDrErFrrCr(rMrKr2countr$r rLr!rJ partitionrSOURCE_SUFFIXES)r%rPZpycache_filenameZpycacheZ dot_countr<Z opt_levelZ base_filenamerrrsource_from_cache4s.        rYc Cst|dkrdS|jd\}}}| s:|jdddkr>|Sy t|}Wn$ttfk rn|dd }YnXt|r||S|S) zConvert a bytecode file path to a source path (if possible). This function exists purely for backwards-compatibility for PyImport_ExecCodeModuleWithFilenames() in the C API. r>Nr=rTrZpyr[)r!r"lowerrYrFrKr.) bytecode_pathrRr&Z extension source_pathrrr_get_sourcefileVs  r_c CsH|jttr.yt|Stk r*YqDXn|jttr@|SdSdS)N)endswithtuplerXrSrFrN)filenamerrr _get_cachedisrcc Cs4yt|j}Wntk r&d}YnX|dO}|S)z3Calculate the mode permissions for a bytecode file.i)r)r+r*)r%r,rrr _calc_modeus  rec sDdfdd }y tj}Wntk r4dd}YnX|||S)zDecorator to verify that the module being requested matches the one the loader can handle. The first argument (self) must define _name which the second argument is compared against. If the comparison fails then ImportError is raised. NcsB|dkr|j}n |j|kr0td|j|f|d||f||S)Nzloader for %s cannot handle %s)name)rf ImportError)selfrfargsZkwargs)methodrr_check_name_wrappers  z(_check_name.._check_name_wrappercSs<x(dD] }t||rt||t||qW|jj|jdS)N __module____name__ __qualname____doc__)rlrmrnro)hasattrsetattrgetattr__dict__update)ZnewZoldr7rrr_wraps  z_check_name.._wrap)N) _bootstrapru NameError)rjrkrur)rjr _check_names  rxcCs<|j|\}}|dkr8t|r8d}tj|j|dt|S)zTry to find a loader for the specified module by delegating to self.find_loader(). This method is deprecated in favor of finder.find_spec(). Nz,Not importing directory {}: missing __init__r>) find_loaderr!r?r@r2 ImportWarning)rhfullnameloaderportionsmsgrrr_find_module_shims rc Csi}|dk r||d<nd}|dk r*||d<|dd}|dd}|dd}|tkr|dj||}tjd |t|f|nVt|dkrd j|}tjd |t|n*t|dkrd j|}tjd |t||dk r|yt|d } Wntk rYn2Xt || kr4d j|}tjd |t|f|y|dd@} Wntk rZYn"Xt || kr|td j|f||ddS)azValidate the header of the passed-in bytecode against source_stats (if given) and returning the bytecode that can be compiled by compile(). All other arguments are used to enhance error reporting. ImportError is raised when the magic number is incorrect or the bytecode is found to be stale. EOFError is raised when the data is found to be truncated. Nrfz r%r zbad magic number in {!r}: {!r}z{}z+reached EOF while reading timestamp in {!r}z0reached EOF while reading size of source in {!r}mtimezbytecode is stale for {!r}sizel) MAGIC_NUMBERr2rv_verbose_messagergr!EOFErrorrKeyErrorr) r8 source_statsrfr%Z exc_detailsZmagicZ raw_timestampZraw_sizerO source_mtime source_sizerrr_validate_bytecode_headersL                   rcCsPtj|}t|tr8tjd||dk r4tj|||Stdj |||ddS)zcCs8tt}|jt||jt||jtj||S)zPCompile a code object into bytecode for writing out to a byte-compiled file.) bytearrayrextendrrZdumps)rrrr8rrr_code_to_bytecodes rcCs>ddl}tj|j}|j|}tjdd}|j|j|dS)zyDecode bytes representing source code and return the string. Universal newline support is used in the decoding. r>NT)tokenizer4ZBytesIOZreadlineZdetect_encodingZIncrementalNewlineDecoderdecode) source_bytesrZsource_bytes_readlineencodingZnewline_decoderrrr decode_sources    r)r|submodule_search_locationsc Cs|dkr get_filename)originT is_packager>)rprrgrrCrv ModuleSpecZ _set_fileattr_get_supported_file_loadersr`rar| _POPULATErrr(append) rfZlocationr|rspec loader_classsuffixesrZdirnamerrrspec_from_file_location s>        rc@sPeZdZdZdZdZdZeddZeddZ edd d Z edd d Z d S)WindowsRegistryFinderz>Meta path finder for modules declared in the Windows registry.z;Software\Python\PythonCore\{sys_version}\Modules\{fullname}zASoftware\Python\PythonCore\{sys_version}\Modules\{fullname}\DebugFc Cs2ytjtj|Stk r,tjtj|SXdS)N)_winregZOpenKeyZHKEY_CURRENT_USERr*ZHKEY_LOCAL_MACHINE)clsrrrr_open_registry\sz$WindowsRegistryFinder._open_registrycCsp|jr|j}n|j}|j|dtjddd}y&|j|}tj|d}WdQRXWnt k rjdSX|S)Nz%d.%dr;)r{Z sys_versionr ) DEBUG_BUILDREGISTRY_KEY_DEBUG REGISTRY_KEYr2r version_inforrZ QueryValuer*)rr{Z registry_keyrZhkeyfilepathrrr_search_registrycs z&WindowsRegistryFinder._search_registryNcCsx|j|}|dkrdSy t|Wntk r6dSXx:tD]0\}}|jt|r@tj|||||d}|Sq@WdS)N)r)rr)r*rr`rarvspec_from_loader)rr{r%targetrr|rrrrr find_specrs  zWindowsRegistryFinder.find_speccCs"|j||}|dk r|jSdSdS)zlFind module named in the registry. This method is deprecated. Use exec_module() instead. N)rr|)rr{r%rrrr find_modules z!WindowsRegistryFinder.find_module)NN)N) rmrlrnrorrr classmethodrrrrrrrrrPs   rc@s0eZdZdZddZddZddZdd Zd S) _LoaderBasicszSBase class of common code needed by both SourceLoader and SourcelessFileLoader.cCs@t|j|d}|jddd}|jdd}|dko>|dkS)zConcrete implementation of InspectLoader.is_package by checking if the path returned by get_filename has a filename of '__init__.py'.rr=r>r;__init__)r(rr$r")rhr{rbZ filename_baseZ tail_namerrrrsz_LoaderBasics.is_packagecCsdS)z*Use default semantics for module creation.Nr)rhrrrr create_modulesz_LoaderBasics.create_modulecCs8|j|j}|dkr$tdj|jtjt||jdS)zExecute the module.Nz4cannot load module {!r} when get_code() returns None)get_codermrgr2rv_call_with_frames_removedexecrs)rhmodulerrrr exec_modules   z_LoaderBasics.exec_modulecCs tj||S)zThis module is deprecated.)rv_load_module_shim)rhr{rrr load_modulesz_LoaderBasics.load_moduleN)rmrlrnrorrrrrrrrrs rc@sJeZdZddZddZddZddZd d Zdd d dZddZ dS) SourceLoadercCstdS)zOptional method that returns the modification time (an int) for the specified path, where path is a str. Raises IOError when the path cannot be handled. N)IOError)rhr%rrr path_mtimeszSourceLoader.path_mtimecCsd|j|iS)aOptional method returning a metadata dict for the specified path to by the path (str). Possible keys: - 'mtime' (mandatory) is the numeric timestamp of last source code modification; - 'size' (optional) is the size in bytes of the source code. Implementing this method allows the loader to read bytecode files. Raises IOError when the path cannot be handled. r)r)rhr%rrr path_statss zSourceLoader.path_statscCs |j||S)zOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. The source path is needed in order to correctly transfer permissions )set_data)rhr^Z cache_pathr8rrr_cache_bytecodeszSourceLoader._cache_bytecodecCsdS)zOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. Nr)rhr%r8rrrrszSourceLoader.set_datacCsR|j|}y|j|}Wn0tk rH}ztd|d|WYdd}~XnXt|S)z4Concrete implementation of InspectLoader.get_source.z'source not available through get_data())rfN)rget_datar*rgr)rhr{r%rexcrrr get_sources zSourceLoader.get_sourcer) _optimizecCstjt||dd|dS)zReturn the code object compiled from source. The 'data' argument can be any object type that compile() supports. rT) dont_inheritrH)rvrcompile)rhr8r%rrrrsource_to_codes zSourceLoader.source_to_codec +Cs^|j|}d}y t|}Wntk r2d}YnXy|j|}Wntk rVYn~Xt|d}y|j|}Wntk rYnNXyt||||d}Wnt t fk rYn Xt j d||t ||||dS|j|}|j||} t j d|tj rZ|dk rZ|dk rZt| |t|}y|j|||t j d|Wntk rXYnX| S)zConcrete implementation of InspectLoader.get_code. Reading of bytecode requires path_stats to be implemented. To write bytecode, set_data must also be implemented. Nr)rrfr%z {} matches {})rfr]r^zcode object from {}z wrote {!r})rrSrFrrrrr*rrgrrvrrrrdont_write_bytecoderr!r) rhr{r^rr]str8 bytes_datarZ code_objectrrrrsN          zSourceLoader.get_codeNr[) rmrlrnrrrrrrrrrrrrs   rcsPeZdZdZddZddZddZefdd Zed d Z d d Z Z S) FileLoaderzgBase file loader class which implements the loader protocol methods that require file system usage.cCs||_||_dS)zKCache the module name and the path to the file found by the finder.N)rfr%)rhr{r%rrrr szFileLoader.__init__cCs|j|jko|j|jkS)N) __class__rs)rhotherrrr__eq__&s zFileLoader.__eq__cCst|jt|jAS)N)hashrfr%)rhrrr__hash__*szFileLoader.__hash__cstt|j|S)zdLoad a module from a file. This method is deprecated. Use exec_module() instead. )superrr)rhr{)rrrr-s zFileLoader.load_modulecCs|jS)z:Return the path to the source file as found by the finder.)r%)rhr{rrrr9szFileLoader.get_filenamec Cs tj|d }|jSQRXdS)z'Return the data from path as raw bytes.rN)r4r5Zread)rhr%r9rrrr>szFileLoader.get_data) rmrlrnrorrrrxrrrZ __classcell__rr)rrrs rc@s.eZdZdZddZddZdddd Zd S) SourceFileLoaderz>Concrete implementation of SourceLoader using the file system.cCst|}|j|jdS)z!Return the metadata for the path.)rr)r)st_mtimeZst_size)rhr%rrrrrHszSourceFileLoader.path_statscCst|}|j|||dS)N)_mode)rer)rhr^r]r8r,rrrrMsz SourceFileLoader._cache_bytecodei)rc Cst|\}}g}x(|r8t| r8t|\}}|j|qWxlt|D]`}t||}ytj|WqDtk rvwDYqDtk r}zt j d||dSd}~XqDXqDWyt |||t j d|Wn0tk r}zt j d||WYdd}~XnXdS)zWrite bytes data to a file.zcould not create {!r}: {!r}Nz created {!r}) r(r0rr#rrZmkdirFileExistsErrorr*rvrr:) rhr%r8rparentrbrrrrrrrRs*    zSourceFileLoader.set_dataN)rmrlrnrorrrrrrrrDsrc@s eZdZdZddZddZdS)SourcelessFileLoaderz-Loader which handles sourceless file imports.cCs0|j|}|j|}t|||d}t|||dS)N)rfr%)rfr])rrrr)rhr{r%r8rrrrrus  zSourcelessFileLoader.get_codecCsdS)z'Return None as there is no source code.Nr)rhr{rrrr{szSourcelessFileLoader.get_sourceN)rmrlrnrorrrrrrrqsrc@s\eZdZdZddZddZddZdd Zd d Zd d Z ddZ ddZ e ddZ dS)ExtensionFileLoaderz]Loader for extension modules. The constructor is designed to work with FileFinder. cCs||_||_dS)N)rfr%)rhrfr%rrrrszExtensionFileLoader.__init__cCs|j|jko|j|jkS)N)rrs)rhrrrrrs zExtensionFileLoader.__eq__cCst|jt|jAS)N)rrfr%)rhrrrrszExtensionFileLoader.__hash__cCs$tjtj|}tjd|j|j|S)z&Create an unitialized extension modulez&extension module {!r} loaded from {!r})rvrrZcreate_dynamicrrfr%)rhrrrrrrs   z!ExtensionFileLoader.create_modulecCs$tjtj|tjd|j|jdS)zInitialize an extension modulez(extension module {!r} executed from {!r}N)rvrrZ exec_dynamicrrfr%)rhrrrrrszExtensionFileLoader.exec_modulecs$t|jdtfddtDS)z1Return True if the extension module is a package.rc3s|]}d|kVqdS)rNr)rsuffix) file_namerr sz1ExtensionFileLoader.is_package..)r(r%anyEXTENSION_SUFFIXES)rhr{r)rrrs zExtensionFileLoader.is_packagecCsdS)z?Return None as an extension module cannot create a code object.Nr)rhr{rrrrszExtensionFileLoader.get_codecCsdS)z5Return None as extension modules have no source code.Nr)rhr{rrrrszExtensionFileLoader.get_sourcecCs|jS)z:Return the path to the source file as found by the finder.)r%)rhr{rrrrsz ExtensionFileLoader.get_filenameN)rmrlrnrorrrrrrrrrxrrrrrrsrc@s`eZdZdZddZddZddZdd Zd d Zd d Z ddZ ddZ ddZ ddZ dS)_NamespacePatha&Represents a namespace package's path. It uses the module name to find its parent module, and from there it looks up the parent's __path__. When this changes, the module's own path is recomputed, using path_finder. For top-level modules, the parent module's path is sys.path.cCs$||_||_t|j|_||_dS)N)_name_pathra_get_parent_path_last_parent_path _path_finder)rhrfr% path_finderrrrrsz_NamespacePath.__init__cCs&|jjd\}}}|dkrdS|dfS)z>Returns a tuple of (parent-module-name, parent-path-attr-name)r=r rr%Z__path__)rr%)rr")rhrdotZmerrr_find_parent_path_namessz&_NamespacePath._find_parent_path_namescCs|j\}}ttj||S)N)rrrrmodules)rhZparent_module_nameZpath_attr_namerrrrs z_NamespacePath._get_parent_pathcCsPt|j}||jkrJ|j|j|}|dk rD|jdkrD|jrD|j|_||_|jS)N)rarrrrr|rr)rhZ parent_pathrrrr _recalculates  z_NamespacePath._recalculatecCs t|jS)N)iterr)rhrrr__iter__sz_NamespacePath.__iter__cCs||j|<dS)N)r)rhindexr%rrr __setitem__sz_NamespacePath.__setitem__cCs t|jS)N)r!r)rhrrr__len__sz_NamespacePath.__len__cCs dj|jS)Nz_NamespacePath({!r}))r2r)rhrrr__repr__sz_NamespacePath.__repr__cCs ||jkS)N)r)rhitemrrr __contains__sz_NamespacePath.__contains__cCs|jj|dS)N)rr)rhrrrrrsz_NamespacePath.appendN)rmrlrnrorrrrrrrrrrrrrrrs  rc@sPeZdZddZeddZddZddZd d Zd d Z d dZ ddZ dS)_NamespaceLoadercCst||||_dS)N)rr)rhrfr%rrrrrsz_NamespaceLoader.__init__cCs dj|jS)zsReturn repr for the module. The method is deprecated. The import machinery does the job itself. z)r2rm)rrrrr module_reprsz_NamespaceLoader.module_reprcCsdS)NTr)rhr{rrrrsz_NamespaceLoader.is_packagecCsdS)Nr r)rhr{rrrrsz_NamespaceLoader.get_sourcecCstdddddS)Nr zrT)r)r)rhr{rrrrsz_NamespaceLoader.get_codecCsdS)z*Use default semantics for module creation.Nr)rhrrrrr sz_NamespaceLoader.create_modulecCsdS)Nr)rhrrrrrsz_NamespaceLoader.exec_modulecCstjd|jtj||S)zbLoad a namespace module. This method is deprecated. Use exec_module() instead. z&namespace module loaded with path {!r})rvrrr)rhr{rrrrsz_NamespaceLoader.load_moduleN) rmrlrnrrrrrrrrrrrrrrs rc@sjeZdZdZeddZeddZeddZedd Zedd d Z edd dZ edddZ d S) PathFinderz>Meta path finder for sys.path and package __path__ attributes.cCs*x$tjjD]}t|dr |jq WdS)z}Call the invalidate_caches() method on all path entry finders stored in sys.path_importer_caches (where implemented).invalidate_cachesN)rpath_importer_cachevaluesrpr)rfinderrrrr#s zPathFinder.invalidate_cachesc CsVtjdk rtj rtjdtx2tjD]$}y||Stk rHw&Yq&Xq&WdSdS)z.Search sys.path_hooks for a finder for 'path'.Nzsys.path_hooks is empty)r path_hooksr?r@rzrg)rr%Zhookrrr _path_hooks+s   zPathFinder._path_hookscCsf|dkr*y tj}Wntk r(dSXytj|}Wn(tk r`|j|}|tj|<YnX|S)zGet the finder for the path entry from sys.path_importer_cache. If the path entry is not in the cache, find the appropriate finder and cache it. If no finder is available, store None. r N)rr/FileNotFoundErrorrrrr)rr%rrrr_path_importer_cache8s  zPathFinder._path_importer_cachecCsRt|dr|j|\}}n|j|}g}|dk r.r=rNr[)r_loadersr% _path_mtimeset _path_cache_relaxed_path_cache)rhr%loader_detailsZloadersrr)r|rrs zFileFinder.__init__cCs d|_dS)zInvalidate the directory mtime.rNr[)r)rhrrrrszFileFinder.invalidate_cachescCs*|j|}|dkrdgfS|j|jp&gfS)zTry to find a loader for the specified module, or the namespace package portions. Returns (loader, list-of-portions). This method is deprecated. Use find_spec() instead. N)rr|r)rhr{rrrrrys zFileFinder.find_loadercCs|||}t||||dS)N)r|r)r)rhrr{r%Zsmslrr|rrrrs zFileFinder._get_specNcCsbd}|jdd}yt|jp"tjj}Wntk rBd }YnX||jkr\|j||_t rr|j }|j }n |j }|}||krt |j|}xH|jD]6\} } d| } t || } t| r|j| || |g|SqWt|}xX|jD]N\} } t |j|| } tjd| dd|| |krt| r|j| || d|SqW|r^tjd |tj|d} |g| _| SdS) zoTry to find a spec for the specified module. Returns the matching spec, or None if not found. Fr=r;rrz trying {})Z verbosityNzpossible namespace for {}r[)r"r)r%rr/rr*r _fill_cacherr r\r rrr.rr0rvrrr)rhr{rZ is_namespaceZ tail_modulerZcacheZ cache_moduleZ base_pathrrZ init_filenameZ full_pathrrrrrsF          zFileFinder.find_specc Cs|j}ytj|ptj}Wntttfk r:g}YnXtjj dsTt ||_ nNt }x@|D]8}|j d\}}}|rdj ||j}n|}|j|q`W||_ tjj trdd|D|_dS)zDFill the cache of potential modules and packages for this directory.rr=z{}.{}cSsh|] }|jqSr)r\)rZfnrrr sz)FileFinder._fill_cache..N)r%rZlistdirr/rPermissionErrorNotADirectoryErrorrr r rr rWr2r\addr r ) rhr%ZcontentsZlower_suffix_contentsrrfrrZnew_namerrrr s"     zFileFinder._fill_cachecsfdd}|S)aA class method which returns a closure to use on sys.path_hook which will return an instance using the specified loaders and the path called on the closure. If the path called on the closure is not a directory, ImportError is raised. cs"t|std|d|fS)z-Path hook for importlib.machinery.FileFinder.zonly directories are supported)r%)r0rg)r%)rr rrpath_hook_for_FileFinder*s z6FileFinder.path_hook..path_hook_for_FileFinderr)rr rr)rr r path_hook s zFileFinder.path_hookcCs dj|jS)NzFileFinder({!r}))r2r%)rhrrrr2szFileFinder.__repr__)N)rmrlrnrorrrrryrrr rrrrrrrrs  0 rc Cs|jd}|jd}|sB|r$|j}n||kr8t||}n t||}|sTt|||d}y$||d<||d<||d<||d<Wntk rYnXdS)N __loader____spec__)r|Z__file__Z __cached__)getr|rrr Exception)ZnsrfZpathnameZ cpathnamer|rrrr_fix_up_module8s"     rcCs&ttjf}ttf}ttf}|||gS)z_Returns a list of file-based module loaders. Each item is a tuple (loader, suffixes). )rrextension_suffixesrrXrrN)Z extensionsZsourceZbytecoderrrrOs rc Cs|atjatjatjt}x8dD]0}|tjkr:tj|}n tj|}t|||q Wddgfdddgff}xv|D]f\}}td d |Dst|d }|tjkrtj|}Pqpytj|}PWqpt k rwpYqpXqpWt d t|d |t|d|t|ddj |ytjd} Wnt k r4d} YnXt|d| tjd} t|d| |dkrxtjd} t|d| t|dt t j tj|dkrtjddt krdt_dS)zSetup the path-based importers for importlib by importing needed built-in modules and injecting them into the global namespace. Other components are extracted from the core bootstrap module. r4r?builtinsrZposix/Znt\css|]}t|dkVqdS)rN)r!)rrQrrrrssz_setup..r>zimportlib requires posix or ntrrrr Z_threadNZ_weakrefZwinregrrz.pywz_d.pydT)r4r?rr)rvrrrrmZ_builtin_from_namerqallAssertionErrorrgrr rrrrXrrr) _bootstrap_moduleZ self_moduleZ builtin_nameZbuiltin_moduleZ os_detailsZ builtin_osrrZ os_moduleZ thread_moduleZweakref_moduleZ winreg_modulerrr_setupZsR                     rcCs2t|t}tjjtj|gtjjt dS)z)Install the path-based import components.N) rrrrrrr meta_pathrr)rZsupported_loadersrrr_installsr!)r)rr)r1)N)NNN)NNN)r>r>)N)N):ror Z%_CASE_INSENSITIVE_PLATFORMS_BYTES_KEYr r rrrr(r)r-r.r0r:type__code__rrrrrZ_RAW_MAGIC_NUMBERrMrLrXrNZDEBUG_BYTECODE_SUFFIXESZOPTIMIZED_BYTECODE_SUFFIXESrSrYr_rcrerxrrrrrobjectrrrrrrrrrrrrrrrrrr!rrrrsl     { -"   7 C@n)-5<*  Dc@sdZdaddZddZiZiZGdddeZGdd d ZGd d d Z Gd d d Z ddZ ddZ ddZ ddddZddZddZddZddZGd d!d!ZGd"d#d#Zddd$d%d&Zd]d'd(Zd)d*d+d,Zd-d.Zd/d0Zd1d2Zd3d4Zd5d6Zd7d8ZGd9d:d:ZGd;d<d<ZGd=d>d>Z d?d@Z!dAdBZ"d^dCdDZ#dEdFZ$dGZ%e%dHZ&dIdJZ'e(Z)dKdLZ*d_dNdOZ+d)dPdQdRZ,dSdTZ-ddfdMfdUdVZ.dWdXZ/dYdZZ0d[d\Z1dS)`aSCore implementation of import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. NcCs<x(dD] }t||rt||t||qW|jj|jdS)z/Simple substitute for functools.update_wrapper. __module____name__ __qualname____doc__N)rrrr)hasattrsetattrgetattr__dict__update)ZnewZoldreplacer _wraps  r cCs tt|S)N)typesys)namer r r _new_module#src@s eZdZdS)_DeadlockErrorN)rrrr r r r r0src@s8eZdZdZddZddZddZdd Zd d Zd S) _ModuleLockzA recursive lock implementation which is able to detect deadlocks (e.g. thread 1 trying to take locks A then B, and thread 2 trying to take locks B then A). cCs0tj|_tj|_||_d|_d|_d|_dS)N)_threadZ allocate_locklockwakeuprownercountwaiters)selfrr r r __init__:s   z_ModuleLock.__init__cCs@tj}|j}x,tj|}|dkr&dS|j}||krdSqWdS)NFT)r get_identr _blocking_onget)rZmetidrr r r has_deadlockBs z_ModuleLock.has_deadlockcCstj}|t|<zx|j`|jdks0|j|krH||_|jd7_dS|jr\td||jj drv|j d7_ WdQRX|jj |jj qWWdt|=XdS)z Acquire the module lock. If a potential deadlock is detected, a _DeadlockError is raised. Otherwise, the lock is always acquired and True is returned. rTzdeadlock detected by %rFN) rrrrrrr rracquirerrelease)rrr r r r"Ns    z_ModuleLock.acquirec Csztj}|jb|j|kr"td|jdks0t|jd8_|jdkrld|_|jrl|jd8_|jj WdQRXdS)Nzcannot release un-acquired lockrr!) rrrr RuntimeErrorrAssertionErrorrrr#)rrr r r r#gs  z_ModuleLock.releasecCsdj|jt|S)Nz_ModuleLock({!r}) at {})formatrid)rr r r __repr__tsz_ModuleLock.__repr__N) rrrrrr r"r#r(r r r r r4s   rc@s0eZdZdZddZddZddZdd Zd S) _DummyModuleLockzVA simple _ModuleLock equivalent for Python builds without multi-threading support.cCs||_d|_dS)Nr)rr)rrr r r r|sz_DummyModuleLock.__init__cCs|jd7_dS)Nr!T)r)rr r r r"sz_DummyModuleLock.acquirecCs$|jdkrtd|jd8_dS)Nrzcannot release un-acquired lockr!)rr$)rr r r r#s z_DummyModuleLock.releasecCsdj|jt|S)Nz_DummyModuleLock({!r}) at {})r&rr')rr r r r(sz_DummyModuleLock.__repr__N)rrrrrr"r#r(r r r r r)xs r)c@s$eZdZddZddZddZdS)_ModuleLockManagercCs||_d|_dS)N)_name_lock)rrr r r rsz_ModuleLockManager.__init__cCst|j|_|jjdS)N)_get_module_lockr+r,r")rr r r __enter__s z_ModuleLockManager.__enter__cOs|jjdS)N)r,r#)rargsZkwargsr r r __exit__sz_ModuleLockManager.__exit__N)rrrrr.r0r r r r r*sr*cCstjzjyt|}Wntk r0d}YnX|dkrptdkrLt|}nt|}|fdd}tj||t|<Wdtj X|S)zGet or create the module lock for a given module name. Acquire/release internally the global import lock to protect _module_locks.Nc Ss0tjztj||krt|=WdtjXdS)N)_imp acquire_lock _module_locksr release_lock)refrr r r cbs  z_get_module_lock..cb) r1r2r3KeyErrorrr)r_weakrefr5r4)rrr6r r r r-s    r-c Cs6t|}y |jWntk r(Yn X|jdS)zAcquires then releases the module lock for a given module name. This is used to ensure a module is completely initialized, in the event it is being imported by another thread. N)r-r"rr#)rrr r r _lock_unlock_modules  r9cOs |||S)a.remove_importlib_frames in import.c will always remove sequences of importlib frames that end with a call to this function Use it instead of a normal call in places where including the importlib frames introduces unwanted noise into the traceback (e.g. when executing module code) r )fr/Zkwdsr r r _call_with_frames_removedsr;r!) verbositycGs6tjj|kr2|jdsd|}t|j|tjddS)z=Print the message to stderr if -v/PYTHONVERBOSE is turned on.#import z# )ZfileN)r=r>)rflagsverbose startswithprintr&stderr)messager<r/r r r _verbose_messages  rEcsfdd}t||S)z1Decorator to verify the named module is built-in.cs&|tjkrtdj||d||S)Nz{!r} is not a built-in module)r)rbuiltin_module_names ImportErrorr&)rfullname)fxnr r _requires_builtin_wrappers  z4_requires_builtin.._requires_builtin_wrapper)r )rIrJr )rIr _requires_builtins  rKcsfdd}t||S)z/Decorator to verify the named module is frozen.cs&tj|stdj||d||S)Nz{!r} is not a frozen module)r)r1 is_frozenrGr&)rrH)rIr r _requires_frozen_wrappers  z2_requires_frozen.._requires_frozen_wrapper)r )rIrMr )rIr _requires_frozens  rNcCs>t||}|tjkr2tj|}t||tj|St|SdS)zLoad the specified module into sys.modules and return it. This method is deprecated. Use loader.exec_module instead. N)spec_from_loaderrmodules_exec_load)rrHspecmoduler r r _load_module_shims      rUc#Cst|dd}t|dr6y |j|Stk r4YnXy |j}Wntk rTYnX|dk rft|Sy |j}Wntk rd}YnXy |j}Wn2tk r|dkrdj |Sdj ||SYnXdj ||SdS)N __loader__ module_repr?z zz) rrrW Exception__spec__AttributeError_module_repr_from_specr__file__r&)rTloaderrSrfilenamer r r _module_repr s.        r`c@s$eZdZddZddZddZdS)_installed_safelycCs||_|j|_dS)N)_modulerZ_spec)rrTr r r r3sz_installed_safely.__init__cCsd|j_|jtj|jj<dS)NT)rc _initializingrbrrPr)rr r r r.7sz_installed_safely.__enter__cGsbzR|j}tdd|Dr@ytj|j=WqPtk r<YqPXntd|j|jWdd|j_XdS)Ncss|]}|dk VqdS)Nr )Z.0Zargr r r Asz-_installed_safely.__exit__..zimport {!r} # {!r}F) rcanyrrPrr7rEr^rd)rr/rSr r r r0>sz_installed_safely.__exit__N)rrrrr.r0r r r r ra1srac@sreZdZdZddddddZddZdd Zed d Zej d d Zed dZ eddZ e j ddZ dS) ModuleSpecaThe specification for a module, used for loading. A module's spec is the source for information about the module. For data associated with the module, including source, use the spec's loader. `name` is the absolute name of the module. `loader` is the loader to use when loading the module. `parent` is the name of the package the module is in. The parent is derived from the name. `is_package` determines if the module is considered a package or not. On modules this is reflected by the `__path__` attribute. `origin` is the specific location used by the loader from which to load the module, if that information is available. When filename is set, origin will match. `has_location` indicates that a spec's "origin" reflects a location. When this is True, `__file__` attribute of the module is set. `cached` is the location of the cached bytecode file, if any. It corresponds to the `__cached__` attribute. `submodule_search_locations` is the sequence of path entries to search when importing submodules. If set, is_package should be True--and False otherwise. Packages are simply modules that (may) have submodules. If a spec has a non-None value in `submodule_search_locations`, the import system will consider modules loaded from the spec as packages. Only finders (see importlib.abc.MetaPathFinder and importlib.abc.PathEntryFinder) should modify ModuleSpec instances. N)origin loader_state is_packagecCs6||_||_||_||_|r gnd|_d|_d|_dS)NF)rr^rhrisubmodule_search_locations _set_fileattr_cached)rrr^rhrirjr r r rqszModuleSpec.__init__cCsfdj|jdj|jg}|jdk r4|jdj|j|jdk rP|jdj|jdj|jjdj|S)Nz name={!r}z loader={!r}z origin={!r}zsubmodule_search_locations={}z{}({})z, ) r&rr^rhappendrk __class__rjoin)rr/r r r r(}s    zModuleSpec.__repr__c Csf|j}yF|j|jkoL|j|jkoL|j|jkoL||jkoL|j|jkoL|j|jkStk r`dSXdS)NF)rkrr^rhcached has_locationr[)rZotherZsmslr r r __eq__s      zModuleSpec.__eq__cCs:|jdkr4|jdk r4|jr4tdkr&ttj|j|_|jS)N)rmrhrl_bootstrap_externalNotImplementedErrorZ _get_cached)rr r r rqs  zModuleSpec.cachedcCs ||_dS)N)rm)rrqr r r rqscCs$|jdkr|jjddS|jSdS)z The name of the module's parent.N.r)rkr rpartition)rr r r parents zModuleSpec.parentcCs|jS)N)rl)rr r r rrszModuleSpec.has_locationcCst||_dS)N)boolrl)rvaluer r r rrs) rrrrrr(rspropertyrqsetterrxrrr r r r rgLs#     rg)rhrjcCst|drJtdkrttj}|dkr0|||dS|r8gnd}||||dS|dkrt|dry|j|}Wqtk rd}YqXnd}t||||dS)z5Return a module spec based on various loader methods.Z get_filenameN)r^)r^rkrjF)rhrj)rrtruspec_from_file_locationrjrGrg)rr^rhrjr}Zsearchr r r rOs"     rOc5Cs8y |j}Wntk rYnX|dk r,|S|j}|dkrZy |j}Wntk rXYnXy |j}Wntk r|d}YnX|dkr|dkry |j}Wqtk rd}YqXn|}y |j}Wntk rd}YnXyt|j}Wntk rd}YnXt |||d}|dkr"dnd|_ ||_ ||_ |S)N)rhFT) rZr[rrVr]Z_ORIGIN __cached__list__path__rgrlrqrk)rTr^rhrSrZlocationrqrkr r r _spec_from_modulesH         rF)overridec;Cs|st|dddkr6y |j|_Wntk r4YnX|sJt|dddkr|j}|dkr|jdk rtdkrnttj}|j |}|j|_ y ||_ Wntk rYnX|st|dddkry |j |_ Wntk rYnXy ||_Wntk rYnX|st|dddkrD|jdk rDy |j|_Wntk rBYnX|jr|sdt|dddkry |j|_Wntk rYnX|st|dddkr|jdk ry |j|_Wntk rYnX|S)NrrV __package__rr]r~)rrrr[r^rkrtru_NamespaceLoader__new__Z_pathrVrxrrZrrrrhr]rqr~)rSrTrr^rr r r _init_module_attrss\           rcCsRd}t|jdr|jj|}nt|jdr2td|dkrDt|j}t|||S)z+Create a module based on the provided spec.N create_module exec_modulezBloaders that define exec_module() must also define create_module())rr^rrGrrr)rSrTr r r module_from_spec4s    rcCsj|jdkrdn|j}|jdkrB|jdkr2dj|Sdj||jSn$|jrVdj||jSdj|j|jSdS)z&Return the repr to use for the module.NrXz zzz)rrhr^r&rr)rSrr r r r\Es   r\c Cs|j}t|tjj||k r6dj|}t||d|jdkrj|jdkrXtd|jdt ||dd|St ||ddt |jds|jj |n |jj |WdQRXtj|S)zFExecute the spec's specified module in an existing module's namespace.zmodule {!r} not in sys.modules)rNzmissing loaderT)rr) rr*rrPrr&rGr^rkrr load_moduler)rSrTrmsgr r r rQVs      rQcCs|jj|jtj|j}t|dddkrLy |j|_Wntk rJYnXt|dddkry(|j|_ t |ds|jj dd|_ Wntk rYnXt|dddkry ||_ Wntk rYnX|S)NrVrrrvrrZ) r^rrrrPrrVr[rrrrwrZ)rSrTr r r _load_backward_compatiblens(    rc Csv|jdk rt|jdst|St|}t|6|jdkrT|jdkr`td|jdn |jj|WdQRXt j |jS)Nrzmissing loader)r) r^rrrrarkrGrrrrP)rSrTr r r _load_unlockeds     rc Cst|j t|SQRXdS)zReturn a new module object, loaded by the spec's loader. The module is not added to its parent. If a module is already in sys.modules, that existing module gets clobbered. N)r*rr)rSr r r rRs rRc@seZdZdZeddZedddZedddZed d Z ed d Z ee d dZ ee ddZ ee ddZeeZdS)BuiltinImporterzMeta path import for built-in modules. All methods are either class or static methods to avoid the need to instantiate the class. cCs dj|jS)zsReturn repr for the module. The method is deprecated. The import machinery does the job itself. z)r&r)rTr r r rWszBuiltinImporter.module_reprNcCs,|dk r dStj|r$t||ddSdSdS)Nzbuilt-in)rh)r1Z is_builtinrO)clsrHpathtargetr r r find_specs  zBuiltinImporter.find_speccCs|j||}|dk r|jSdS)zFind the built-in module. If 'path' is ever specified then the search is considered a failure. This method is deprecated. Use find_spec() instead. N)rr^)rrHrrSr r r find_modules zBuiltinImporter.find_modulecCs.|jtjkr"tdj|j|jdttj|S)zCreate a built-in modulez{!r} is not a built-in module)r)rrrFrGr&r;r1Zcreate_builtin)rrSr r r rs   zBuiltinImporter.create_modulecCsttj|dS)zExec a built-in moduleN)r;r1Z exec_builtin)rrTr r r rszBuiltinImporter.exec_modulecCsdS)z9Return None as built-in modules do not have code objects.Nr )rrHr r r get_codeszBuiltinImporter.get_codecCsdS)z8Return None as built-in modules do not have source code.Nr )rrHr r r get_sourceszBuiltinImporter.get_sourcecCsdS)z4Return False as built-in modules are never packages.Fr )rrHr r r rjszBuiltinImporter.is_package)NN)N)rrrr staticmethodrW classmethodrrrrrKrrrjrUrr r r r rs    rc@seZdZdZeddZedddZedddZed d Z ed d Z ed dZ ee ddZ ee ddZee ddZdS)FrozenImporterzMeta path import for frozen modules. All methods are either class or static methods to avoid the need to instantiate the class. cCs dj|jS)zsReturn repr for the module. The method is deprecated. The import machinery does the job itself. z)r&r)mr r r rWszFrozenImporter.module_reprNcCs tj|rt||ddSdSdS)NZfrozen)rh)r1rLrO)rrHrrr r r r s zFrozenImporter.find_speccCstj|r|SdS)z]Find a frozen module. This method is deprecated. Use find_spec() instead. N)r1rL)rrHrr r r rszFrozenImporter.find_modulecCsdS)z*Use default semantics for module creation.Nr )rrSr r r rszFrozenImporter.create_modulecCs@|jj}tj|s$tdj||dttj|}t||j dS)Nz{!r} is not a frozen module)r) rZrr1rLrGr&r;get_frozen_objectexecr)rTrcoder r r r s    zFrozenImporter.exec_modulecCs t||S)z_Load a frozen module. This method is deprecated. Use exec_module() instead. )rU)rrHr r r r)szFrozenImporter.load_modulecCs tj|S)z-Return the code object for the frozen module.)r1r)rrHr r r r2szFrozenImporter.get_codecCsdS)z6Return None as frozen modules do not have source code.Nr )rrHr r r r8szFrozenImporter.get_sourcecCs tj|S)z.Return True if the frozen module is a package.)r1Zis_frozen_package)rrHr r r rj>szFrozenImporter.is_package)NN)N)rrrrrrWrrrrrrrNrrrjr r r r rs     rc@s eZdZdZddZddZdS)_ImportLockContextz$Context manager for the import lock.cCs tjdS)zAcquire the import lock.N)r1r2)rr r r r.Ksz_ImportLockContext.__enter__cCs tjdS)z= 0z__package__ not set to a stringz6attempted relative import with no known parent packagezEmpty module nameN) isinstancestr TypeErrorr&r rrG)rrrr r r _sanity_checks   rzNo module named z{!r}c Csd}|jdd}|r|tjkr*t|||tjkr>tj|Stj|}y |j}Wn2tk rtdj||}t||ddYnXt ||}|dkrttj||dnt |}|rtj|}t ||jdd||S)Nrvrz; {!r} is not a package)r) rwrrPr;rr[_ERR_MSGr&ModuleNotFoundErrorrrr)rimport_rrxZ parent_modulerrSrTr r r _find_and_load_unlockeds*        rc Cs^t|&tjj|t}|tkr*t||SWdQRX|dkrRdj|}t||dt||S)zFind and load the module.Nz(import of {} halted; None in sys.modules)r) r*rrPr_NEEDS_LOADINGrr&rr9)rrrTrDr r r _find_and_loads  rrcCs*t||||dkr t|||}t|tS)a2Import and return the module based on its name, the package the call is being made from, and the level adjustment. This function represents the greatest common denominator of functionality between import_module and __import__. This includes setting __package__ if the loader did not. r)rrr _gcd_import)rrrr r r rs  r) recursivecCst|drx|D]}t|tsN|r.|jd}nd}td|dt|jq|dkrz| rt|drt||j|dd qt||sd j|j|}yt ||Wqt k r}z&|j |krt j j|td k rwWYd d }~XqXqW|S) zFigure out what __import__ should return. The import_ parameter is a callable which takes the name of module to import. It is required to decouple the function from assuming importlib's import implementation is desired. rz.__all__z ``from list''zItem in z must be str, not *__all__T)rz{}.{}N)rrrrrr _handle_fromlistrr&r;rrrrPrr)rTfromlistrrxZwhereZ from_nameZexcr r r rs*        rcCs|jd}|jd}|dk rR|dk rN||jkrNtjd|d|jdtdd|S|dk r`|jStjd tdd|d }d |kr|jd d }|S)zCalculate what __package__ should be. __package__ is not guaranteed to be defined or could be set to None to represent that its proper value is unknown. rrZNz __package__ != __spec__.parent (z != ))Z stacklevelzYcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__rrrvr)rrxrrrrw)globalsrrSr r r _calc___package__ s    rc Cs|dkrt|}n$|dk r|ni}t|}t|||}|s|dkrTt|jddS|s\|St|t|jdd}tj|jdt|j|Sn t||tSdS)aImport a module. The 'globals' argument is used to infer where the import is occurring from to handle relative imports. The 'locals' argument is ignored. The 'fromlist' argument specifies what should exist as attributes on the module being imported (e.g. ``from module import ``). The 'level' argument represents the package location to import from in a relative import (e.g. ``from ..pkg import mod`` would have a 'level' of 2). rNrv)rr partitionrrrPrr) rrlocalsrrrTZglobals_rZcut_offr r r __import__&s    rcCs&tj|}|dkrtd|t|S)Nzno built-in module named )rrrGr)rrSr r r _builtin_from_nameIs  rc Cs|a|att}xVtjjD]H\}}t||r|tjkr>t}ntj|rt }nqt ||}t ||qWtjt }x6dD].}|tjkrt |} n tj|} t||| qxWy t d} Wntk rd} YnXt|d| t d} t|d| dS)zSetup importlib by importing needed built-in modules and injecting them into the global namespace. As sys is needed for sys.modules access and _imp is needed to load built-in modules, those two modules must be explicitly passed in. rrNr8)r)r1rr rPitemsrrFrrLrrrrrrrG) sys_module _imp_moduleZ module_typerrTr^rSZ self_moduleZ builtin_nameZbuiltin_moduleZ thread_moduleZweakref_moduler r r _setupPs2             rcCsBt||tjjttjjtddl}|a|jtj t dS)z2Install importlib as the implementation of import.rN) rrrrnrr_frozen_importlib_externalrt_installrPr)rrrr r r rs    r)NN)N)Nr)2rrtr rr3rr$rrr)r*r-r9r;rErKrNrUr`rargrOrrrr\rQrrrRrrrrrrrZ_ERR_MSG_PREFIXrrobjectrrrrrrrrrr r r r s^D%   $e -<IM   / &#/UUUUUUUU?33333333*$I$I$qqqE]tEUUUUUUU;;I$I$I8885P^Cy 0 0 0 袋. ,d! p= ףp= ؉؉ %^B{ $I$I$ =B!B|PuPuPqq@(  Copyright (c) 2001-2021 Python Software Foundation. All Rights Reserved. Copyright (c) 2000 BeOpen.com. All Rights Reserved. Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved. Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved.Śx0@`x@Xp ! !<"`` !```yy`yyyyyy``````````````````````````````````yyyyy````````````````!`````````#``````"`+-)-/l/E//0))))))))))))))))))))))))))))))))))00 0/p-I-######################################################################i#########0#######(#( > (B( > (B ( @ ( > (B  > (@ (@@  `    > (@ ( (@ ( (  ( ( ( " ( During handling of the above exception, another exception occurred: The above exception was the direct cause of the following exception: PYTHONHOME???wbOsssOisiOOOiencodings.utf_8encodings.latin_1OpenWrapperPYTHONIOENCODINGsN File "%U", line %d ^ : Fatal Python error: %s can't create __main__ moduleBuiltinImporterCODESET is not set or emptyPYTHONMALLOCSTATSCould not allocate TLS entryinvalid tokenexpected an indented blockunexpected indentunexpected unindentinvalid syntaxunexpected EOF while parsingexpression too longunknown decode errorunknown parsing errorerror=%d (sO)Error in sys.excepthook: Original exception was: sys.excepthook is missing import _imp # builtin import sys # builtin _installmodules>>> ... __cached__.pycSourcelessFileLoaderBad magic number in .pyc fileBad code object in .pyc fileSourceFileLoaderclock_gettime(CLOCK_REALTIME)negative argument not allowed/dev/urandomPYTHONHASHSEEDPYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONDONTWRITEBYTECODEbreakcontinueraiseglobalnonlocalassertelifexceptsingle_inputfile_inputeval_inputdecoratordecoratorsdecoratedasync_funcdeftypedargslisttfpdefvarargslistvfpdefsimple_stmtsmall_stmtexpr_stmtannassigntestlist_star_expraugassigndel_stmtpass_stmtflow_stmtbreak_stmtcontinue_stmtreturn_stmtyield_stmtraise_stmtimport_stmtimport_nameimport_fromimport_as_namedotted_as_nameimport_as_namesdotted_as_namesdotted_nameglobal_stmtnonlocal_stmtassert_stmtcompound_stmtasync_stmtif_stmtwhile_stmtfor_stmttry_stmtwith_stmtwith_itemexcept_clausesuitetest_nocondlambdeflambdef_nocondor_testand_testnot_testcomp_opxor_exprand_exprshift_exprarith_exprtermfactorpoweratom_expratomtestlist_comptrailersubscriptlistsubscriptsliceopexprlisttestlistdictorsetmakerclassdefarglistcomp_itercomp_forcomp_ifencoding_declyield_expryield_argexcepthook_shutdownsiphash24PyThreadState_Clear: warning: thread still has a frame PyState_AddModule called on module with slotsTypeError: print_exception(): Exception expected for value, Failed to initialize __main__.__annotations__Failed to retrieve builtins moduleFailed to initialize __main__.__builtins__Failed to retrieve BuiltinImporterFailed to initialize __main__.__loader__Py_Initialize: Unable to get the locale encodingCan't initialize threads for interpreterCouldn't create autoTLSkey mappingPyState_AddModule: Module Definition is NULLPyState_AddModule: Module already added!PyState_RemoveModule called on module with slotsPyState_RemoveModule: Module index invalid.PyState_RemoveModule: Interpreters module-list not acessible.PyState_RemoveModule: Module index out of bounds.PyThreadState_Delete: NULL tstatePyThreadState_Delete: NULL interpPyThreadState_Delete: tstate is still currentPyInterpreterState_Delete: invalid interpPyInterpreterState_Delete: remaining threadsPyInterpreterState_Delete: invalid extraPy_EndInterpreter: thread is not currentPy_EndInterpreter: thread still has a framePy_EndInterpreter: not the last threadPyThreadState_DeleteCurrent: no current tstatePyThreadState_Get: no current thread__PyCodeExtraState_Get: no code state for interpreterCouldn't create thread-state for new threadauto-releasing thread-state, but no thread-state for this threadThis thread state must be current when releasingwith Barry as BDFL, use '<>' instead of '!='EOF while scanning triple-quoted string literalEOL while scanning string literalinconsistent use of tabs and spaces in indentationunindent does not match any outer indentation leveltoo many levels of indentationunexpected character after line continuation characterinvalid character in identifiermultiple statements found while compiling a single statementPy_Initialize: can't import _frozen_importlibimport _frozen_importlib # frozen Py_Initialize: couldn't get _frozen_importlib from sys.modulesPy_Initialize: __import__ not foundPy_Initialize: can't import _impPy_Initialize: can't save _imp to sys.modulesPy_Initialize: importlib install failedFailed to import the site module Py_NewInterpreter: call Py_Initialize firstPy_Initialize: can't set preliminary stderrPy_Initialize: can't initialize sys standard streamspython: Can't reopen .pyc file python: failed to set __main__.__loader__ timestamp out of range for platform time_tInvalid value NaN (not a number)timestamp too large to convert to C _PyTime_tclock_gettime(CLOCK_MONOTONIC)/dev/urandom (or equivalent) not foundFailed to read %zi bytes from /dev/urandomPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]failed to get random numbers to initialize PythonPy_Initialize: can't make first interpreterPy_Initialize: can't make first threadPy_Initialize: can't init framesPy_Initialize: can't init longsPy_Initialize: can't init bytearrayPy_Initialize: can't init floatPy_Initialize: can't make modules dictionaryPy_Initialize: can't initialize unicodePy_Initialize: can't initialize structseqPy_Initialize: can't initialize builtins modulesPy_Initialize: can't initialize builtins dictPy_Initialize: can't initialize sysPy_Initialize: can't initialize sys dictPy_Initialize: can't initialize timePy_Initialize: can't initialize faulthandlerPy_Initialize: unable to load the file system codecPy_Initialize: can't import signalPy_Initialize: can't initialize tracemalloc'import warnings' failed; traceback: unexpected binary operation %d on a constantunexpected unary operation %d on a constantpython3eA& .>filesystem encoding is not initializedsys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.getswitchinterval() instead.can't delete numeric/char attributeattribute value type must be boolTruncation of value to unsigned charTruncation of value to unsigned shortWriting negative value into unsigned fieldTruncation of value to unsigned intBUG: internal directive bookkeeping brokenname '%U' is parameter and globalname '%U' is nonlocal and globalname '%U' is parameter and nonlocalnonlocal declaration not allowed at module levelno binding for nonlocal '%U' foundduplicate argument '%U' in function definitionmaximum recursion depth exceeded during compilationannotated name '%U' can't be globalannotated name '%U' can't be nonlocalname '%U' is used prior to global declarationname '%U' is assigned to before global declarationname '%U' is used prior to nonlocal declarationname '%U' is assigned to before nonlocal declarationthis compiler does not handle Suites [Previous line repeated %ld more times] [Previous line repeated %ld more time] sys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.setswitchinterval() instead.switch interval must be strictly positiverecursion limit must be greater or equal than 1cannot set the recursion limit to %i at the recursion depth %i: the limit is too lowcallable finalizer expected, got %.50scallable firstiter expected, got %.50sType %.100s doesn't define __sizeof____sizeof__() should return >= 0Python error: is a directory, cannot continue /builddir/build/BUILD/Python-3.6.15/Python/traceback.cTraceback (most recent call last): Stack (most recent call first): unable to get the interpreter stateunable to get the thread head stateHook to intercept first iterationHook to intercept finalization'alpha', 'beta', 'candidate', or 'final'width of the type used for hashing, in bitsprime number giving the modulus on which the hash function is basedvalue to be used for hash of a positive infinityvalue to be used for hash of a nanmultiplier used for the imaginary part of a complex numbername of the algorithm for hashing of str, bytes and memoryviewsinternal output size of hash algorithmsmall string optimization cutoffbad memberdescr typereadonly attributeTruncation of value to charTruncation of value to shortTruncation of value to intbad memberdescr type for %sunknown symbol table entry(Nii)[ssss].%d_[%d]genexprlistcompsetcompdictcomplost builtins moduleU:interncan't intern %.400si:setcheckintervali:setdlopenflags|i:_getframecall stack is not deep enoughd:setswitchintervali:setrecursionlimitcallable expected, got %.50s|OOO|O:getsizeofOO!:call_tracingcan't create sys.pathcan't assign sys.pathno mem for sys.path insertionsys.path.insert(0) failedno mem for sys.argvcan't assign sys.argv... truncated__displayhook____excepthook__hexversionCPython(szz)_gitdont_write_bytecodeapi_versioncopyrightplatformexecutablebase_prefixbase_exec_prefixmaxsizemaxunicodebuiltin_module_namesabiflags_xoptionsfinalcache_tagx86_64-linux-gnu_multiarchimplementationfloat_repr_stylewarnoptionstracebacklimit File "%U", line %d, in %U \x\u\U ... File in Current thread 0xThread 0x (most recent call first): firstiterfinalizer-dinspect-iinteractive-O or -OO-Bno_user_site-sno_site-Signore_environment-Everbose-vbytes_warning-bquiet-qhash_randomization-Risolated-IMajor release numberMinor release numbermicroPatch release numberreleaselevelserialSerial release numberwidthmodulusinfnanhash_bitsseed_bitsseed size of hash algorithmcutoffcallstats_clear_type_cache_current_framesexc_infogetdefaultencodinggetdlopenflagsgetallocatedblocksgetfilesystemencodinggetfilesystemencodeerrorsgetrefcountgetrecursionlimitis_finalizinggetcheckintervalgetswitchintervalsetprofilegetprofilesettracegettrace_debugmallocstatsset_coroutine_wrapperget_coroutine_wrapperset_asyncgen_hooksget_asyncgen_hookscpythonsys.flagssys.version_infosys.hash_infoc_callc_exceptionc_returnxhP0  @ | e ,   d D t   < d T T *+T141D00|/4/..D.t*.--l--**,t,*****,*T++,,f2p9@886:78@676(75h5444X443832H2-c-mư>----helpr home =os.pyLibrb--versionpyvenv.cfgModules/Setuplib64/python00.zippybuilddir.txtlib64/lib-dynloadbBc:dEhiIJm:OqRsStuvVW:xX:?__main__-J is reserved for Jython Unknown option: -%c sem_initsem_destroysem_timedwaitsem_trywaitsem_waitsem_postInfinityNaN%+.02dInvalid format specifier646ansi_x3.4_1968ansi_x3.4_1986ansi_x3_4_1968cp367csasciiibm367iso646_usiso_646.irv_1991iso_ir_6POSIXfailed to get LC_CTYPE localeunknown dlopen() error./%-.255s%.20s_%.200spthreadsemaphorePYTHONPATH/opt/alt/python36lib64/python3.6runpy_run_module_as_mainPYTHONMALLOC/lib/pythonX.XPython %s PYTHONNOUSERSITEPYTHONWARNINGS,Python %s on %s PYTHONSTARTUPCould not open PYTHONSTARTUP unable to get sys.pathsys.thread_infoINFNANArgument expected for the -%c option could not convert string to %s: %Rcould not convert string to float: %.200svalue too large to convert to float: %.200s/builddir/build/BUILD/Python-3.6.15/Python/pystrtod.cCannot specify both ',' and '_'.Format specifier missing precisionCannot specify '%c' with '%c'.Cannot specify '%c' with '\x%x'.Sign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierUnknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'Precision not allowed in integer format specifierSign not allowed with integer format specifier 'c'Alternate form (#) not allowed with integer format specifier 'c'Zero padding is not allowed in complex format specifier'=' alignment flag is not allowed in complex format specifierbuffer overflow in getpath.c's joinpath()Unable to decode path variables in getpath.c: memory error/builddir/build/BUILD/Python-3.6.15Could not find platform independent libraries Could not find platform dependent libraries Consider setting $PYTHONHOME to [:] Not enough memory for dynamic PYTHONPATHFailed calling sys.__interactivehook__ Could not import runpy module Could not access runpy._run_module_as_main Could not convert module name to unicode Could not create arguments for runpy._run_module_as_main Error in PYTHONMALLOC: unknown allocator "%s"! not enough memory to copy -c argumentfailure in handling of -W argumentTry `python -h' for more information. not enough memory to copy PYTHONWARNINGSType "help", "copyright", "credits" or "license" for more information.Failed checking if argv[0] is an import path entry Unable to decode the command from the command line: %ls: '%ls' is a directory, cannot continue %ls: can't open file '%s': [Errno %d] %s name of the thread implementationname of the lock implementationname and version of the thread library @00`0`00`0`0 0`0`0`01`0`0`0`0`00`0`0 01`0`01H101`0`0`0`0`0`0`0`0`0H2`082`0`0`002`0`0`0`0`0`0`02`01 011`02PYTHONHASHSEED: if this variable is set to 'random', a random value is used to seed the hashes of str, bytes and datetime objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. PYTHONMALLOC: set the Python memory allocators and/or install debug hooks on Python memory allocators. Use PYTHONMALLOC=debug to install debug hooks. PYTHONHOME : alternate directory (or %lc). The default module search path uses %s. PYTHONCASEOK : ignore case in 'import' statements (Windows). PYTHONIOENCODING: Encoding[:errors] used for stdin/stdout/stderr. PYTHONFAULTHANDLER: dump the Python traceback on fatal errors. file : program read from script file - : program read from stdin (default; interactive mode if a tty) arg ...: arguments passed to program in sys.argv[1:] Other environment variables: PYTHONSTARTUP: file executed on interactive startup (no default) PYTHONPATH : '%lc'-separated list of directories prefixed to the default module search path. The result is sys.path. -u : force the binary I/O layers of stdout and stderr to be unbuffered; stdin is always buffered; text I/O layer will be line-buffered; also PYTHONUNBUFFERED=x -v : verbose (trace import statements); also PYTHONVERBOSE=x can be supplied multiple times to increase verbosity -V : print the Python version number and exit (also --version) when given twice, print more information about the build -W arg : warning control; arg is action:message:category:module:lineno also PYTHONWARNINGS=arg -x : skip first line of source, allowing use of non-Unix forms of #!cmd -X opt : set implementation-specific option -i : inspect interactively after running script; forces a prompt even if stdin does not appear to be a terminal; also PYTHONINSPECT=x -I : isolate Python from the user's environment (implies -E and -s) -m mod : run library module as a script (terminates option list) -O : remove assert and __debug__-dependent statements; add .opt-1 before .pyc extension; also PYTHONOPTIMIZE=x -OO : do -O changes and also discard docstrings; add .opt-2 before .pyc extension -q : don't print version and copyright messages on interactive startup -s : don't add user site directory to sys.path; also PYTHONNOUSERSITE -S : don't imply 'import site' on initialization Options and arguments (and corresponding environment variables): -b : issue warnings about str(bytes_instance), str(bytearray_instance) and comparing bytes/bytearray with str. (-bb: issue errors) -B : don't write .pyc files on import; also PYTHONDONTWRITEBYTECODE=x -c cmd : program passed in as string (terminates option list) -d : debug output from parser; also PYTHONDEBUG=x -E : ignore PYTHON* environment variables (such as PYTHONPATH) -h : print this help message and exit (also --help) usage: %ls [option] ... [-c cmd | -m mod | file | -] [arg] ... /:   ؗҜ<3#I9=D2[%Cod(h7yACnF?O8M20HwZ uncollectablegc: done, %.4fs elapsed garbage collectioncollected{sisnsn}(iii){snsnsn}invalid generationi:set_debugi|ii:set_thresholdgarbageDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_SAVEALLDEBUG_LEAK %s release unlocked lockkltimeout|iO:acquiretimeout value is too largeunlocked<%s %s object at %p>(kl):_acquire_restorecouldn't acquire lockthread.local.%pno current thread identstart_new_threadfirst arg must be callable2nd arg must be a tuplecan't start new thread|n:stack_sizesize not valid: %zd bytesTIMEOUT_MAXLockTypeuid is less than minimumuid is greater than maximumgid is less than minimumgid is greater than maximumfd is greater than maximumfd is less than minimumstring, bytes or os.PathLikesched_priority out of range|i:stat_float_timessO&:getgrouplistO&O&:initgroupsiiO&:sched_setscheduleriO&:sched_setparamO&O:execvtoo many groupsgroups must be integersresourceNiNO&|$O&:readlinkiiOn:sendfile|$p:DirEntry.stat|$p:DirEntry.is_dir|$p:DirEntry.is_file|O&:scandiri:get_blockingii:set_blockingunclosed scandir iterator %Rfollow_symlinkssrci:ttynamei:nicei:umaski:sched_getscheduleri:sched_getparami:sched_rr_get_interval%s=%s(Ni)iO:sched_setaffinitynegative CPU numberCPU number too largei:sched_getaffinity(ii)sched_prioritypolicycommandsrc_dir_fddst_dir_fdwhichwhoeffective_idsis_symlinkinode__fspath__start_newallocate_lockexit_threadinterrupt_mainget_ident_set_sentinel_is_owned_release_savelocked_lockdisableisenabledget_debugget_countget_thresholdcollectget_objectsget_statsis_trackedget_referrersget_referentsO:sched_parami:sched_get_priority_mini:sched_get_priority_maxO&OO:execvei:_exitO&|O$OO&p:utimeO&|$O&:removeO&|$O&:unlinkO&:systemO&|$O&:rmdirO&O&|$O&O&:replaceO&O&|$O&O&:renameiii:setpriorityii:getpriorityO&|i$O&:mkdir|O&:listdirO&O&|$O&O&p:linkO&O&O&:lchowniO&O&:fchownO&O&O&|$O&p:chownO&:fdatasyncO&:fsyncO&:chrootii:fchmodO&i|$O&p:chmodO&:fchdirO&:chdirO&i|$O&pp:accessO&|$O&:lstatO&|$O&p:statposix.ScandirIteratorposix.DirEntrySC_2_CHAR_TERMSC_2_C_BINDSC_2_C_DEVSC_2_C_VERSIONSC_2_FORT_DEVSC_2_FORT_RUNSC_2_LOCALEDEFSC_2_SW_DEVSC_2_UPESC_2_VERSIONSC_AIO_LISTIO_MAXSC_AIO_MAXSC_AIO_PRIO_DELTA_MAXSC_ARG_MAXSC_ASYNCHRONOUS_IOSC_ATEXIT_MAXSC_AVPHYS_PAGESSC_BC_BASE_MAXSC_BC_DIM_MAXSC_BC_SCALE_MAXSC_BC_STRING_MAXSC_CHARCLASS_NAME_MAXSC_CHAR_BITSC_CHAR_MAXSC_CHAR_MINSC_CHILD_MAXSC_CLK_TCKSC_COLL_WEIGHTS_MAXSC_DELAYTIMER_MAXSC_EQUIV_CLASS_MAXSC_EXPR_NEST_MAXSC_FSYNCSC_GETGR_R_SIZE_MAXSC_GETPW_R_SIZE_MAXSC_INT_MAXSC_INT_MINSC_IOV_MAXSC_JOB_CONTROLSC_LINE_MAXSC_LOGIN_NAME_MAXSC_LONG_BITSC_MAPPED_FILESSC_MB_LEN_MAXSC_MEMLOCKSC_MEMLOCK_RANGESC_MEMORY_PROTECTIONSC_MESSAGE_PASSINGSC_MQ_OPEN_MAXSC_MQ_PRIO_MAXSC_NGROUPS_MAXSC_NL_ARGMAXSC_NL_LANGMAXSC_NL_MSGMAXSC_NL_NMAXSC_NL_SETMAXSC_NL_TEXTMAXSC_NPROCESSORS_CONFSC_NPROCESSORS_ONLNSC_NZEROSC_OPEN_MAXSC_PAGESIZESC_PAGE_SIZESC_PASS_MAXSC_PHYS_PAGESSC_PIISC_PII_INTERNETSC_PII_INTERNET_DGRAMSC_PII_INTERNET_STREAMSC_PII_OSISC_PII_OSI_CLTSSC_PII_OSI_COTSSC_PII_OSI_MSC_PII_SOCKETSC_PII_XTISC_POLLSC_PRIORITIZED_IOSC_PRIORITY_SCHEDULINGSC_REALTIME_SIGNALSSC_RE_DUP_MAXSC_RTSIG_MAXSC_SAVED_IDSSC_SCHAR_MAXSC_SCHAR_MINSC_SELECTSC_SEMAPHORESSC_SEM_NSEMS_MAXSC_SEM_VALUE_MAXSC_SHARED_MEMORY_OBJECTSSC_SHRT_MAXSC_SHRT_MINSC_SIGQUEUE_MAXSC_SSIZE_MAXSC_STREAM_MAXSC_SYNCHRONIZED_IOSC_THREADSSC_THREAD_ATTR_STACKADDRSC_THREAD_ATTR_STACKSIZESC_THREAD_KEYS_MAXSC_THREAD_PRIORITY_SCHEDULINGSC_THREAD_PRIO_INHERITSC_THREAD_PRIO_PROTECTSC_THREAD_PROCESS_SHAREDSC_THREAD_SAFE_FUNCTIONSSC_THREAD_STACK_MINSC_THREAD_THREADS_MAXSC_TIMERSSC_TIMER_MAXSC_TTY_NAME_MAXSC_TZNAME_MAXSC_T_IOV_MAXSC_UCHAR_MAXSC_UINT_MAXSC_UIO_MAXIOVSC_ULONG_MAXSC_USHRT_MAXSC_VERSIONSC_WORD_BITSC_XBS5_ILP32_OFF32SC_XBS5_ILP32_OFFBIGSC_XBS5_LP64_OFF64SC_XBS5_LPBIG_OFFBIGSC_XOPEN_CRYPTSC_XOPEN_ENH_I18NSC_XOPEN_LEGACYSC_XOPEN_REALTIMESC_XOPEN_REALTIME_THREADSSC_XOPEN_SHMSC_XOPEN_UNIXSC_XOPEN_VERSIONSC_XOPEN_XCU_VERSIONSC_XOPEN_XPG2SC_XOPEN_XPG3SC_XOPEN_XPG4CS_GNU_LIBC_VERSIONCS_GNU_LIBPTHREAD_VERSIONCS_LFS64_CFLAGSCS_LFS64_LDFLAGSCS_LFS64_LIBSCS_LFS64_LINTFLAGSCS_LFS_CFLAGSCS_LFS_LDFLAGSCS_LFS_LIBSCS_LFS_LINTFLAGSCS_PATHCS_XBS5_ILP32_OFF32_CFLAGSCS_XBS5_ILP32_OFF32_LDFLAGSCS_XBS5_ILP32_OFF32_LIBSCS_XBS5_ILP32_OFF32_LINTFLAGSCS_XBS5_ILP32_OFFBIG_CFLAGSCS_XBS5_ILP32_OFFBIG_LDFLAGSCS_XBS5_ILP32_OFFBIG_LIBSCS_XBS5_LP64_OFF64_CFLAGSCS_XBS5_LP64_OFF64_LDFLAGSCS_XBS5_LP64_OFF64_LIBSCS_XBS5_LP64_OFF64_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_CFLAGSCS_XBS5_LPBIG_OFFBIG_LDFLAGSCS_XBS5_LPBIG_OFFBIG_LIBSPC_ASYNC_IOPC_CHOWN_RESTRICTEDPC_FILESIZEBITSPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_PRIO_IOPC_SOCK_MAXBUFPC_SYNC_IOPC_VDISABLEPC_ALLOC_SIZE_MINPC_REC_INCR_XFER_SIZEPC_REC_MAX_XFER_SIZEPC_REC_MIN_XFER_SIZEPC_REC_XFER_ALIGNPC_SYMLINK_MAXstruct_rusage_thread.RLock_thread._localThread-local data_localdummy_destroyed_thread._localdummyThread-local dummy_thread.lockgc: collecting generation %d... gc: objects in each generation:gc: done, %zd unreachable, %zd uncollectablegc couldn't create gc.garbage listunexpected exception during garbage collectiongc: %zd uncollectable objects at shutdowngc: %zd uncollectable objects at shutdown; use gc.set_debug(gc.DEBUG_UNCOLLECTABLE) to list them/builddir/build/BUILD/Python-3.6.15/Modules/gcmodule.ccannot release un-acquired lockcan't specify a timeout for a non-blocking calltimeout value must be positive<%s %s object owner=%ld count=%lu at %p>Internal lock count overflowedCouldn't get thread-state dictionaryInitialization arguments are not supportedUnhandled exception in thread started by optional 3rd arg must be a dictionarysize must be 0 or a positive valuesetting stack size not supporteduid should be integer, not %.200sgid should be integer, not %.200sargument should be integer or None, not %.200sstring, bytes, os.PathLike, integer or Nonestring, bytes, os.PathLike or integerstring, bytes, os.PathLike or None%s%s%s should be %s, not %.200s%s%sembedded null character in %sexpected str, bytes or os.PathLike object, not %.200sexpected %.200s.__fspath__() to return str or bytes, not %.200smust have a sched_param objectstat_float_times() is deprecated%s: src and dst must be the same typeexecv() arg 2 must be a tuple or listexecv() arg 2 must not be emptyexecv() arg 2 first element cannot be emptysetgroups argument must be a sequenceconfiguration names must be strings or integersunrecognized configuration name%s: cannot use dir_fd and follow_symlinks together%s%s%s unavailable on this platform%s: can't specify both dir_fd and fd%s: cannot use fd and follow_symlinks togetherlink: src and dst must be the same typeutime: you may specify either 'times' or 'ns' but not bothutime: 'times' must be either a tuple of two ints or Noneutime: 'ns' must be a tuple of two ints%s: can't specify dir_fd without matching pathexecve: argv must be a tuple or listexecve: argv must not be emptyexecve: environment must be a mapping objectexecve: argv first element cannot be emptyenv.keys() or env.values() is not a listillegal environment variable nameexpected an iterator of ints, but iterator yielded %Rcould not allocate a large enough CPU setthe entry's base filename, relative to scandir() "path" argumentthe entry's full path name; equivalent to os.path.join(scandir_path, entry.name)return True if the entry is a directory; cached per entryreturn True if the entry is a file; cached per entryreturn True if the entry is a symbolic link; cached per entryreturn stat_result object for the entry; cached per entryreturn inode of the entry; cached per entryreturns the path for the entrySC_THREAD_DESTRUCTOR_ITERATIONSCS_XBS5_ILP32_OFFBIG_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_LINTFLAGS쵠ƠBunable to determine login nameLoad averages are unobtainablesymlink: src and dst must be the same typewritev() arg 2 must be a sequencereadv() arg 2 must be a sequencestrerror() argument out of rangegetpwnam(): name not found: %Rname of machine on network (implementation-defined)elapsed time since an arbitrary point in the pastwidth of the terminal window in charactersheight of the terminal window in charactersinteger time of last modificationtime of last access in nanosecondstime of last modification in nanosecondstime of last change in nanosecondsin:killii:killpgO&O&:setreuidO&O&:setregidii:setpgidii:tcsetpgrpiO&:ftruncateO&O&O&:setresuidO&O&O&:setresgidO&:setuidO&:seteuidO&:setegidO&:setgidi:getsidi:tcgetpgrpO&:confstrii:closerangeiiO&:lockfiO&O&:posix_fallocateiO&O&i:posix_fadvisei:fstatvfsiii:waitidiO&i:lseekiO&:fpathconfO&:sysconfii:waitpidNii:pipe2dddii:set_inheritablei:dupin:readiiO&:preadiO:writeviO:readviy*O&:pwriteiy*:writei:isattyi:WCOREDUMPO&:majorO&:minorii:makedevO&O&:putenvO&:unsetenvi:strerrorn:urandomi:get_inheritableHAVE_FACCESSATF_OKR_OKW_OKTMP_MAXWCONTINUEDWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NDELAYO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_LARGEFILEO_PATHO_TMPFILEPRIO_PROCESSPRIO_PGRPPRIO_USERO_CLOEXECO_ACCMODESEEK_HOLESEEK_DATAO_ASYNCO_DIRECTO_DIRECTORYO_NOFOLLOWO_NOATIMEEX_OKEX_USAGEEX_DATAERREX_NOINPUTEX_NOUSEREX_NOHOSTEX_UNAVAILABLEEX_SOFTWAREEX_OSERREX_OSFILEEX_CANTCREATEX_IOERREX_TEMPFAILEX_PROTOCOLEX_NOPERMEX_CONFIGST_RDONLYST_NOSUIDST_NODEVST_NOEXECST_SYNCHRONOUSST_MANDLOCKST_WRITEST_APPENDST_NOATIMEST_NODIRATIMEST_RELATIMEPOSIX_FADV_NORMALPOSIX_FADV_SEQUENTIALPOSIX_FADV_RANDOMPOSIX_FADV_NOREUSEPOSIX_FADV_WILLNEEDPOSIX_FADV_DONTNEEDP_PIDP_PGIDP_ALLWEXITEDWNOWAITWSTOPPEDCLD_EXITEDCLD_DUMPEDCLD_TRAPPEDCLD_CONTINUEDF_LOCKF_TLOCKF_ULOCKF_TESTSCHED_OTHERSCHED_FIFOSCHED_RRSCHED_BATCHSCHED_IDLESCHED_RESET_ON_FORKXATTR_CREATEXATTR_REPLACEXATTR_SIZE_MAXRTLD_LAZYRTLD_NOWRTLD_GLOBALRTLD_LOCALRTLD_NODELETERTLD_NOLOADRTLD_DEEPBINDGRND_RANDOMGRND_NONBLOCKconfstr_namessysconf_namesposix.times_resultposix.waitid_resultos.stat_resultos.statvfs_resultposix.sched_paramposix.uname_result_have_functionspathconf_namesenvirongetpwuid(): uid not foundgetpwuid(): uid not found: %SerrorcodeENODEVENOCSIEHOSTUNREACHENOMSGEUCLEANEL2NSYNCEL2HLTENODATAENOTBLKENOSYSEPIPEEINVALEOVERFLOWEADVEINTREUSERSENOTEMPTYENOBUFSEPROTOEREMOTEENAVAILECHILDELOOPEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEBADREHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEBADFDEDOTDOTEISCONNENOANOESHUTDOWNECHRNGELIBBADENONETEBADEEBADFEMULTIHOPEUNATCHEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNENOTNAMEACCESELNRNGEILSEQENOTDIRENOTUNIQEPERMEDOMEXFULLECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILEIDRMECOMMESRMNTEREMOTEIOEL3RSTEBADMSGENFILEELIBMAXESPIPEENOLINKENETRESETETIMEDOUTENOENTEEXISTEDQUOTENOSTREBADSLTEBADRQCELIBACCEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQELIBSCNENOLCKEISNAMECONNABORTEDENETUNREACHESTALEENOSRENOMEMENOTSOCKESTRPIPEEMLINKERANGEELIBEXECEL3HLTECONNRESETEADDRINUSEEOPNOTSUPPEREMCHGEAGAINENAMETOOLONGENOTTYERESTARTESOCKTNOSUPPORTETIMEEBFONTEDEADLOCKETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIOENOPKGENOMEDIUMEMEDIUMTYPEECANCELEDENOKEYEKEYEXPIREDEKEYREVOKEDEKEYREJECTEDEOWNERDEADENOTRECOVERABLEERFKILLENOTSUPU:getpwnampw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programgetpwuidgetpwallsysnameoperating system namenodenameoperating system releaseoperating system versionmachinehardware identifieruser timesystem timechildren_useruser time of childrenchildren_systemsystem time of childrenelapsedcolumnsthe scheduling priorityf_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxst_modeprotection bitsst_inost_devdevicest_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last changest_atimest_mtimetime of last modificationst_ctimest_atime_nsst_mtime_nsst_ctime_nsst_blksizeblocksize for filesystem I/Ost_blocksnumber of blocks allocatedst_rdevdevice type (if inode device)si_pidsi_uidsi_signosi_statussi_codectermidgetcwdgetcwdbunamesched_yieldopenptyforkptygetegidgeteuidgetgidgetgroupsgetpidgetppidgetuidgetloginsetgroupssetsidpipeabortgetloadavggetresuidgetresgidget_terminal_sizecpu_countfd2target_is_directorypwd.struct_passwdHAVE_FCHDIRHAVE_FCHMODHAVE_FCHMODATHAVE_FCHOWNHAVE_FCHOWNATHAVE_FEXECVEHAVE_FDOPENDIRHAVE_FPATHCONFHAVE_FSTATATHAVE_FSTATVFSHAVE_FTRUNCATEHAVE_FUTIMENSHAVE_FUTIMESHAVE_FUTIMESATHAVE_LINKATHAVE_LCHOWNHAVE_LSTATHAVE_LUTIMESHAVE_MKDIRATHAVE_MKFIFOATHAVE_MKNODATHAVE_OPENATHAVE_READLINKATHAVE_RENAMEATHAVE_SYMLINKATHAVE_UNLINKATHAVE_UTIMENSATos.terminal_sizen|i:getrandomO:fspath|O&$p:listxattrO&O&|$p:removexattrO&O&y*|i$p:setxattrO&O&|$p:getxattri:device_encodingO&O&:pathconfO&:statvfsi:WSTOPSIGi:WTERMSIGi:WEXITSTATUSi:WIFEXITEDi:WIFSIGNALEDi:WIFSTOPPEDi:WIFCONTINUEDO&O&:truncateO&|iO&$O&:mknodO&|i$O&:mkfifoi:fstatii|p:dup2i:closeO&i|i$O&:openO&O&|p$O&:symlinkii:wait4i:wait3i:getpgid Pp(0 hhhhhhhhhH hhhhhhhhhhhhhhhhhLLLLLLLLLLLLLLLLDLLL|<\,!DDDD\ \|DDDd '<4\L{#${# &&$$%%7&$112211111111111$2111l231112266P6666666666666666666666777788:P977778:8P8P8p;777:7777770:777dioiqnxnnepee0plhdj`iPiPij0jpjjpkooeeXlmeppxdhedefg0gPgghPhhhscusXqwhwHu=u!vuvuxHX8(P@@@X؋h@@@h80X؈H:˗-xX P SRE 2.2.2 Copyright (c) 1997-2002 by Secret Labs AB maximum recursion limit exceededinternal error in regular expression enginecannot copy this pattern objectexpected string or bytes-like objectcannot use a string pattern on a bytes-like objectcannot use a bytes pattern on a string-like objectArgument given by name ('%s') and position (1)The '%s' keyword parameter name is deprecated. Use 'string' instead.Required argument 'string' (pos 1) not found<%s object; span=(%d, %d), match=%.50R>cannot deepcopy this pattern objectcannot deepcopy this match objectregular expression code size limit exceededsplit() requires a non-empty pattern match.A dictionary mapping group names to group numbers.cannot copy this match objectBuffer is NULLno such group0x%xre.compile(%.200R, %S)re.compile(%.200R)ii:getlower_expandinvalid SRE codespanMAGICCODESIZEMAXREPEATMAXGROUPSs:lookups:_forget_codecs*|z:escape_decodeNnO!|z:escape_encodestring is too large to encodeO|z:unicode_internal_decodey*|zi:utf_7_decodey*|zi:utf_8_decodepattern_subxgetcodesizelastindexlastgroupregsendpos__copy__memotemplategroupindexindexgroupreplO|ss:decodeO|ss:encode_sre.SRE_MatchO:__deepcopy__|O:groupdict|O:groupsO:expandOiO!nOO:compileOO|n:subnOO|n:sub|On$O:splitO|nn:scannerO|nn:finditer|Onn$O:findall|Onn$O:search|Onn$O:fullmatch|Onn$O:match_sre.SRE_Pattern_sre.SRE_Scannerre.TEMPLATEre.IGNORECASEre.LOCALEre.MULTILINEre.DOTALLre.UNICODEre.VERBOSEre.DEBUGre.ASCIIy*|zi:utf_16_decodey*|zi:utf_16_le_decodey*|zi:utf_16_be_decodey*|zii:utf_16_ex_decodeNniy*|zi:utf_32_decodey*|zi:utf_32_le_decodey*|zi:utf_32_be_decodey*|zii:utf_32_ex_decodes*|z:unicode_escape_decodey*|z:latin_1_decodey*|z:ascii_decodey*|zO:charmap_decodes*|z:readbuffer_encodeO|z:unicode_internal_encodeU|z:utf_7_encodeU|z:utf_8_encodeU|zi:utf_16_encodeU|z:utf_16_le_encodeU|z:utf_16_be_encodeU|zi:utf_32_encodeU|z:utf_32_le_encodeU|z:utf_32_be_encodeU|z:unicode_escape_encodeU|z:raw_unicode_escape_encodeU|z:latin_1_encodeU|z:ascii_encodeU|zO:charmap_encodeU:charmap_buildsO:register_errors:lookup_errorO!O:_remove_dead_weakrefnot a weakrefdeque index out of rangeis_is_notReferenceTypeCallableProxyTypeop_concat%U, %R%U, %S=%R%s(%R%U)defaultdict(%U, %U)O(O)(OOOO)invalid partial stateO:KO:cmp_to_keyop_ltop_leop_eqop_neop_gtop_gereduceOOpO:lru_cachennOnOO:compare_digestop_addop_subop_mulop_matmulop_floordivop_truedivop_modop_lshiftop_rshiftop_and_op_xorop_or_op_iaddop_isubop_imulop_imatmulop_ifloordivop_itruedivop_imodop_ilshiftop_irshiftop_iandop_ixorop_iorop_iconcatop_containsindexOfcountOfop_getitemop_delitemop_setitemipowO|n:length_hintO!|nitemgetter()O(O)method name must be a stringattrgetter()%U=%R%s(%R, %U)O()NNO(()n)NNpop from an empty deque|n:rotatedeque(%R, maxlen=%zd)deque(%R)%R is not in dequemaxlendeque()|OO:dequemaxlen must be non-negativeappendleftextendleftpoplefttruthis_(a, b) -- Same as a is b.add(a, b) -- Same as a + b.sub(a, b) -- Same as a - b.mul(a, b) -- Same as a * b.mod(a, b) -- Same as a % b.negneg(a) -- Same as -a.pos(a) -- Same as +a.abs(a) -- Same as abs(a).invinv(a) -- Same as ~a.invertinvert(a) -- Same as ~a.not_not_(a) -- Same as not a.and_(a, b) -- Same as a & b.xor(a, b) -- Same as a ^ b.or_(a, b) -- Same as a | b.pow(a, b) -- Same as a ** b.lt(a, b) -- Same as ab.ge(a, b) -- Same as a>=b._compare_digestcache_infocache_cleargetweakrefcountgetweakrefsraw_unicode_escape_decode_collections._deque_iteratorcollections.dequeoperator.methodcalleroperator.attrgetteroperator.itemgetterfunctools._lru_cache_wrapperuser_functiontypedcache_info_typefunctools._lru_list_elemmycmpfunctools.KeyWrapperfunctools.partials*|z:raw_unicode_escape_decodedeque mutated during iterationtype 'partial' takes at least one argumentthe first argument must be callableother argument must be K instancereduce() arg 2 must support iterationreduce() of empty sequence with no initial valuemaxsize should be integer or Nonecomparing strings with non-ASCII characters is not supportedunsupported operand types(s) or combination of types: '%.100s' and '%.100s'Buffer must be single dimensionmethodcaller needs at least one argument, the method nameattribute name must be a stringkeywords dict changed size during iterationdeque already at its maximum size%.200s() must return a deque, not %.200scan only concatenate deque (not "%.200s") to dequedeque mutated during remove().deque.remove(x): x not in dequefirst argument must be callable or Nonemaximum size of a deque or None if unboundedtruth(a) -- Return True if a is true, False otherwise.contains(a, b) -- Same as b in a (note reversed operands).indexOf(a, b) -- Return the first index of b in a.countOf(a, b) -- Return the number of times b occurs in a.is_not(a, b) -- Same as a is not b.index(a) -- Same as a.__index__()matmul(a, b) -- Same as a @ b.floordiv(a, b) -- Same as a // b.truediv(a, b) -- Same as a / b.lshift(a, b) -- Same as a << b.rshift(a, b) -- Same as a >> b.a = iadd(a, b) -- Same as a += b.a = isub(a, b) -- Same as a -= b.a = imul(a, b) -- Same as a *= b.a = imatmul(a, b) -- Same as a @= b.a = ifloordiv(a, b) -- Same as a //= b.a = itruediv(a, b) -- Same as a /= ba = imod(a, b) -- Same as a %= b.a = ilshift(a, b) -- Same as a <<= b.a = irshift(a, b) -- Same as a >>= b.a = iand(a, b) -- Same as a &= b.a = ixor(a, b) -- Same as a ^= b.a = ior(a, b) -- Same as a |= b.concat(a, b) -- Same as a + b, for a and b sequences.a = iconcat(a, b) -- Same as a += b, for a and b sequences.getitem(a, b) -- Same as a[b].setitem(a, b, c) -- Same as a[b] = c.delitem(a, b) -- Same as del a[b].a = ipow(a, b) -- Same as a **= b.Value wrapped by a key function.function object to use in future partial callstuple of arguments to future partial callsdictionary of keyword arguments to future partial calls_collections._deque_reverse_iteratorWeak-reference support module.@@@@@@_count_elementssigtimedwait_deque_reverse_iteratorO|O:groupbyO|O:accumulateOO:compressO(OO)(OOO)O(())(Oi)O(OO)lO()(OO)O()(O)O(n)state is not a tupleOO!OInvalid argumentsO!iIndex out of rangeArguments must be iterators.O(ONO)O(N)(Oi)O(O)(Oi)O|nn must be >= 0ONOcycle()dropwhile()takewhile()starmap()chain()filterfalse()invalid argumentsO!O!islice()O(Nn)nO(OnNn)nOONO(()n)O(On)NO(On)(NN)|n:productrepeat argument too largeOn:combinationsr must be non-negativeO|O:permutationsExpected int as r(O)OO(NiO)O(OO)O|OO:counta number is requiredcount(%zd)count(%R)count(%R, %R)repeat(%R)repeat(%R, %zd)O|n:repeatlen() of unsized objectfillvaluei:alarmi:getsignalsignal number out of rangeiO:pthread_sigmaskii:siginterruptid|d:setitimeri:getitimeri:set_wakeup_fdSIG_DFLSIG_IGNNSIGSIG_BLOCKSIG_UNBLOCKSIG_SETMASKdefault_int_handlerSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGCHLDSIGPWRSIGIOSIGURGSIGWINCHSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOUSIGVTALRMSIGPROFSIGXCPUSIGXFSZSIGRTMINSIGRTMAXITIMER_REALITIMER_VIRTUALITIMER_PROFsignal.ItimerErroriO:signalli:pthread_killmode out of rangesignal numbersignal codesi_errnosending process IDexit value or signalsi_bandband event for SIGPOLLpausesigpendingsigwaitsigwaitinfo_run_exitfuncs_ncallbacksfrom_iterabledefault_factorysignal.struct_siginfoitertools.repeatitertools.productitertools.permutationsitertools.zip_longestitertools.countitertools.compressitertools.combinationsitertools.accumulateitertools.filterfalseselectorsitertools.chainitertools.starmapitertools.isliceitertools.takewhileitertools.dropwhileitertools.cycleitertools._teeitertools._tee_dataobjectitertools.groupbyitertools._groupercollections.defaultdictStop argument for islice() must be None or an integer: 0 <= x <= sys.maxsize.Indices for islice() must be None or an integer: 0 <= x <= sys.maxsize.Step for islice() must be a positive integer or None.repeat argument cannot be negativeOn:combinations_with_replacementsignal number %ld out of rangezip_longest() got an unexpected keyword argumentzip_longest argument #%zd must support iterationError in atexit._run_exitfuncs: register() takes at least 1 argument (0 given)Exception ignored when trying to write to the signal wakeup fd: set_wakeup_fd only works in main threadthe fd %i must be in non-blocking modesignal only works in main threadsignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable objecterrno associated with this signalreal user ID of sending processFactory for default value called by __missing__().itertools.combinations_with_replacementxb+xbab+rb+day of month out of rangehour out of rangeminute out of rangeseconds out of rangeday of week out of rangeday of year out of rangeI/O operation on closed file.S_IFDIRS_IFCHRS_IFBLKS_IFREGS_IFIFOS_IFLNKS_IFSOCKS_IFDOORS_IFPORTS_IFWHTS_ISUIDS_ISGIDS_ISVTXS_ENFMTS_IREADS_IWRITES_IEXECS_IRWXUS_IRUSRS_IWUSRS_IXUSRS_IRWXGS_IRGRPS_IWGRPS_IXGRPS_IRWXOS_IROTHS_IWOTHS_IXOTHUF_NODUMPUF_IMMUTABLEUF_APPENDUF_OPAQUEUF_NOUNLINKUF_COMPRESSEDUF_HIDDENSF_ARCHIVEDSF_IMMUTABLESF_APPENDSF_NOUNLINKSF_SNAPSHOTST_MODEST_INOST_DEVST_NLINKST_UIDST_GIDST_SIZEST_ATIMEST_MTIMEST_CTIMEgetrusage(RUSAGE_SELF)times()clock()i:clock_gettimei:clock_getresiO:clock_settimeI/O operation on closed file|O:gmtime|O:localtimeiiiiiiiiimktime argument out of rangeU|O:strftime_strptimeasctime%s %s%3d %.2d:%.2d:%.2d %d|O:ctimes:get_clock_infomonotonicperf_counterprocess_timeunknown clockadjustableresolutioninvalid GMT offsettimezonealtzonedaylight(zz)tznameCLOCK_REALTIMECLOCK_MONOTONICCLOCK_MONOTONIC_RAWCLOCK_PROCESS_CPUTIME_IDCLOCK_THREAD_CPUTIME_ID_STRUCT_TM_ITEMSi|z:setlocaleunsupported locale settinglocale query failedUU:strcolli:nl_langinfounsupported langinfo constantzszsiszint_curr_symbolcurrency_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signint_frac_digitsp_cs_precedesp_sep_by_spacen_cs_precedesn_sep_by_spacep_sign_posnn_sign_posnU:strxfrmLC_CTYPELC_TIMELC_COLLATELC_MONETARYLC_MESSAGESLC_NUMERICLC_ALLlocale.Errorcannot serialize '%s' objectwritingFile not open for %s_bootlocaleraw stream has been detachedinvalid file: %Rinvalid mode: '%s''U' mode is deprecatedOsiOinvalid buffering sizeunknown mode: '%s'OsssiDEFAULT_BUFFER_SIZEUnsupportedOperations(OO){}|O&:readlines|n:readunclosed file %Rnew buffer size too large|O&:read<_io.FileIO [closed]>negative file descriptorinvalid mode: %.200sexpected integer from openeropener returned %dO|i:seekw*:readintonegative size value %zdn|i:seeknegative seek value %zdnew position too largeread() should return bytes(OnN)reentrant call inside %Rcan't allocate read lock|O&:readlineinitial_bytesnewlinelocaleconvdgettextdcgettextbindtextdomainbind_textdomain_codesettm_yearyear, for example, 1993tm_monmonth of year, range [1, 12]tm_mdayday of month, range [1, 31]tm_hourhours, range [0, 23]tm_minminutes, range [0, 59]tm_secseconds, range [0, 61])tm_wdaytm_ydayday of year, range [1, 366]tm_isdsttm_zoneabbreviation of timezone nametm_gmtoffoffset from UTC in secondssleepmktimetzsetS_ISDIRS_ISCHRS_ISBLKS_ISREGS_ISFIFOS_ISLNKS_ISSOCKS_ISDOORS_ISPORTS_ISWHTS_IMODES_IFMTfilemode|O:BytesIOO|siO:FileIO__IOBase_closed_io.StringIO_io._BytesIOBufferO|sizzziO:openABDAY_1ABDAY_2ABDAY_3ABDAY_4ABDAY_5ABDAY_6ABDAY_7ABMON_1ABMON_2ABMON_3ABMON_4ABMON_5ABMON_6ABMON_7ABMON_8ABMON_9ABMON_10ABMON_11ABMON_12RADIXCHARTHOUSEPCRNCYSTRAM_STRPM_STRCODESETT_FMT_AMPMERAERA_D_FMTERA_D_T_FMTERA_T_FMTALT_DIGITSYESEXPRNOEXPR_DATE_FMTtime.struct_time_strptime_timethe processor time used is not available or its value cannot be representedclock_gettime(CLOCK_PROCESS_CPUTIME_ID)sleep length must be non-negativeTuple or struct_time argument requireddomain must be a non-empty stringcannot fit '%.200s' into an offset-sized integerinteger argument expected, got '%.200s'could not find io module state (interpreter shutdown?)I/O operation on uninitialized objectmode U cannot be combined with x', 'w', 'a', or '+'can't have text and binary mode at oncemust have exactly one of create/read/write/append modebinary mode doesn't take an encoding argumentbinary mode doesn't take an errors argumentbinary mode doesn't take a newline argumentcan't have unbuffered text I/Ointeger argument expected, got '%s'File or stream is not seekable.File or stream is not readable.File or stream is not writable.Raw stream returned invalid position %zdunbounded read returned more bytes than a Python bytes object can hold<_io.FileIO fd=%d mode='%s' closefd=%s><_io.FileIO name=%R mode='%s' closefd=%s>reentrant call inside %s.__repr__Must have exactly one of create/read/write/append mode and at most one plusCannot use closefd=False with file nameinvalid whence (%i, should be 0, 1 or 2)%.200s.__setstate__ argument should be 3-tuple, got %.200ssecond item of state must be an integer, not %.200sposition value cannot be negativethird item of state should be a dict, got a %.200sdeallocated BytesIO object has exported buffersbytesiobuf_getbuffer: view==NULL argument is obsoletecould not acquire lock for %A at interpreter shutdown, possibly due to daemon threadsbuffer size must be strictly positivepeek() should have returned a bytes object, not '%.200s'read() should have returned a bytes object, not '%.200s'day of week, range [0, 6], Monday is 01 if summer time is in effect, 0 if not, and -1 if unknownThe time value as returned by gmtime(), localtime(), and strptime(), and accepted by asctime(), mktime() and strftime(). May be considered as a sequence of 9 integers. Note that several fields' values are not the same as those defined by the C language standard for struct tm. For example, the value of the field tm_year is the actual year, not year - 1900. See individual fields' descriptions for details.@@@@@@@@@@@0 @@@@@@@@@@@@@@@@P@@@p %:%$$$$$$$$$$$$$$$&$$$$&&SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec<%s><%s name=%R>flush of closed filereadinto of closed filereadline of closed filew*:readinto1|n:peekpeek of closed filen:read1read length must be positiveread of closed filereadall() should return byteswhence value %d unsupportedseek of closed filewrite to closed fileOO|n:BufferedRWPair((OK)) sssnot readableOO;illegal decoder state|n:readline<_io.TextIOWrapper name=%R mode=%R%U encoding=%R>illegal newline value: %scodecs.open()U:writenot writablenegative seek position %Riyy#yiwrite_throughbuffer_sizeiso8859-1getpreferredencodingO|zzzii:TextIOWrapperO|i:decodeO|n:BufferedRandomO|n:BufferedWriterO|n:BufferedReaderunderlying buffer has been detachedraw readinto() returned invalid length %zd (should have been between 0 and %zd)raw write() returned invalid length %zd (should have been between 0 and %zd)readline() should have returned a bytes object, not '%.200s'the BufferedRWPair object is being garbage-collectedread length must be positive or -1a strictly positive integer is requireddecoder should return a string result, not '%.200s'IncrementalNewlineDecoder.__init__ not calledstate argument must be a tupleillegal decoder state: the first item should be a bytes object, not '%.200s'underlying %s() should have returned a bytes-like object, not '%.200s'readline() should have returned a str object, not '%.200s'could not determine default encodingencoder should return a bytes object, not '%.200s'underlying stream is not seekablecan't do nonzero cur-relative seekscan't do nonzero end-relative seeksinvalid whence (%d, should be 0, 1 or 2)underlying read() should have returned a bytes object, not '%.200s'can't restore logical file positiontelling position disabled by next() callcan't reconstruct logical file positionOi|O:IncrementalNewlineDecoder|0@`ȑsignal %i cannot be registered, use enable() insteadunable to raise a stack overflow (allocated %zu bytes on the stack, %zu recursive calls)can't apply this %s to %s objectstring argument expected, got '%s'newline must be str or None, not %.200sinitial_value must be str or None, not %.200s%.200s.__setstate__ argument should be 4-tuple, got %.200sthird item of state must be an integer, got %.200sfourth item of state should be a dict, got a %.200sInvalid whence (%i, should be 0, 1 or 2)Can't do nonzero cur-relative seeks/builddir/build/BUILD/Python-3.6.15/Modules/zipimport.cbad central directory size or offsetbootstrap issue: python%i%i.zip contains non-ASCII filenames without the unicode flag# zipimport: found %u names in %R can't decompress data; zlib not availablecompiled module %R is not a code objectzipimport: no memory to allocate source bufferimport %U # loaded from Zip %U file is not a valid file descripterfile.fileno() is not a valid file descriptorunable to get the current thread statetimeout must be greater than 0Timeout (%lu:%02lu:%02lu.%06lu)! unable to start watchdog threadcould not allocate locks for faulthandlerthe tracemalloc module has been unloadedEnable tracemalloc to get the memory block allocation traceback Memory block allocated at (most recent call first): PYTHONTRACEMALLOC: invalid number of frames-X tracemalloc=NFRAME: invalid number of framesthe number of frames must be in range [1; %i]symtable() arg 3 must be 'exec' or 'eval' or 'single'write could not complete without blockingexpected some sort of expr_context, but got %Runsupported operand type(s) for ** or pow(): '%.100s' and '%.100s'unsupported operand type(s) for pow(): '%.100s', '%.100s', '%.100s'import * only allowed at module levelan int variable for demonstration purposesReturn symbol and scope dictionaries used internally by compiler.enable(file=sys.stderr, all_threads=True): enable the fault handlerdisable(): disable the fault handleris_enabled()->bool: check if the handler is enableddump_traceback(file=sys.stderr, all_threads=True): dump the traceback of the current thread, or of all threads if all_threads is True, into filedump_traceback_later(timeout, repeat=False, file=sys.stderrn, exit=False): dump the traceback of all threads in timeout seconds, or each timeout seconds if repeat is True. If exit is True, call _exit(1) which is not safe.cancel_dump_traceback_later(): cancel the previous call to dump_traceback_later().register(signum, file=sys.stderr, all_threads=True, chain=False): register a handler for the signal 'signum': dump the traceback of the current thread, or of all threads if all_threads is True, into fileunregister(signum): unregister the handler of the signal 'signum' registered by register()_read_null(): read from NULL, raise a SIGSEGV or SIGBUS signal depending on the platform_sigsegv(release_gil=False): raise a SIGSEGV signalfatal_error_c_thread(): call Py_FatalError() in a new C thread._sigabrt(): raise a SIGABRT signal_sigfpe(): raise a SIGFPE signal_fatal_error(message): call Py_FatalError(message)_stack_overflow(): recursive call to raise a stack overflowillegal newline value: %R(OOnN)Negative size value %zdNegative seek position %zd%U%s%U%U%c%U%c%U%UU:zipimporter.is_packagecan't find module %Ri:unregisteri:setstateU|O:zipimporter.find_moduleO[]O[O]cp437bad central directory offsetbad central directory sizenot a Zip filecan't open Zip file: %R%U%c%UNHIIkHHIcan't read Zip file: %Rbad local header offset%s: %Rzipimporter()O&:zipimporterarchive path is emptybad local file headerbad local file header sizeOHnnlHHInegative data sizezipimport: can't read datazlib# zipimport: zlib %s availableU:zipimporter.get_dataU:zipimporter.get_source%U%c__init__.py%U.py# trying %U%c%U bad pyc data# %R has bad magic # %R has bad mtime U:zipimporter.load_module[N]U:zipimporter.get_filenameU:zipimporter.get_codezipimport.ZipImportError_zip_directory_cacheunable to get sys.stderrsys.stderr is None|Oi:dump_tracebackFatal Python error: |Oi:enablei|Oii:registerd|iOi:dump_traceback_laterTimeout (%lu:%02lu:%02lu)! :getstate|i:_sigsegvin new thready|i:fatal_errorunable to start the threadPYTHONFAULTHANDLERcannot allocate lock File "", line PYTHONTRACEMALLOC|n:startsO&s:symtableDEF_GLOBALDEF_LOCALDEF_PARAMDEF_FREEDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDDEF_ANNOTTYPE_FUNCTIONTYPE_CLASSTYPE_MODULEGLOBAL_EXPLICITGLOBAL_IMPLICITCELLSCOPE_OFFSCOPE_MASKOU|iisntimeout must be non-negativenon-ascii grouped digit((yi))opcode = %d PyCompile_OpcodeStackEffect()benchgetstate() -> statesetstate(state)classmethclassmeth(*args, **kw)staticmethstaticmeth(*args, **kw)is_tracingclear_traces_get_traces_get_object_tracebackget_traceback_limitget_tracemalloc_memoryget_traced_memoryis_enabledcancel_dump_traceback_later_read_null_fatal_error_c_thread_sigabrt_sigfpe_fatal_error_stack_overflowarchivefind_loaderinitial_valuexxsubtype.spamlistxxsubtype.spamdictsignumall_threadsBus errorIllegal instructionFloating point exceptionAbortedSegmentation faultzipimport.zipimporterdecompress|OO:StringIO B.maketrans(frm, to) -> translation table Return a translation table (a bytes object of length 256) suitable for use in the bytes or bytearray translate method where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.?;Ĉv\2H_дX(( Y, @\Th,$|p<\ <Th<|L 4HL,Ќ,0d\xl\8T|Ȏ@\T,>hl>> ??P<>dl>x ?,?L?l???,@,@`+?+\@+@+A,AD,,Bp,lC,C, >L> ?\p?LL?@L?`LL@LALAL|BLBL\CM|C(MCC8\DtJM,\NH PR,S4S` T U[ ]P],z8,P,t  L<lD d x   < l   L< ` , | (   lT   < 4 `   d|$,TlDL p LdDl ( x , <  p<pL| $#||..:(:<;`==|>?|B8DtV@>|W>W>X>|X?X,?YX?Y?Z?\[D@[@|\@\(A<]TAl]pA]AL^A^B^PBl_B_B,`B`Ca\C\btClcCLzC| ><>T>l\??,@l@@$ A<AX,BtBLCClDD|E(FPFl@>\d> >>L>>?<Li\?iL@i|AEFlGĝGHTT2U-4  UxFHH I(H0H(D AABHDhUNFEB B(A0A8Dp 8A0A(B BBBH lX9Es$XLE G hHHHYFBB B(A0A8DP 8A0A(B BBBA H \BDL B(A0D8FPE 8A0A(B BBBB (l^dEAR z DAA D^KEy A x^Zl^+_L^LFGB D(A0 (A BBBB X (F BBBD H,_FHE B(D0C8Dpj 8D0A(B BBBI dx$cBBB B(A0A8Gp> 8D0A(B BBBL  8C0A(B BBBE (\fuEDD M AAD 8 fFEA C(G0e (A ABBA Hg}Ek A ,hdgdFDC G ABA HgFEE B(A0D8DPC 8D0A(B BBBE hh[EE E L hZ FBB B(A0A8J 8A0A(B BBBA T u h uES uEt G 8 HvFEA D(D0 (D ABBD  vD< xFEE A(D0 (D BBBI 8< xBGD d ABD W MBB Hx yBBE E(A0D8D@y 8A0A(B BBBF H yFEB E(G0A8G@ 8D0A(B BBBF H LzFBB J(D0D8D@n 8D0A(B BBBE \ {H A Hx d|FBB B(A0A8D@ 8D0A(B BBBJ  }R\ P D 8 <~FBA A(G (D ABBF p FEB A(D0i8[@HHDPI0a (F BBBH A (C BBBF R (C BBBE H ,BBE B(A0D8H 8D0A(B BBBH  pHbe8 FBA A(Gh (D ABBF 0 , LD (FBB B(A0A8G 8D0A(B BBBB  zH_ I b F  zH_ I b F  xzH_ I b F  ؉zH_ I b F 8zH^ J g A 4 4HFAA } GBB ] CBF LFBA A(D0G (J ABBL ` (F ABBA Hl*BBE I(D0D8KP 8D0A(B BBBB <PvBDG s DBJ N DBD GDBL\BEA C(G0 (A ABBK a (D ABBE H@FEA D(D0 (D ABBK O(D ABB@ԐFBE A(D0DP< 0D(A BBBC <~EDpV AH `ܓWiU A d| BBB I(A0A8GP 8A0A(B BBBF  8A0A(B BBBA (XAAG n AAA dBEB B(A0A8G 8D0A(B BBBE  8C0A(B BBBE xT.ES H MLdBBB B(D0I8D 8D0A(B BBBH `FEE E(D0D8G@n 8A0A(B BBBL Q8C0A(B BBB`LFEE E(D0A8G@z 8D0A(B BBBH T 8C0A(B BBBH AH s A 0<THFKH A(D0DPp 0A(A BBBF L0C(A BBBpLFEE E(G0A8G`KhJpDxDL`X 8D0A(B BBBF k 8D0A(B BBBH $OH(\0D8D@I T A %HB D(B0T8ınFBA A(GP (D ABBA D X LlFBA D(G0] (D ABBF  (G ABBF \pFBE B(A0 (E BBBD d (F EBBE (E BBB`еyBBB D(D0 (A BBBC m (A BBBD Z (A BBBG LFGA D(G0R (A ABBG F (C ABBJ 4|EIG R AAG y CAC 4Է|EIG R AAG y CAC 4@|EIG R AAG y CAC 4xd|EIG R AAG y CAC 4|EIG R AAG y CAC 4|EIG R AAG y CAC @ <FFD O ABF ] GBB ACB4d|EIG R AAG y CAC 4|EIG R AAG y CAC 4(|EIG R AAG y CAC 4 p|EIG R AAG y CAC 4DcBED h BBI ZBB0|xENG R AAB CCA0FAA Q0  AABJ (4 EHG l FOK L 5 FBA A(D0d (D ABBE F (A ABBL p5,L5FFB B(A0N8G 8D0A(B BBBK L5cFBB B(D0A8Z 8D0A(B BBBF L$6'YFBB E(A0A8ZR 8D0A(B BBBA Lt6/FIB B(D0A8T+ 8D0A(B BBBD H6h1FIB E(N0A8G 8D0A(B BBBK H72yFIB B(D0N8G 8D0A(B BBBI H\73FBB B(A0A8WP 8D0A(B BBBF (7d5BIDs DBH 076RFFA J  DABD x847YDE B(A0A8DPz8D0A(B BBBGPPD 8A0A(B BBBJ d87gBHB B(A0A8GU 8E0A(B BBBF N 8D0A(B BBBE 8; (9;eFAG y DBC (,9;eFAG y DBC (X949FBA A(QP (D ABBB HT:?FBB B(A0N8DpV 8D0A(B BBBF 0:@FAA Q0  DABF H:BFBB H(A0A8DPz 8D0A(B BBBA H ;|DFBB B(A0A8JP 8D0A(B BBBK ll;FFEA A(G0 (D ABBF  (A ABBG Z (G DBBG s(A DBB;pH/HZ F F8;H)FIA N(DP (A ABBK 08<tIFHA Q0{  AABA 0l< JFAN D0  AABK 0< K/FHN D0  AABA 0<LFCD J  AABB t=L FBB E(A0A8D@~ 8C0A(B BBBA f 8D0A(B BBBE d8A0A(B BBBH=MBEE E(A0D8GPz 8D0A(B BBBD 8=0OYBEB D(G (D BBBG 4>TPFGG0d ABE L KDE L@> QBEB B(A0D8G * 8D0A(B BBBB >lS{EW0X AA d>S"FBB B(A0D8Dpg 8D0A(B BBBG J 8A0A(B BBBE X?V.FBB A(A0JPx 0A(A BBBJ  0A(A BBBB Hx?dXFEE B(A0D8Dp 8A0A(B BBBF \?\FBB E(D0D8GEZRA* 8D0A(B BBBI @$@HaHFIB A(J0K@ 0D(A BBBH 8h@Tc^PAA L ABG  ABA @xeDLl H C@@eiFBE A(D0In 0A(A BBBG A (AgIE{DAgXAglAg AgAgAh5dP4A,hEFDD a GBH AABADh BPh`E@ K K,Bh`E@ K KLBh`E@ K KlBiLEBBDi 0B@iyEAR N AAA LAABiBi-BiIM{Ci (Ci,EGG eDA,DRH  I k E d L [ E LtRTFEB B(A0A8J 8D0A(B BBBA RK A pRFBB B(A0A8G 8A0A(B BBBD nHQA BKB0TS(sFDG m IBG _ABSt/LSFEB E(D0A8J 8D0A(B BBBG SFD a EH <TlTFBD A(ID (A ABBH (PTFAQ@l ABI L|T \BBB B(D0A8G" 8A0A(B BBBH LT0~BBM B(A0A8G" 8A0A(B BBBH U`FBA A(D0 (D ABBH D (A ABBN p (D DBBD  (A DBBD T (D ABBK <UhFJA D@  DABH THTPRHA@U KU>0 V cFID e KKJ DDB\@V\(FIA A(D0t (M HDBL i (D ABBF N (D ABBA V,?LM G ^VL?LM G ^lVlFBE D(D0| (G BBBB P (D BBBF I (D BBBE I(D BBBlPWFBE D(D0| (G BBBB P (D BBBF I (D BBBE I(D BBB(WFHM@ ABG WE I X8 X@NHD R ABA @P HXqom D P(hX4yEDD s AAF X<dWXX XX.XY$Y48YEFDD a GBH AABpY Eq J 4YeFDD E GBD AABY5dP4Y UFDD s GBF AABZ4 ,Z@E} F J F PZHEz4lZ0uFDD ] ABB AABZx$Z$Z@E^ M KZHEz4[FFED ` BBM ABB@[@E^ M K`[P`>d`>x`4>```l)$`HEFG jCD`_DZD`FEA @ ETK i BBC N BBF NED J(T0B8A@BHAPAXA`AhApI _ BBE O BBE m BED \f(BBB A(D0r (D BBBI f (A EBBH T(D BBB tfFU E z F fD f@yFa I fyFa I fyFa I glFR H z F $gyFa I @g\yFa I (\gFS G L D j F gD (g@FP J L D j F gyFa I g(yFa I hyFa I hFEB B(A0DrHFAFFFFIAIAIHII[DEDDABBBGf 0D(B BBBC 8hFBA D(D0- (D ABBI i?$i9\\  AABD 8n1]H i O \@XnT1iFBB A(A0D 0A(A BBBH n3 n|3n3:n360n3FBD Qpe  DBBF H oL4FBB B(A0D8Dpo 8A0A(B BBBB Llo7FIB B(A0A8T2 8D0A(B BBBH DoPFBB D(D0g (D BBBM E(F BBBq>FBB B(A0D8DP 8A0A(B BBBH C 8C0A(B BBBI P 8A0A(B BBBF D 8C0A(B BBBH lq?GFBB A(D0G@q 0A(A BBBA P 0C(A BBBF D 0C(A BBBB r@$r@8r@Lr@`r@tr@$r@?FBD XTB$r ACFBD \RD4r4AmBAD  ABG VAEslA%E_,sA%E_HsA%E_dsA%E_$sA6EDG cAAsA sA% sAE[0j AA shBttBtB0tBDtB (XtBEDG e AAA XtBFBA D(D0l (G ABBG H (C ABBH H(D ABBlt\CGFBB A(D0G@n 0A(A BBBD P 0C(A BBBF D 0C(A BBBB PuEDG n(I0K8E@K h AAD 4(eEDG K(K0M(A Z AAH eeeeX e9QBA A(G0 (D ABBE U(D DBBGP0XhfQBA A(G0 (D ABBD U(D DBBGP0PĀgQAA V ABD N ABG hP D AEF $h, h5HIO TL@h5HIO Tl`h3HO [h(Ph0FBA D(GsSTAKH (D ABBE $|jV H BV4k <,0kFBA D(G$ (A ABBB 8lFBB D(G (D BBBB xFBB B(D0A8G@ 8A0A(B BBBD [ 8F0A(B BBBF h 8F0A(B BBBA 4$؏EDH G DAK D AAB \PmHo I xmHo I D1FAA  ABB c ABJ V DBD ܃(H_8&FBA A(D@ (D ABBJ 40FAD C DBD N DBA 4hdFDA l ABF w ABA 8BGA A(GP (D ABBI ܄ 4 ,FAA  ABB AB((pFAD@ ABG @THBAG y DBG N DBD _ DBC  ԅHO( BDA V ABH $,EC H H H b$TkE{ H H H RH|0 FBB B(A0D8Dp- 8A0A(B BBBD 0ȆBED DP~  ABBF (E[8h@U8C0t AA ( $<SEd G H H R0d(Er I H H _ A Y G R F DYEADPsXi`RXAPs AAB  DAG 0BDD G0  AABH (<Pd7Hn|ЧnE\ A  nE\ A (pADG  AAG Kl I R A ( ADG q AAA (8BDD n ABE dX-EP K L0hCFDG K GBK MCB-EP K L0؉CFDG K GBK MCBX FEE E(K0A8F@lHFPBXB`I@X 8D0A(B BBBE 0hFAA D0X  DABE 4MFAD l DBC  DBA ԊIL|8̯wFBA A(GP (D ABBD (,LLAG ^DAX4lH y G _xF A Zdp|%(ԋFGD@ ABC 8\FFB D(D (D BBBE \<0FBA A(D@ (A ABBA w (A ABBC h (A ABBB `H c E O A (uAAG o AAF (PEAGP} AAD (EAGP AAH (DEAGP} AAD (plEAGP AAF (PrEAG` AAG 0ȍdFJD y DBE DAB(/EAG` AAD (H N J Y E dLPFBB E(D0A8Dp 8A0A(B BBBN  8D0A(B BBBH DpԎh(dEAG` AAI (8aFj H L D H H H(@|EADpc AAA DlpFBB A(D0G/ 0A(A BBBA LEFBB H(A0A8D  8A0A(B BBBF DFBB A(D0D`} 0D(A BBBA LP$8`lWFBB D(D0=(A BBB8lFEA A(D0 (C ABBG ؐ   $($4<FDD  GBF AABtES P 4(EFDD a GBH AAB ̑@YEt G J F | 4xEFDD a GBH AAB <YEt G J F `4tEFDD a GBH AAB G4Ԓ(RFBA A(D0}(A ABB P \`tP8LpDPd`E@ K K HyEO L K E `E@ K K$ȓQFAD BAB  IM{4H HD%E_dX%E_$lQFAD DB [oFHܔ(EAM@ AAA 0 CwDH3g0XtwFHD D0t  AABB 0FAA G0X  AABE 0,FAA G@  AABA xED  AG DED  AG <REn E Y\0mHo I xmHo I ~Hv B <~Hv B ̖~Hv B A\ dEHTP AAK x?|FGB B(A0D8DP 8D0A(B BBBK L 8H0A(B BBBK D 8M0A(B BBBN \XAFBA A(D0( (D ABBA u (D ABBB Q (D ABBF LDBBB D(D0 (D BBBG N (A EBBH 0EFIA T@i  ABBF 0<pF-FIA T0  DBBD @plGFAD  ABB A DBI AABHG0FBE E(A0A8DPY 8D0A(B BBBB 4JFEG z BBH K BBI 884KhBED D(DPU (D ABBG <thLeFBE A(H0 (D BBBB HMwFEH A(G0g (A BBBG D (J BBBL M ME[0t AK 48NBAG  DBE b DBA p\OOC F `XPrEN M MxPTW|$PO F K W I PC xQyE_ L Q;Eb I J 4QOC F `X,XRFAD D ABF LSuFBB A(A0 (D BBBK R (D BBBD LDTFIB A(A0v (D BBBE Z (D BBBD 8(U!FAA  ABH N ABG @dVED C AC ` CE U HK X AG ZCdWaH S A 8W>FFD D(L0  (A ABBA LXFED A(F0 (D ABBC N (D ABBI HP|YFBB E(A0A8F@C 8D0A(B BBBI \ 4 \EFDD a GBH AAB$\,@\4\EFDD g GBB AABH\KEu F d]x]5dP<] 8]4]#P]\]Hh]LBA D(D0 (D ABBD \(D DBB@<^TH^hT^|`^/|^^ ^1Hh^^^, ^uGx] K d D <`IM{X` l``(`XEAD z AAJ ``S Dach E XHX aHT$a#8aLa!$`aSEAD FAA4bcLVb bIblc cER@ AA 4dTFBA G  DBBI P gdgx$g3Pg#plg<OBB A(G0A (D BBBJ K (G BBBH x (D BBBF D(G BBB8h#(Th3<h#PhdhQF{$hCFAG nDB$iCFAG nDBFBB B(A0A8D$ 8D0A(B BBBE kBBAAERrEAAL$\FF^ D L D M8,EW L CDXFAA  ABB E ABH N ABG 0<FKD ] DBH WDB4{FDD y DBC \ DBA  (EW E FP,zFEA D0W  DBBA K  DBBE   DBBH L,FBA G0Q  ABBJ s  DBBE O  DBBA dlLED A(G0m (F ABBK S (A ABBG D (C ABBD Q48[FED i BBD N BBA 0p@FDJ N JBE DFB4(FGD q DBH N DBD hFBD A(G0 (D ABBI D8U@W8A0L (D DBBG z (D ABBE \H7FBE D(A0 (D BBBA 8U@W8A0w (D BBBA <vFKD s DBB N DBD GDBH4FBB B(A0A8DP 8D0A(B BBBG 4 LHFEA A(G0Q (D ABBB ] (D ABBJ HTFBB B(A0A8D@ 8D0A(B BBBA  48FAD c DBD A DBA 0>EtLL FBB D(D0X (A BBBG D (F BBBH EG0 AH `LFIB B(A0D8D`s 8D0A(B BBBD I 8J0A(B BBBL ($>FDD \ ABE (P:FDG M IBE \|BBB B(A0A8D 8A0A(B BBBA FcAlDFED A(D0 (D ABBG Y (D ABBF D (D DBBH D(F ABB(L`:FED V BBE 0xtyJDG D DAB X,8FDG M GBE _ HsFIE D(D0w (C BBBD K(A BBBPLd4xUFDD s GBF AAB<<BHD G(D (D ABBA ER UEK (EC H K E L`E@ K KlEn M H0UHLxYyN/!    @4FMB D(F0Pk 0A(A BBBA \x$]FTJ B(A0A8GBA 8A0A(B BBBA H$FHI I(D0A8G 8A0A(B BBBA 8$zFBA A(D0F (A ABBF `Fs G JLLZ\LZ\LZ\oHv B Q A DNZ_|NZ_NZ_0s\,HdRi E Q G N J cHxFIB B(A0A8G 8C0A(B BBBB HT`sFBB E(A0A8F@ 8D0A(B BBBK d8A0A(B BBBL@lBEB B(A0A8G  8A0A(B BBBB @(84BDK a DBH r ABK  1 H0  FBF A(G0 (A ABBG D(C ABB`| BBG E(D0A8G` 8A0A(B BBBF ^ 8A0A(B BBBH d ,XFBB B(D0A8Gpk 8A0A(B BBBC  8A0A(B BBBK H $ H\  :FBE E(D0D8G@ 8A0A(B BBBC @ cBAA q ABH N ABG DAEp @BGA D(D0z (D ABBK v (D ABBA k (D DBBI n (D ABBI 8` \FBB A(J` (A BBBB L FDA A(G0 (D ABBJ W (D ABBH < fFGD f DBC N DBD GDB, 4@  -<T (iBBB D(A0 (D BBBA  X5^N( wHm K W I F J FH FDG0m ABO A ABD _ CBD XABH$ hmbBA A(F@[ (A ABBC Q (C ABBG $p nEx K J N M "0 FGA D@  AABG  "  ` FBB A(A0u (D ODBF o (C BBBH R (C BBBE LlpFBA A(G0o (K DGBH S (C ABBE  SEq J (dFKL@ ABG LFBA A(G0} (D ABBI  (G DFBI LTHMFBA A(G0\ (D ABBJ d (D DBBH HHNBEB B(A0A8G` 8D0A(B BBBE HLBAG y DBG K DBG J DBH GDB0<wBDG y DBD ^FB|p}BBB E(D0D8Dp 8A0A(B BBBL W 8A0A(B BBBG g 8A0A(B BBBA 0 {FDG | ABH ]CB\$( FBB D(A0 (A BBBD I (D BBBE A(A BBB\ yFBB A(G0b (C BBBK  (D BBBG D (D EBBG 0 FAA I`  DABF 4 EAK48 Ep A ,T MDD  ABA @xFBD  BBA O BBE mBE,EQ0w8Z@R8A0p AE `FBB A(D0 (D BBBA d (D BBBG M (A EBBI \@UHh H \H|BBB B(D0A8Gp 8A0A(B BBBA 8dMDD g CBG LABA4BAI e DBI N DBD 0<FDD D0c  AABG p((4FDG0 ABF 0BAD J  AABG 4WFHD h ABK AGB<0uEDD i GAJ I DAJ KDAXpFBD D(D0p (D ABBC S (D DBBA Q(D ABBHpFBB E(A0D8D@ 8D0A(B BBBH HFBA D(G0B (A ABBD d(C ABBddWBBB B(D0A8DP 8A0A(B BBBA  8D0A(B BBBE \FBD A(D0g (D ABBG o (D ABBH N (D ABBA (,UFAG o DBE LXFBB I(D0S (B BBBN [ (B BBBE 8$ FBD A(G0e (D ABBF H FBB B(A0D8Dp 8A0A(B BBBK \0#FBD D(D0X (D ABBK K (D ABBD W (D DBBE L#FBB I(D0S (B BBBN [ (B BBBE 8 $FBA D(G0I (A ABBE lp$XFBE D(A0D@ 0A(A BBBG f 0A(A BBBJ D 0C(A BBBA H`%FBI B(D0n (B BBBK E(E BBB4%FDG0M ABG p ABE 8<&!FDD y ABF  ABJ \L0'BED A(D0 (A ABBG X (F ABBE D (C ABBA L(FBA D(G0N (A ABBH D (C ABBD 8)|MDD t CBB \ABA88D)BBD D(D0d (D ABBC |t)BBB E(A0A8DP* 8A0A(B BBBK  8G0A(B BBBE w 8D0A(B BBBE LH,FDA c ABG w ABN R ABK AGBLD,FBB I(D0S (B BBBN [ (B BBBE X-tFEA D(F0y (G ABBE N (G ABBF C (A EBBK ] (A ABBE f (A ABBD T.'HQ G FL8d.;FBI D(D0| (A BBBD  (A BBBF \T/&FEB A(D0y (D BBBK O (D BBBG } (D EBBF ($0fFHA i ABE h0BE` E WH40FBB D(G0l (G BBBJ a(D BBB00FDG { GBK aFB@81FBD D BBL q GBF QBB`1FBB E(D0D8G@z 8A0A(B BBBF T 8F0A(B BBBE \P2EE` K T0|2ZFDG ] GBE UFB27Z\42FGN@MHZPRHA@ DBG  |5eHa G \ D  5Hz F < p6P l6d h6Lx d6:FEE H(D0p (A BBBE o (O BBGG 8 T7WFEE G(G0g (A BBBD (!x7dFHD GDB(0!7}FHD gAB@\!8FAD g DBH  DBE \ ABI 8!\9FBA A(L0c (D ABBF @!@:bBB A(D0D@U 0A(A BBBD @ ";FIB A(J0KP 0D(A BBBJ Ld"8>FBE B(A0A8G 8D0A(B BBBG H"?FIB B(A0D8D@ 8D0A(B BBBH H#\AHFEB E(A0A8D@* 8D0A(B BBBA L#`D 0`#\D`FCG g DBC YDB#DOHx H #D 4#DOFBA A(D0z(A ABB$D$D]tP,$ E@$E4T$E|BBA A(G0h(A ABB $`EBz D b F $ F`E@ K K$LF$XF$TF %`F  %\F4%XFHH%TFFBI A(A0G (A BBBG (A BBBD%FFBE B(H0H8K@H8D0A(B BBB% GDtK8%XGsKAD | AEN ACBJ40&GvLHG d CAE dEAAh&Gm<|&@HqKBD A(D0L(A ABBH&H $&|HEJ AA ,&tIBDF \ ABE X('IFBA D(D0 (A ABBJ D (D ABBK D(A ABB'JLEo D O'JDN`'JFa`d'0K FBB B(A0A8DP 8A0A(B BBBD  8A0A(B BBBO LD(LFBB A(A0X (A BBBE O (A EBFA 4((M?FDD c ABD ACB(0MAd\(hMY|\H(MFBB A(D0[ (C BBBE A(D BBBH)M<dW`)NStWLx)dNFAF  ABJ U ABA A ABE WCB4)OEAD  AAC D AAJ (*OFB H O A j F `,*0PBBE E(A0A8GP 8C0A(B BBBH h 8F0A(B BBBA 8*R3FBA A(D0 (A ABBH H*SpFBA A(D0D (C ABBA G(D ABB+S ,+S'4@+S[EAQ@bHWPMHA@ AAH x+$UWBE B(A0A8DPe 8C0A(B BBBI O8A0A(B BBBGPPI 8A0A(B BBBE c 8A0A(B BBBA (,P0H,VLFJA DP  AABF @|,0WFBB A(A0JP\ 0A(A BBBF ,X(HV@,X FAD G  GABB Z  AABA L-YFBB A(A0& (A BBBG _ (C BBBH 0l-`[mFBD ] RDI PLD-[ZEz A -[Eq J T A -l\=Ee F L.\8.\FBA A(DP (A ABBB (P.<]sLAA aAB|.]TEN\.]rBA A(G0d (D ABBA S (G DBBA D(D DBB0.^NFAA D0  DABI ,/_FD i EH (P/l`FK G F J M K F4|/`FAD h DIH c FBE 4/8aFAD h DIH c FBE /aZLb B i@ 0aFAA ~ ABG t DBF [ ABB (P0bFAD z DBE 8|0 cFBA A(IP (D ABBK 0c$0cHKg F O0 dHKg F O4 1PdFDD k BBC EBHD18eBFDD A(D0t (D ABBH (D DBB81DNG4> H>xFBD A(G0b (D ABBA m (H DBBC D (D AEBH q (E AEEG i (D AEEH > >UEO`?\FBB B(D0D8D@I 8A0A(B BBBE ] 8J0H(D BBBG `d?FBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `?FBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `,@FBB B(D0D8D@Q 8A0A(B BBBE a 8J0H(D BBBK `@FBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `@HFBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF xXAtFBB B(D0D8D@v 8A0A(B BBBH z 8J0H(D BBBJ l 8I0O(B BBBL `AFBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `8B$FBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `BPFBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `C|FBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `dCFBB B(D0D8D@K 8A0A(B BBBC ^ 8J0H(D BBBF `CFBB B(D0D8D@Q 8A0A(B BBBE a 8J0H(D BBBK `,DFBB B(D0D8D@Q 8A0A(B BBBE a 8J0H(D BBBK DLuHz F H H \ DuHz F H H \ D}Hz F K M \ D`mHv B D L \L EFHA n CBF { ABJ W CBD ACB pEuHv B Q G \ Ex}Hz F K M \ E}Hz F K M \ E0}Hz F K M \ F}Hz F K M \ $F}Hz F K M \ HFD}Hz F K M \(lFHz F ^ J \ D FLFFBB D(D0_ (D BBBE N (D BBBH (FEs H O I Y G N$GHz F _ I \ D (FBB j BBH y BBC M BBG \<]>BBB E(D0G8J b 8D0A(B BBBA  G r A ]B$]A0FDG IJG(]BFAA | ABI 0^CFAA D0d  DABI H8^$D2FBB B(A0A8DP 8D0A(B BBBC \^EBBE H(D0A8DY 8D0A(B BBBH 1DlA^XH ^THED  DH _0I $0_,IUIc D E K T X_dIxFD B EG L|_IFEB B(D0D8GF 8A0A(B BBBB h_0NFEF E(A0A8JrLFFFFS 8A0A(B BBBA 8`S hL`S FEB B(A0D8KIFFIIcD 8A0A(B BBBA `^ `^X FBB B(A0A8G{ 8A0A(B BBBF XFFFIY@QFFFIYTah |hahFBB E(D0A8GP 8A0A(B BBBB s 8E0A(B BBBO  8A0A(B BBBJ XalFEE D(D0l (D BBBB N (D BBBH D(D EBB`Db8lw FBB B(A0A8D 8A0A(B BBBF SEDN@bTvdFED i BBD N BBF DEBbv `c|v FBB B(A0A8D. 8A0A(B BBBF SEDN@dcdFED i BBD N BBF DEBcD `c@BBE E(A0A8G1 8D0A(B BBBK OTABX` dlBBE E(A0A8G4 8D0A(B BBBH \TABX`dFAD d GBH [ JEF d EBE H ABE D JEM ICBLddzFBB A(DP (D BBBF  (D BBBN @8edFED i BBD N BBF DEB|eO@e FAA z ABK d ABI V ABG LeȏkFBA A(D0 (D ABBG l (H ABBG $f <8ffFDD f DBF N DBD GDBxf hfmFBB B(A0A8GHMFFFSz 8A0A(B BBBF LfBEH D(G0S (D BBBI N (D BBBA HHgt|FBI B(A0D8J 8A0A(B BBBG gK A XgLFBE E(A0G| 0A(B BBBA  0F(B BBBJ L hFBA A(D (D ABBE x (K ABBH \hpOphEL`hUFBA A(G0 (D ABBF } (D DBBG  (A DBBF h ipi ,i @ihTiFBB B(A0A8Gm 8A0A(B BBBD sMFFIIYhiFBB B(A0A8G` 8A0A(B BBBA BFFFFS ,jFD a EH <Pj FEE D(D0j (A BBBG Lj FEE D(D0 (A BBBK o (F BBBE `j|FBA A(D@ (A ABBF 8 (A ABBJ l (E ABBJ \DkFBA A(D@  (A ABBC s (G ABBI | (A ABBF <k8^FAD c DBD N DBD GDB<kX^FAD c DBD N DBD GDB`$lxnFBB A(A0` (D BBBJ p (D BBBF D (A EBBA hlFBB L(D0A8O} 8A0A(B BBBG DFFFFNdl8FKD A(G0q (A ABBL j (A ABBH D8P@Z8A0D(A ABB<\mFBB A(A0O (A BBBF Hm FEE E(A0D8D`/ 8A0A(B BBBI `mBBE B(A0A8GNBB]2 8A0A(B BBBA <LnfFDD k DBA N DBD GDBHn FAD m LBJ h ABE R ABK ICBn <nfFDD k DBA N DBD GDB<,oFAD s ABO D LBN YCBlo hoFBB B(A0A8G,WFFFFS 8A0A(B BBBE o k FBE E(A0D8GS 8A0A(B BBBE aFFFFS 8D0A(B BBBE WFFFFIp4pBFD V DBH m DBE pBIB B(A0D8GP 8A0A(B BBBD l 8A0A(B BBBJ  8F0A(B BBBB J 8F0A(B BBBG 8pqL BFA W ABE q ABD Lq FBB B(A0A8G 8D0A(B BBBG `qp FBB B(A0A8J 8A0A(B BBBH XHBX@`rdFED i BBD N BBF DEBr0dKdrZ FBB B(A0A8G 8A0A(B BBBG  8A0A(B BBBK @$sdFED i BBD N BBF DEB4hsoFBA f BBM J DBA \sL<FBH E(D0A8DP 8D0A(B BBBN 8C0A(B BBBHt,hBBB B(A0A8DP 8D0A(B BBBC TLtPTFBB B(A0A8DP[ 8D0A(B BBBF aXN`hXAP8tXFBB A(A0m (D BBBE `tBEB B(D0A8D@ 8A0A(B BBBD t 8M0A(B BBBN tDu(FEB E(A0D8GGBDIX 8D0A(B BBBD cMEA]Hu FEB B(A0A8Jp/ 8D0A(B BBBI Lvt*FBB A(A0 (J BBBE J (H BBBH HXv*FBB B(A0A8D`2 8D0A(B BBBG Hv(3FBA A(F0R (D ABBE s(D ABBhv3KEE E(D0A8H@b 8F0A(B BBBH _ 8F0A(B BBBB xH\w04FBB E(A0C8Gp 8D0A(B BBBA Hw5vBBB B(A0A8D 8D0A(B BBBH w6 x6Hx6FBB B(A0A8D 8D0A(B BBBE Hhx8FBB B(A0A8Dp 8D0A(B BBBB Hx8FBB B(A0A8D 8D0A(B BBBF @y :FBE A(A0D@u 0D(A BBBE HDyh%h,>FBB B(D0D8D`r 8G0A(B BBBF P 8A0A(B BBBF  A A4A`E@ K KTAhA#|AA*$B-FDG UDB̕ BK\BGB,$B6ECG dAAd0BFKE B(A0A8DPI 8A0A(B BBBG O 8A0A(B BBBG DK50́FԖ]THD̂H$O8DHIPLOdHI|H̃HHDH̗]̄]0|DXHXHlЈD !(Em F HK$̘)EAG YAAȉa0$BDD G0f  AABE <Tw\HTMFBB B(A0A8Dp 8D0A(B BBBK Eg D B F ęxTw\ܙTw\ZEz A LLQFBB B(A0A8G 8A0A(B BBBI (`\EE F M C W I XBFBB B(J0A8DpxTRxApJ 8D0A(B BBBF ]H0 B ((vEAD \ AAE X0|FBA A(D0b (A ABBJ u (A ABBE y(A ABB0-EgDLH ~ A ěxbBB B(A0A8D@^ 8A0A(B BBBJ I 8A0A(B BBBE D8A0A(B BBBL <`̲FBD ] RDI a ODL DDB(,E F C E T A (̜FAD0x DBG T `&EX(t[E| G $DcOG `AIA l.D:FBA  DBO | BBH e DBM ȝO\)RBI D(D0 (A BBBE V (D BBBH W(A BBBJP0Q(A BBBHh4%FLB B(D0A8Qp8 8D0A(B BBBG |EQ S AF ؞tO\g\Dd_ ܺO\8TO\P̻O\hDO\O\4O\O\ȟ$g\ܾTw\$Tw\lTw\(Tw\@O\XtO\pO\dO\O\TTw\РO\O\O\O\0|O\HO\`lg\x$O\O\O\O\ءO\x5dP4 HDd_`Fdax$%E[8Dd_pO\ĢUl_ܢ0Ad\hAd\ dG\4$eBMK c DBE N DBA H\06FBB B(A0A8D`  8D0A(B BBBD H$oFBB B(A0A8D`% 8D0A(B BBBD 0HzEAD Q AAC UCA$(AAa F E K DdPvFBB B(A0A8Dp& 8M0A(B BBBJ o 8A0A(B BBBG \!BDA F0}  AABB X  AABD M  AABG N  CABD L;FBB B(A0 (E BBBI W (H BBBK hYE` K h(AAG t AAA lBBE E(D0D8GPV 8A0A(B BBBC D 8C0A(B BBBH QXV`[XAP`$ BBB B(A0D8G 8D0A(B BBBE NDF],tTFGB IAV A L D TIBBB E(D0A8HPXJ`\XAPt 8D0A(B BBBJ TEi B L D 44cFEG k BBG N BBA l< YFNH DPqXF`RXAP  AABB p,NFOH DzFFFFFXsBcAX  ABBI AoAH4yBEH G(D0l (D BBBH N (D BBBA <FP BA K A HAFEH E(A0D8G@u 8D0A(B BBBJ \ FEH E(A0D8JK^A 8D0A(B BBBG \lPBIB D(M0U (D BBBC A (D EBBB N (D BBBH L̩*FNA A(D0 (D ABBD ` (D DBBD H!FBE B(D0A8NpO 8D0A(B BBBB @hdFHA s ABK N ABG d CBO \BHD A(G@] (A ABBG M (A ABBE V (A ABBD 4 @EDG b AAD Z FAG 8D*FBB A(D0V (D BBBA &E`&E`JEe F Yث&E`HFBB B(A0A8D@] 8A0A(B BBBG H@lFBB B(A0A8D@] 8A0A(B BBBG HFBB B(A0A8D@S 8A0A(B BBBA (ج$6FGH ]AB(86FGH ]AB80LjFBA A(D0{ (A ABBA <lFBB A(A0L (A BBBA HFBB B(A0A8D@R 8A0A(B BBBB HdFBB B(A0A8D@R 8A0A(B BBBB HDFBB B(A0A8D@R 8A0A(B BBBB <,rFBB A(A0@ (A BBBE <ЮlrFBB A(A0@ (A BBBE 4IFHI C(F0b(A ABB4HIFHI C(F0b(A ABB4IFHI C(F0b(A ABBDcFEJ E(D0D8G@o8A0A(B BBB8jFBA A(G0x (A ABBA (<P6FGH ]AB8hdMFHJ D(C0f(A BBB(x6FGH ]AB(а6FGH ]AB(ZFAA q ABD $(3EHI ZAA$P3EHI ZAA$x3EHI ZAAHsFBA A(F0v (A ABBD Z(C ABB<PFBB A(A0L (A BBBA 8,FBA A(F0} (A ABBE 8h4FBA A(G0 (A ABBJ <FBB A(A0O (A BBBF 4(IFHI C(F0b(A ABB(@6FGH ]AB8HTjFBA A(G0x (A ABBA 8jFBA A(G0x (A ABBA <FBB A(A0F (A BBBG 8jFBA A(G0x (A ABBA (<PZFAA q ABD (h6FGH ]AB(ZFAA q ABD <rFBB A(A0@ (A BBBE < rFBB A(A0@ (A BBBE (@LZFAA q ABD (lZFAA q ABD <rFBB A(A0@ (A BBBE (ص6FGH ]AB(ZFAA q ABD (0<ZFAA q ABD $\p3EHI ZAA(ZFAA q ABD LFBB A(A0N (A BBBG W (C BBBH L<FBB A(A0N (A BBBG W (C BBBH HPFBA A(G0| (A ABBE Z (C ABBF HFBA A(G0| (A ABBE Z (C ABBF HdsFBA A(D0x (A ABBD Z(C ABBH4sFBA A(D0x (A ABBD Z(C ABB(:FGI `AB&E`ȸJEe F Y8$FBA A(G0x (A ABBA 8$xMFHJ D(C0f(A BBBD`^FEJ E(D0D8G@j8A0A(B BBB8jFBA A(G0q (A ABBH (READ h AAD ( REAG e AAD ,<@REAG e AAD Dlp#BEA z ABK n ABG U ABH X^̺^HBBB B(A0A8DPz 8D0A(B BBBK `0l6xBBB A(A0i (D BBBE  (A EBBG @ (A BBBI 48BEA  ABE jAB8̻ 9BEA  ABF j ABK ,9BEA   ABH H84;BFB E(A0A8D@ 8D0A(B BBBA H>!BBB B(A0A8Dz 8D0A(B BBBK PмL`FBB A(A0 (D BBBB p (A BBBI H$bBFB B(A0A8G@ 8D0A(B BBBJ @p,dwMBD b BBG W GBH JBB@hdwMBD b BBG W GBH JBBd/EW L FHdlFBB B(A0A8Gp 8D0A(B BBBE Hdi/FBB I(G0D8Gp 8A0A(B BBBK 8mFED H(JP (A ABBG @@opFBE D(H0JP 0D(A BBBJ 80lpFED H(JP (A ABBF (l r FAD  DBLFBB B(D0D8G 8A0A(B BBBD  8G0A(B BBBG  8D0A(B BBBE  8D0A(B BBBE @4<BEA h BBD b BBB [ EBF 0xPAG C DBG QGB0PAG C DBG QGBL 8D0A(B BBBH  @,EAG | CAC  AAE H AAF \FBB B(D0D8DTMRA 8A0A(B BBBD (tHDFNK@ DBA @lFSA A(MX_`RXAP (D ABBH HH0g A HܶFBH E(A0D8D@ 8D0A(B BBBH LPYEn M (htFIA _BBDy A |gV C pC(ܽ_EAD  AAB LFBB B(A0A8D! 8A0A(B BBBC `%YtVTn F ReJ9E[ A :EX E 9Ff A @FAD  DBG D ABI T ABI 4DFAA S DBO { ABE \|YFED A(D0 (D ABBE z (A ABBA X(G DBB\NBB A(A0d (D BBBF  (D BBBG `(A BBB$<0$HJ B(B0B8B@ILd8yFBB B(A0A8J 8A0A(B BBBF lx?FBB H(D0A8DPxXO`cXAPY 8A0A(B BBBG O 8A0A(B BBBG $AXH8B/BBB E(A0H8F@ 8A0A(B BBBE 8BBDA ; DBH H DBJ 8DBED D(F0p (D ABBB 4EMDD N ABJ ^AB44xEMDD j ABF ^ABlEE,F8FEtFFEFFF7HR F VFHR0F:EtL G@`LGotG.(IECG q DAK (8JmFDD XDB0|JBBGJ N JBK DCB8JBBG A(L0h (D ABBG P K BBB B(A0A8G5Y\A 8A0A(B BBBG : 8A0A(B BBBE ] 8A0A(B BBBE 8,UEE^B B(D0D8B@DHBPBXA`IA@UBKE B(A0A8D@aHHPAXB`BhApAxEBAK8A0A(B BBBI@x 8D0A(B BBBK hV `dVFBB E(D0A8G@ 8C0A(B BBBF  8F0A(B BBBJ H XFBE E(D0A8Gp& 8A0A(B BBBB HhYFEE E(D0D8G` 8A0A(B BBBC (ZLEAD s AAA (Z^FAG ` DBD [XFc G H H $0<[Hh H ] K \ D X[Y0l\@FDJ N LBH DAB< \EDF N AAA @ FAI hMAH|\FEE E(I0A8GP 8D0A(B BBBI ,^FEB B(A0D8DBAAAACGAAbw 8D0A(B BBBF vDCAAABBBB] 8A0A(B BBBE <0aSAD v AAH ZCAJH 4,aEAD v AAF Z CAJ (dalFAA Q ABD 8,b<FBA D(G@A (A ABBE 0c5Ef A HTcFBB B(D0A8D@w 8D0A(B BBBG H4hBEH D(D0s (J BBBF D (C BBBC (Lh_BGD s ABE HhBBE E(A0D8F`y 8A0A(B BBBD HTjBBBB E(D0A8Gp 8A0A(B BBBD 4DXoAAG g AAF D AAA `|oNBBB B(A0D8JH 8A0A(B BBBG NDBHppBEB B(D0A8DP 8C0A(B BBBF V 8A0D(B BBBE SXR`IhGpNP`TrBBB B(D0D8F@ 8D0A(B BBBD  8J0A(B BBBJ HDuBBB E(D0A8D` 8A0A(B BBBD wsFBB B(D0D8DPv 8A0A(B BBBH f 8A0A(B BBBH K 8D0A(B BBBH  8D0C(B BBBI XM`OXBPXJ`NXAP_XC`YXAPW 8D0A(B BBBK ` 8D0A(B BBBK TXM`OXBP 8G0A(B BBBE @$GDG M CBD @FBHH `\4BEB B(A0A8D` 8A0A(B BBBA D 8C0A(B BBBH x\dBEB E(A0A8D@^ 8D0A(B BBBI  8F0A(B BBBF [ 8C0A(B BBBA `<PBEE E(D0D8GPo 8A0D(B BBBD y 8C0A(B BBBK ` BEH E(A0D8G@B 8C0A(B BBBB  8A0D(B BBBD dhyBEB B(A0D8Gp 8C0A(B BBBC W 8A0D(B BBBA HlBBB B(A0K8Dp 8A0A(B BBBH dԗBBB B(A0A8Ge 8A0A(B BBBH G 8C0A(B BBBE H BEH E(I0D8DP 8D0A(B BBBD lП^$BBB B(A0A8D` 8D0A(B BBBI F 8G0A(B BBBJ  8C0A(B BBBH  8C0A(B BBBH W 8G0A(B BBBI  8D0A(B BBBH  8I0A(B BBBH 8PLBDA  ABF M FBC DFEE D(D0G 0D(A BBBD \FEE G(A0o (D BBBG K (D BBBC D(A EBB44lFED I BBD DEBdlPBBB B(D0D8Dpe 8C0A(B BBBK  8I0A(B BBBE dBBB B(A0D8D 8A0A(B BBBH / 8K0A(B BBBE `<pBEE E(A0D8DP 8A0A(B BBBD K 8A0A(B BBBC ` BEE E(D0A8DP 8A0A(B BBBH K 8A0A(B BBBK 8HBBD D(G@l (A ABBK @ Kj K \p|xtpl$h8dL``\tXTPLHD@<8(4<0P,d(x$  ITtLDMEE A(A0_ (A BBBA E (D BFBE X<lE4FDD I ABF O ABF HBBB B(A0D8G` 8D0A(B BBBA ,#MN@DBAA | ABE V AED _AB4TBGD t DBI N DBD  `D u G K E O HR4$ZFED n DBE KDB\K A 0xFBD D@  DBBE  0|*FAD D0{  AABB x (tEDD@% AAD 4 8HFBA D(DP_ (D ABBG X HTFBB B(A0D8Gg 8A0A(B BBBG ( p$MBB D(D0 (J BBBJ ` (K BEDJ v (D BFBD o(A BBB@l FBB A(D0DP 0D(A BBBJ iM P8\FBB A(G`} (A BBBJ  NEq J H, @1H\ A x\ FBB B(A0A8G 8D0A(B BBBA JEBDBBDBBR4 BDA m ABI IAB4 pFAD ~ DBA N DBD 0H$ TFGD c ABI OAB4|P EDG _ AAG B DAA ` FBE D(D0r (C BBBH X (C BBBG u (A DBEG LMBEB A(J0q (D BBBA B (D BBBD LhmBHE A(D0q (D BBBA P (D BBBF 4xMDD b DBK J FBF L.IBB A(A0R (A BBBH  (A BBBE 4@MEA z BBG oBBxTEH[ E \ %H\4EDD n DAH M FAD HFBB B(A0A8D` 8D0A(B BBBG $H4FF^ D L D M@p\dBED i BBH N BBF DEB LBED A(F0@ (D ABBE N (D ABBI ,@TEFa I 4p @FED ] BBH ADBEFa I 4H@FED ] BBH ADBLP\FBE D(A0 (C BBBD s (C BBBD L` <`\pFDD p DBD N DBD DEB \FEB D(G@ (C BBBD N (C BBBI J (C BBBE (!<HPFBB E(A0I8G@ 8D0A(B BBBA HFEE E(D0D8D@g 8D0A(B BBBK 0$FBD D@   ABBG 8sFBA A(D`y (A ABBC XTEL`tX FEE A(A0P (D BBBD F (A EBBH Y (D BBBE 4 UBAF d DBE K DBG 4, HFGK ] BBG ADB4HD PFJK ] BBL ADB`\ FBE E(D0A8FPx 8A0A(B BBBA r 8A0A(B BBBD 0"!FBA D`  ABBA D #FBE E(A0Gf 0C(B BBBE 8` l$BEA D(G (A ABBA %CO] L CE <%CJ] I HH\ h%AFEA A(G0 (C ABBJ N (C ABBJ } (C ABBK HD X&FBB E(D0A8F`r 8A0A(B BBBJ L  )FED h BBE H BBL A BBK FJB <)H 8)FBB E(D0C8FP  8D0A(B BBBK H@ ,FFBB B(A0A8D`j 8A0A(B BBBJ < /fFGD f DBC N DBD GDB /#MN8 /BBA D(G} (D ABBJ  0bB G Y\@ 0BBB E(D0D8GN 8A0A(B BBBF yM\A NBNB B(D0A8RK 8D0A(B BBBE IFBKSBEYA$ UK A @ lVK A \ WK A x WK A  XXPH0B A  XSH0E A p X2 BBE B(D0D8GK 8D0A(B BBBF EYAIZB@dK A \eK A xdfH0 A fH0 A lgsH _ I W I blg BBB B(A0A8J|H[B 8A0A(B BBBD aMSB(DsKGKAq A (ptKGKAq A (uKQKAW B (tvKQKAW B $8wH0D8`@K8A0o A $wH0D8`@K8A0o A DHx2dM\pxTENxx x x x(x6_FXID |EK H V R 04}QEDG i AAE NAAL`}K A h};| ~a|~K G H|FBB H(A0A8GL 8A0A(B BBBG ,`_$vKb C W I _A <`vM] F a G W$`MFHD tDBHBBB B(D0D8G@Z 8A0A(B BBBE 04FLA D@j  ABBJ \FDA A(D0s (D ABBD _ (D ABBH R (D ABBE (|`FKD0 ABF (EKD0z AAH 8FLA A(D@ (A ABBE <,FAG | ABK a HBM DCBP d)]xKEm A 4؇ECD  AAG o AAB 4EAD ` AAD c AAK HT  zMj I d J @|]Fn D d`BHX H |YH} K L4FBB B(A0A8D 8A0A(B BBBH 8tFBA U BBF _ BBE <$؏NBE E(A0 (B BBBH 4dHeFGD i DBH N DBA 4FBA  BBC YEBLNBB B(A0 (E BBBF L (E BBBA <$hfFAD f DBI N DBD GDB<d^FAD c DBD N DBD GDB4BBA s BBD D EBE 8 BEE D(D0 (D BBBC lFEE B(D0A8G@DHKPdHA@T 8J0A(B BBBG S 8C0A(B BBBA LDFBE E(A0 (E BBBF  (B EBBB Ԗ Ж H̖DFBB L(A0A8D@ 8D0A(B BBBD \LЗFLD A(D0p (D ABBD h (D DBBD  (L ABBE HP FBB B(A0A8Dp 8D0A(B BBBF \FEE D(A0o (D BBBB K (D BBBK D(A EBBXĢSFk G ZLxPHB A(A0(D BBBEC0OH@A A DOAD { ABF D ABA xH D,GAD sABFH n ABO (tADG f AAD ܥH` A `P.BBB B(D0D8FP 8A0A(B BBBG D 8F0A(B BBBM @ BBB A(A0GA 0A(A BBBH (dEG L@I@ AF 0FEF Kp  DABF (8FKD@ DBD ̻kH0] A 8  BBB D(G (D BBBE HhkYJIhDr J Axd BEB B(A0A8G 8D0A(B BBBE BEBBDDDBJ| xrBb D e C ((MFMNpv DBC (TFKG DBK FD` EK hFD` ED 0FOA D0  DBBF tOBB D(A0D@ 0A(A BBBK D 0C(A BBBB _ 0F(A BBBD _ tHEN M AG 4UFAD c DBD N DBA @FBA J  DBBK Z  DBBE  xFJ`z EA 8 FD` EA p\  BHE B(A0D8P` 8D0A(B BBBK x 8J0F(B BBBH  8D0A(B BBBK v 8A0A(B BBBH 2 8A0A(B BBBL s 8A0A(B BBBK | 8A0A(B BBBJ r 8A0A(B BBBL r 8A0A(B BBBL s 8A0A(B BBBK S 8D0A(B BBBH P 8D0A(B BBBK  8D0A(B BBBF d!BBB B(D0D8M 8A0A(B BBBK { 8A0A(B BBBK H8"d(BBB B(A0A8DP 8D0A(B BBBC ("HBDIPa ABE "K A \"pvNBE B(A0d8O@X8A0h (E BBBI k (E BBBJ <,#^FAD c DBD N DBD GDB\l#PFIA A(D0 (A ABBF e (C ABBK n (A ABBD # 8#FID E BBD N BBF $K A 8$ L$(`$FGG DBC 0$`CFBD G  DBBI 8$|FLD K BBK N BBA d$@FLB B(A0D8D` 8D0A(B BBBB  8L0A(B BBBL @d%xFOI B(A0DP 0D(B BBBA (%TFEG l BBF %(9Fr(%LTFEG l BBF <&FEB D(A0 (D BBBH \&0 p&<L`  & & &TD0R J V J & (&EED0D AAD '*OPB8'L' `' t'' ' 0'rFAD P DBG CAE'8 '4 60 (` FGG A DBE \DB@( WKF A (\( FAIq ABA (d $HW(| ;H m A ( ( S ( L H U K ) ) 0) D) X) l) )| )x -) ) ) )) * *C4*yH0T D P*,{H0[ E l*(TS@*BBB A(D0GP 0D(A BBBC $*THEDD qDAH*|FBA D(L0w (A ABBJ \(A ABB$<+HEG X AK VA4d+(FFD ` DBJ ] ABH +,+FEA E BBK $+TLU G ^ J C0,TfAHD m AAD aCA,<,BIA U BBK l,`,{x,HBBB B(A0A8D`y 8D0A(B BBBD hhVpPxOI`hGpmhA`hZpIxBI`H-1BIB B(A0A8DP 8D0A(B BBBE $\-5AHD [EC(-HH H H P Q O 4-\EID A AAK L AAB ,-$FFD } ABH .#,.IgYH@H.OAA V ABE W FBB SH.P FBA A(D0 (A ABBG I(A ABB8. MAI v ABH M CBF 8/x!FBB A(A0(D BBBP/"-HdLh/4"(BBH D(D0 (D BBBH n (D BBBH d/#H BBB B(D0D8F`d 8A0A(B BBBD  8A0A(B BBBF P 0, FLD c BBC P GIP E EBL v BBN 0t0-FBB B(D0A8D`L0d/BBA A(N0 (A ABBD T (A ABBF 800MBBA D(D0s (A ABBJ (411UFFD  DBI `12VO^CH,1,3BAC  ABH 1414 14YHt E 14H| L _ A (2h5AAD ` DAE @25YLi K \26E B R L 82 7FHA I ABE  ABI 28 28E(28EAD G DAE (39iEAD ~ AAF @3\9!U(T3x9wFAD M DBA (39zEDG v AAH 3 :lEN A $3p:El G x H U A $3:nEs H F J A E 40;D0 A @84;lBJJ i BBE N BBF DEBH|4 <BBB B(A0A8Gp 8A0A(B BBBD @4@QFEE E(A0Dp 0D(B BBBJ H 5AFEE B(K0A8GPc 8D0A(B BBBK X5B Hl5BFEE E(D0A8F@Z 8D0A(B BBBI \5dBFEE G(A0o (D BBBG K (D BBBC D(A EBB6B,6B@6B8T6BFEE D(D@o (D BBBG @6 CdFEG i BBA N BBF DEB\68CFEE G(A0o (D BBBG K (D BBBC D(A EBBt47XCFBE B(A0A8DfJGBVb 8D0A(B BBBE tFGB^`7pDBBE B(K0A8DLFDS 8D0A(B BBBH X8GFBE B(D0G8GPkXJ`JhDpIP~ 8D0A(B BBBH l8pHHE I8tHHB I8xHHB LX8|HFEE E(G0A8G@NHMPMXG`I@X 8D0A(B BBBG 49HFIDXQ`MhBpHPu DBJ T9(I (h9$IFFDPW DBC 9I (9IFFDPW DBC 9I 9I (9IBAD@ ABD D(:KFBB A(A0FF 0A(A BBBH p:NL:NBBE H(G0 (A BBBG K (A BBBN :HPgD^ F L B P:PQLBB B(A0 (E BBBH T (E BBBA @H;RFBH A(A0G@ 0D(A BBBC ;0T ;,T7H N J V4;LT`FEG i BBA N BBA ;tT X <pTFBL B(D0A8FpxMQxAp^ 8D0A(B BBBI Xh<YFLE D(G0m (D BBBG D (M BBBI L(D BBB<XY <TY <PY=LY =HY 8(=DYFAK C ABH K ABA d=Y (x=YVFAD R DBE =Y =Y @=YBEE A(D0G`  0D(A BBBC >l[$>x[88>[CFEA D(GP (D ABBH Xt>\BEE A(D0G@ 0D(A BBBF H 0A(A BBBH >]>]8>]/FGA A(G` (D ABBH 04?^#FAD LP  DABH h?_\EF @ AD ?`JH Z A ?D`JH Z A H?x`BBB B(A0C8GB 8A0A(B BBBA @c$@c(8@cUEAD0s AAA hd@dZBB G(A0A8MPL 8A0A(B BBBF D 8A0A(B BBBJ @Lj@Hj8@DjBBD H(G0~ (A ABBE L4AjFBB B(A0A8JL 8A0A(B BBBB 4AxEFDD a GBH AAB AYEt G J F ĀEq J K E B,B,,B@B̅Ad\XBAd\pB< B8#xBTH t L O I G I G I ` H G I G I G I L L G I G I H H G I h H F J H H I G C(CGHj N F0HCFAD D@  DABA $|CЍ:FAG UGKCHIC:DuC>Hu C@iEs H K E D,Hc@(DFGD q DBH N DBD G DBK HlDBBA A(D0g (C ABBG Z(C ABBLDd BBB B(A0A8L 8D0A(B BBBB ERE L A`(EBEE E(D0A8JPP 8C0A(E BBBA M 8A0A(B BBBI 4E`aBAA t DBJ A CBB `E&FBB E(D0A8GPl 8A0A(B BBBG o 8A0A(B BBBG H(FdBEA D(D0D (D ABBC (D ABB<tF8BDA G0j  AABD h CABFuF.dF01BBB E(D0D8Jk 8D0A(B BBBK f 8C0A(B BBBF \DGFBA A(GPk (A ABBF e (A ABBE ] (A ABBE 0GKADG e FAH HAAHGĬSBBB B(A0A8G@Y 8A0A(B BBBD L$HغFEA I(G0 (D ABBH l (D ABBK @tHdFEG i BBA N BBF DEB@HBAD Z ABD } FBC Q EBH H@+I\+<$IxrFAG [ JBK T GBK DCB<dIrFAG [ JBK T GBK DCB4I}BOK u DBI N DBA HI@FBB B(K0A8D` 8D0A(B BBBD (JH8j@U8C0w A LJlH ^ A hJTHI J\EN T AH JTLC A C JyEN W AE JtFN  EF L K BBA D0Z  DBBE O  DBBI T JBB4\K`BAD n DBE N DBD 8KFEA H(O0c (A ABBD 8KFEA H(O0c (A ABBD  LH t D (L$KH_ I DLXH t D 0`LyEAD k DAF tCALh0HR F O(Lx.ENK@ AAG (L|eEAD @ AAD 8 MDFBD  BBD t BBH HMEX0[ AG lMHIM MkH0] A MGEd G M HTM-M0>Ed G HNP3TOD4Nx%FBD  BBP x BBL A BBC L|N`FBA D(I0 (A ABBD O (A ABBC TN0EBBB B(A0A8H Q D 8A0A(B BBBD `$O()FBE E(A0A8DP 8A0A(B BBBD n 8G0A(B BBBJ OHO BBE E(D0D8G 8A0A(B BBBH OK A PK A L PLFNB B(A0A8G, 8D0A(B BBBF 8pPBEE D(GP} (A BBBE PK A PDK A <PEDD x AAI D DAG DAA0$Qx(FAD D@  AABD 8XQtBHD D(GPy (D ABBE QXFc G L D $QDE D e A k8QFED A(FP (A ABBA `RFBB B(A0A8Dp 8A0A(B BBBA j8G0A(B BBBR\H0 A RH0y A dRD^FBB B(A0A8Dp 8A0A(B BBBB d 8I0H(B BBBK ` S<BBB B(D0C8DP 8A0A(B BBBB Z8H0H(B BBBSHS`FBB E(A0C8D@ 8D0A(B BBBI SRS$ Tp T|RHI E(A0A8 0A(B BBBA n 0A(B BBBI [0A(B BBBDTHTdKDD ZDBEH F ABG KAI$T$EAD UCAHUFBDB B(G0A8IPc 8D0A(B BBBE hU;H|U7FBB E(D0D8D@ 8D0A(B BBBK (UgEDG C AAK U8VD@VPGEDG  AAE C AAC DAA`V\ 4tVXgPED A(D0B(A ABBV8VFEA A(G (A ABBD V7H ] K W'H,WmLn F l LW9JP F PHpW,FBE B(A0D8GpK 8D0A(B BBBE W0HM K KWWmH | D  X  X 4XHMLX `XtX 0XFAA D`{  DABB XX-X@ XQAe J L L PY FBB B(A0A8G I! 8D0A(B BBBE xpYSFEE E(D0I8GP 8D0A(B BBBK T 8M0A(B BBBB D 8A0A(B BBBE (YpAAF A AAE 8ZBEA D(I0M (D ABBE HTZBEB E(A0A8DPe 8D0A(B BBBJ LZ\ xDBB D(A0~ (D BBBK y (A EBBE HZ jBBE B(A0A8D@ 8D0A(B BBBF 4<[ BAD L DBG {AB(t[ aADI H DAA d[\ 1FBB G(F0A8I 8A0A(B BBBL C 8A0A(B BBBC (\4&vADG0 AAC H4\'FEB B(A0A8D 8A0A(B BBBF H\FBB D(A0D@:HMPRHA@ 0A(A BBBF HHPRHA@4yFAA _ ABF ABy| EQ4yEHD b AAK i FAH 4z!E[Pz ;HX H NXpz,BED A(D0F (A ABBD D (C ABBD N(A ABBz`H } K 8zYFLA A(DP (D ABBC ${EN0z AB H{FU0e BF l{0EU Y AD `{NBBE E(D0A8JPE 8A0A(B BBBD I 8A0A(B BBBE { H|DFBB A(N0 (D BBBH V(D EBB0T|FDA D@  DABD |dfED0~ AH H|BEB A(C0t (D BBBE {(A BEB|D  }@\ }<BVF D(D0\ (A BBBG Y (C BBBF s(D BBB8}BED A(G0T (D ABBH <}@FSD A(D: (D ABBK T}FBB B(A0A8H Q DЀ 8A0A(B BBBJ XT~x/OEA C(G0] (G DDIL V (C ABBB `0~LBAC J}  AABG ~EU F Z F PtFBB A(G I!k!H!H!A! (D BBBK <\nFNH DPVXF`RXAP  AABF sE[ L AA <E[ h AG E[ h AG 8TFLA  BBA f BBF xD(FBB B(D0A8DP_ 8F0A(B BBBE  8C0A(B BBBA N 8F0A(B BBBA xl5BBB B(A0A8DP 8A0A(B BBBE Z 8C0A(B BBBB W 8F0A(B BBBJ <0P<dHxTiH Q G qH Z F H zFBB B(A0A8D` 8D0A(B BBBE 0@FAA G@  AABE 0*ET O A<P FNQgeFHKs DBA 8FNQzHHAq DBA ĥFOL B(D0A8DggFFHFKz 8D0A(B BBBJ 088FON Dp  DBBI lmH _ A `$FFOL I(D0A8DFHFK 8D0A(B BBBG 8FKH A(D@ (A ABBD 0(FON Dp  DBBC \mH _ A xmH _ A p(FOL I(D0A8Dj]FHFFFHI 8D0A(B BBBH LTFKI A(A0DX]`FhFpPPu 0A(A BBBJ PXFFOL D(DrFFHI^ (D BBBH pFKI B(D0A8NfFHFHHBI 8D0A(B BBBE P <{FOL D(Dg_HFKd (D BBBJ th ET c AC  H8f@U8C0z H P` FKR GHFHHBIG  DBBA P FKR GHFHHBIJ  DBBA Dd XFON DzHHAa  DBBE 8 FNQzHHAo DBA 8FNQzHHAo DBA $X[H D A @H ] K \H ] K xFQ N EF EN b AJ lvH W A ܈vH W A 4FQ i EK H@ C L8FOL B(A0A8DY 8D0A(B BBBA ($FJK0 DBE hFOL I(D0A8GvFHFFK 8D0A(B BBBD \ <FOL B(A0A8GFHA 8C0A(B BBBA $|"`EY J g A H("FAD0m ABE (ԊX#qEJK0O AAA H#FLB B(A0A8Dp{ 8D0A(B BBBD HL & FLB B(A0A8DP 8D0A(B BBBA 'FK } EE (Ћ(B EAA($F]($F]8(;HX H NX(;HX H Nx)H ] K x)HI)HIČ)`H R A )bH T A  *`H R A d*<H] K G@8*vFAA h DEG [ ABB RAB|*HI*H0d D <+H a G ̍+H j F $,H j F ,H ` H   -H ` H <-jH0\ A $X-H0l8F@N8C0y D $L.H0l8F@N8C0y D .H a G Ď8/H a G /H a G  0H a G 0vH W A 40vH W A P\1`H R A 0l1FJH D0f  AABJ 02FKA D0  AABA @ԏ2FSB A(A0DP 0A(A BBBG @3FKI A(A0G 0A(A BBBA H\3FKI B(A0A8G 8A0A(B BBBD 8t4FKH A(G (A ABBD X5FOL A(A0Dg_HFK 0D(A BBBF h@L6FOL B(A0A8D^qHFHFK 8D0A(B BBBD L7FSE A(A0DPYXF`MXAPu 0A(A BBBB T@8FSE B(A0A8D`YhFpMhA`{ 8A0A(B BBBH LT8FLA A(GqDDDgZ (A ABBA H9FLB B(D0A8G 8D0A(B BBBG 8:FSB A(DP (A BBBD (,;ERD0` AAC (X$<ERD0Z AAI @<FLB A(A0DP 0A(A BBBD 0ȓd=FAA D0  AABF =H0j F d>H0X H (4>FBD@t BBD X`L?YFKP D(GfHFHBI (D BBBJ @PA}FBB A(A0Dp! 0D(A BBBD DBNFON DxHHA_  DBBI DHCFON GGGGse  DBBF DDdFOK DxHHAZ  DBBA `ؕFFOL B(A0A8DHFFK 8D0A(B BBBF @<GFKI A(DX^`RXAPm (A BBBD 0HFAA D0}  AABC IqH \ D Ж JsEN J AB 0hJFNA D@  DABD @($KFSB A(A0DPw 0A(A BBBH lpL0EjLLFLB B(A0A8DE 8A0A(B BBBA Hؗ4NFLB B(A0A8Dp: 8A0A(B BBBA @$P<FPI A(A0D 0D(A BBBE 0hQFPA D  DBBC QsEN J AB Q_H Q A ܘ@RiH [ A RfH X A RnH ` A 0DBdȧwFKI B(A0A8GYFFFHV 8D0A(B BBBB H0FBB B(J0K8D`  8D0A(B BBBD |PEX c AA EX c AA 8ĨFIA A(Q@ (D ABBH (|FIA wBB,WH I A H$HHxPUHC@r F lHHxPUHC@r F \iH R F (FOD DBF (ةd FKDPg ABA 8H4FLB A(G (A BBBK (@LFOJ DBA (lFOJ DBA HFBB B(D0D8Dp 8D0A(B BBBH HBBB B(A0A8Dp 8A0A(B BBBK H0}BBB B(D0D8Dp 8D0A(B BBBH p|BED A(D0{ (A ABBG e (D AFBF G (D AFBD } (A EBBA LFBB D(Z@FRA9 (D BBBD L@FBB D(Z@FRA6 (D BBBG XmSAA G0  AABJ F AABFP0t  AABH H0BBB B(A0A8Dp 8A0A(B BBBD X8FBB B(D0A8ZtSA 8D0A(B BBBH L%BBB B(D0A8Jj 8D0A(B BBBB (x-EW8_@U8C0r AA (-EW8_@U8C0u AA L<@.FBB D(Z@FRA* (D BBBK \0 FBB B(D0J8QCFRA 8D0A(B BBBJ \06mSAA G0  AABD F AABFP0t  AABH 4L@7eFDD E GBD AAB4x7EFDD a GBH AAB 7YEt G J F 47EFDD a GBH AAB 7YEt G J F < 8P8 d8 Hx8FEA D(G0x (G ABBE D(A ABB(İx8#EDD  CAJ |9/9w:,:4@:EFDD a GBH AABx4:g: D:FBE E(D0A8D@8A0A(B BBB::4:NFED g BIG ABBH;AEe N dH;yEO L K E ;HEg L K; TK;9dT(ز<FOJ DBA (<FOJ DBA (0=FOJ DBA (\>FOJ DBA (d?FOJ DBA (8@FOJ DBA ( AFOJ DBA ( AFOJ DBA (8BFOD DBC (dhCFOD DBC ( DFOD DBC (DFOD DBC (TEFOD DBG (FFOD DBH 0@FoFLA D  ABBE tGFN0p BJ tHFN0l BF HFN0} BE |IFN0q BI IFN0q BI (tJFN0} BE LKFN0q BI p|KFN0q BI KFN0g BC dLFN0g BC ܶLFN0l BF LMFN0l BF $MFN0 BB HTNWH I A dNyH0_ I NWH I A @O/H[ E FPOз\O2O$O $ OTIl K F J C4OH0m K PlPAG x AG (tPLADD k DAG (PEAG R AAG ̸`Q\8RldRtd(HSwUAH JAAF@SwH0i A \TH0h H xtTH0h H $TFND zEB`UnH0` A HعUOFBB B(A0A8D@ 8D0A(B BBBD $WE[ P (DHXEDD  AAK p,Y8E[ H KLY HYyEy J K M ȺY8E[ H KYAEj I YEWH YFBB B(A0D8G@b 8D0A(B BBBI `lp[FBB E(A0A8Dps 8H0A(B BBBG [ 8D0A(B BBBH <л]FAG ^ CBO y DBA GDBLl]FBA A(G0 (D ABBI e (D DBBG `^IHMI ]EL^"(h^.EAD` AAJ l`E[ _ AA `}H o A H^ J L qHt L $Hn J p H F Hn J p H F @Hn J p H F d8Hn J p H F Hn J p H F Hn J p H F LHn J p H FaH` H paH` H p4HaH` H p TwHc M s E F xwHc M s E FP\5dP|x=Ht05dPHi\0,pLX5dP|4EFDD d GBE AAB iEA J J F 0 rBDD i DBA qAET8 @h4FEB A(A0DP 0A(A BBBH 8Dj B i G l D \ D P H \ D Id d<Id dtId d0Id dHId d`mHm K llFMH` H \ 0kAO AK |! x!TH F A !FQ@n EF 4H"FQ@n EF X"ENP AA @|`#BBD K BBI f BBF pBB8#'FGA A(Dp (A ABBK $9\\<$FAD q DBN N ABO ZCB0T%0BAN  DBA YDB &AG0l AK &}EN`c AA &uEN`[ AA HH'BEA D0A8D@LHIPIXH`K0{  AABG (@(FGD`a DBH Dl)FPB A(A0DI 0D(A BBBF <x*~FKD v DBG N DBD GDB,* EU`hEpVhA`T AF $$+H`lhEpVhA`^ A L0,TH F A ht,TH F A ,Ad\,Ad\0(-_EAD h DAI ZCAT-`-l-t($-FKD` ABA LP<1BIB B(A0F8Dr 8A0A(B BBBJ  3nEB I C E (X3FND  EBE LL4MDJ A(A0{(D BBBFH0@4H@l D 0\5FLA D@  DBBA 6FN { ED 6hH Z A  7sH0e A p7wH0i A 7FQ R EB ,@8H0k E @H8FBB A(A0DP 0D(A BBBE 8@dFLB A(DP (D BBBJ 4A>FN0 EG 4PBhFMD   DBC N DBD $C/Hf<C/HfDTCFAA d ABI V ABO o CBD H`DFEA A(G0m (D ABBF N (D ABBI 4EMAA y ABE DAB4 |EOFDD j GBG CABXESEMtEEMHb F \F)H`F)H`4F)H`@LFFIB A(A0Q@ 0D(A BBBF 4G)H`LH)H`d(H)H`<|@HFAG k DBA @ DBJ YDBH!H[rSV J BBB A(D0 (H BBBI X (A BBBA 0"hAAD j AAF LAA"9dT#UAz E T0#,KEI0L#(0d#HEQ#L #H+K\H#` FBB E(A0D8GP 8D0A(B BBBE #$ $0H $<FHA D(D0M (D ABBC D(D DBB`l$MFHB E(A0D8DP 8A0A(B BBBK V 8C0A(B BBBA $leH0W A ($@FDD kDB`%yFHE B(A0A8GP 8F0A(B BBBA F 8A0A(B BBBH |%DPo E P%tgLEE D(D0j (A BBBA J(C BBBA4%yFBA D(D0Z(D ABB($&\FAI @HBHP& FFE B(A0A8D@} 8D0A(B BBBE $&gFGN EDBH&FBE A(D0 (F BBBI A(F BBB'10$'QDA P ABG P,X'FHA  MBQ 'r']'<bH[ E 'bH[ E 'bH[ E (8bH[ E  (Qt\(8(ADD N DAD 4d(mBAE @ ABE VAE8(BAA \ ABE N ABG D($ BDA  ABK T AEF W AEC $ )!xHc E D L \ D `H)T"BBB A(A0D@NHbPUHA@d 0A(A BBBB T 0E(A BBBE )"}Kg F ` H \()<#EFDP CAD )#`}b4*$,FAD n DBA Y DBA 8L*%FBA E EBK M DBE *%`HT L \ D *%Er I *&E L 0*'bEDD y CAF MCA+'`HC E K<+(IFf D TH\+@(BBB A(A0 (D BBBF I(A EBB(+(EFG@ AAD H+)BBB B(D0A8G@e 8A0A(B BBBE , ,,,3FAA  ABC P,<-ET0[ AK 8t,-FBA A(DP (A ABBD , 09\\,40,00,,0zHc E O A 0-0FHA Q0  AABJ 0D-82RFHN D0  AABG 0x-d3FHA Q0  AABD (-4FDQ@ DBJ -D6T4-6tBAG } ABF D KBO `$.6MBBB H(A0A8DP 8A0A(B BBBH _8A0D(B BBBL.7BEB A(A0^ (D BBBE K (D BBBC .t8EQ S AF .8H  G /9iEQ D AE FBB B(A0C8D@ 8C0A(B BBBL D 8A0A(B BBBJ h>dgDb>9dT>T E T0>tBBAA DP$  AABA 4>FAD0  CBH u ABH $?hEN q AK (H?GFKD@ DBG t?(F ?EN0 AA ?0?sEDD L AAE OAAH?qFGB B(A0D8G 8A0A(B BBBJ XH@FBB A(D0t (D BBBC S (D EBBH p(D BBBL@FBB A(A0H Q D 0D(A BBBA H@(FEE E(A0D8GP 8D0A(B BBBH 0@A5FBA G  DBBE 8tAFBA C(Gm (A ABBJ 4A܎lFDG I GBM Y GBN AFEE E(A0D8GP 8A0A(B BBBB XL`KhHpIP 8A0A(B BBBD b 8F0A(B BBBG PxBD(FHB A(A0G@ 0A(A BBBB HOPFXD`I@(B `EAG ^ AAC 8BTFBA A(G0[ (A ABBF (4CUEHC u ABA H`C<FBB G(D0w (D BBBJ N (D BBBH 4CEDG \ DAG ` CAD 8Cؗ|FBA D(DP (A ABBI @ DPFEA h BBH b BBJ [ EBF 0dD(eFKD k DBJ NDB0DdFAD J  AABE 0D RFBA G  DBBG HELFBB E(H0D8F 8D0A(B BBBG HLETFEB E(A0A8GP 8A0A(B BBBA `EUFEE E(A0A8GP 8A0A(B BBBA  8C0A(B BBBK HE.FBB B(A0A8Dp  8A0A(B BBBA HFFA I L D \lF0FHE A(G0Z (D BBBA y (D BBBE i (D BBBE HFFFBB B(D0A8DP 8D0A(B BBBA 8GFKD K BBD X BEI HTGHBEE B(D0D8G`u 8A0A(B BBBD HGBEE E(D0D8D` 8A0A(B BBBA HG0BFHE E(D0D8D` 8A0A(B BBBA %N7!W!WqQ`N7qQ`!W!WD D  )!DKKKx!jPKWisjj^}z_ "}}} }}t}4M}P4T}}}}}}}}}}}}}}}}}}}}}}c'}59 8x66Q77d|*}a ^!"""#g$4Ng12+,,8-a}}3.W/CQ~-%.(.))@**}}Z3?}$%}} 4%'}~ }}z     4&~?0/"}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}ijk!  ʾ&Wif5!{!!!g!k! 7&!&!&! F!vS!$!R!&!%!&!&!&!&!%!!&!&!%!!&!&!&!&!aQ!&!&!K&!%!!&!&!%!fS!%R!y!fS!%R!fS!%R!&!%!y!y!y!KK&!%!y!K&!&!%!&!&!%! !Wi%!%!xWi%!%!y!JvS!vS!vS!vS!vS!vS!vS!fOKQ!&!K&!y!y!UT!6F!y!WiK&!%!!YT!&!_S! _S!BF!T!T!T!T!T!T!T!T!T!T!U!U!"U!/U!>U!JU!VU!aU!nU!{U!U!U!U!U!U!U!U!H7H7a!a!a!Wi`!%!b!b!a!b!b!Wx!a!a!a!a!a!a!x!a!a!a!a!a!a!a!a!a!c!)c!7c!Ac!Nc!Xc! cc!@nc!wc!g!٪Kx!٪K 7u!x!܌!!! ! ! !  ! ڌ!!!!!! !!!$!,!4! size of S in memory, in bytesmaketrans(x, y=None, z=None, /) -- Return a translation table usable for str.translate(). If there is only one argument, it must be a dictionary mapping Unicode ordinals (integers) or characters to Unicode ordinals, strings or None. Character keys will be then converted to ordinals. If there are two arguments, they must be strings of equal length, and in the resulting dictionary, each character in x will be mapped to the character at the same position in y. If there is a third argument, it must be a string, whose characters will be mapped to None in the result.S.__format__(format_spec) -> str Return a formatted version of S as described by format_spec.S.format_map(mapping) -> str Return a formatted version of S, using substitutions from mapping. The substitutions are identified by braces ('{' and '}').S.format(*args, **kwargs) -> str Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').S.zfill(width) -> str Pad a numeric string S with zeros on the left, to fill a field of the specified width. The string S is never truncated.S.isprintable() -> bool Return True if all characters in S are considered printable in repr() or S is empty, False otherwise.S.isidentifier() -> bool Return True if S is a valid identifier according to the language definition. Use keyword.iskeyword() to test for reserved identifiers such as "def" and "class". S.isalnum() -> bool Return True if all characters in S are alphanumeric and there is at least one character in S, False otherwise.S.isalpha() -> bool Return True if all characters in S are alphabetic and there is at least one character in S, False otherwise.S.isnumeric() -> bool Return True if there are only numeric characters in S, False otherwise.S.isdigit() -> bool Return True if all characters in S are digits and there is at least one character in S, False otherwise.S.isdecimal() -> bool Return True if there are only decimal characters in S, False otherwise.S.isspace() -> bool Return True if all characters in S are whitespace and there is at least one character in S, False otherwise.S.istitle() -> bool Return True if S is a titlecased string and there is at least one character in S, i.e. upper- and titlecase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.S.isupper() -> bool Return True if all cased characters in S are uppercase and there is at least one cased character in S, False otherwise.S.islower() -> bool Return True if all cased characters in S are lowercase and there is at least one cased character in S, False otherwise.S.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.S.upper() -> str Return a copy of S converted to uppercase.S.translate(table) -> str Return a copy of the string S in which each character has been mapped through the given translation table. The table must implement lookup/indexing via __getitem__, for instance a dictionary or list, mapping Unicode ordinals to Unicode ordinals, strings, or None. If this operation raises LookupError, the character is left untouched. Characters mapped to None are deleted.S.swapcase() -> str Return a copy of S with uppercase characters converted to lowercase and vice versa.S.strip([chars]) -> str Return a copy of the string S with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead.S.splitlines([keepends]) -> list of strings Return a list of the lines in S, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.S.rpartition(sep) -> (head, sep, tail) Search for the separator sep in S, starting at the end of S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return two empty strings and S.S.rstrip([chars]) -> str Return a copy of the string S with trailing whitespace removed. If chars is given and not None, remove characters in chars instead.S.rjust(width[, fillchar]) -> str Return S right-justified in a string of length width. Padding is done using the specified fill character (default is a space).S.rindex(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.S.rfind(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.S.lstrip([chars]) -> str Return a copy of the string S with leading whitespace removed. If chars is given and not None, remove characters in chars instead.S.lower() -> str Return a copy of the string S converted to lowercase.S.ljust(width[, fillchar]) -> str Return S left-justified in a Unicode string of length width. Padding is done using the specified fill character (default is a space).S.index(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.S.partition(sep) -> (head, sep, tail) Search for the separator sep in S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return S and two empty strings.S.find(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.S.expandtabs(tabsize=8) -> str Return a copy of S where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.S.center(width[, fillchar]) -> str Return S centered in a string of length width. Padding is done using the specified fill character (default is a space)S.title() -> str Return a titlecased version of S, i.e. words start with title case characters, all remaining cased characters have lower case.S.casefold() -> str Return a version of S suitable for caseless comparisons.S.capitalize() -> str Return a capitalized version of S, i.e. make the first character have upper case and the rest lower case.S.join(iterable) -> str Return a string which is the concatenation of the strings in the iterable. The separator between elements is S.S.rsplit(sep=None, maxsplit=-1) -> list of strings Return a list of the words in S, using sep as the delimiter string, starting at the end of the string and working to the front. If maxsplit is given, at most maxsplit splits are done. If sep is not specified, any whitespace string is a separator.S.split(sep=None, maxsplit=-1) -> list of strings Return a list of the words in S, using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator and empty strings are removed from the result.S.replace(old, new[, count]) -> str Return a copy of S with all occurrences of substring old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.S.encode(encoding='utf-8', errors='strict') -> bytes Encode S using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.T.count(value) -> integer -- return number of occurrences of valueT.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Return state information for pickling.S.indices(len) -> (start, stop, stride) Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.Private method returning an estimate of len(list(it)).Update a set with the union of itself and others.Return the union of sets as a new set. (i.e. all elements that are in either set.)Update a set with the symmetric difference of itself and another.Return the symmetric difference of two sets as a new set. (i.e. all elements that are in exactly one of the sets.)S.__sizeof__() -> size of S in memory, in bytesRemove an element from a set; it must be a member. If the element is not a member, raise a KeyError.Return state information for pickling.Remove and return an arbitrary set element. Raises KeyError if the set is empty.Report whether this set contains another set.Report whether another set contains this set.Return True if two sets have a null intersection.Update a set with the intersection of itself and another.Return the intersection of two sets as a new set. (i.e. all elements that are in both sets.)Remove all elements of another set from this set.Return the difference of two or more sets as a new set. (i.e. all elements that are in this set but not the others.)Remove an element from a set if it is a member. If the element is not a member, do nothing.Return a shallow copy of a set.x.__contains__(y) <==> y in x.Remove all elements from this set.Add an element to a set. This has no effect if the element is already present.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).rangeobject.index(value, [start, [stop]]) -> integer -- return index of value. Raise ValueError if the value is not present.rangeobject.count(value) -> integer -- return number of occurrences of valueReturn a reverse iterator.Return state information for picklingA bool indicating whether the memory is contiguous.A bool indicating whether the memory is Fortran contiguous.A bool indicating whether the memory is C contiguous.A tuple of integers used internally for PIL-style arrays.A tuple of ndim integers giving the size in bytes to access each element for each dimension of the array.A tuple of ndim integers giving the shape of the memory as an N-dimensional array.An integer indicating how many dimensions of a multi-dimensional array the memory represents.A string containing the format (in struct module style) for each element in the view.The size in bytes of each element of the memoryview.A bool indicating whether the memory is read only.The amount of space in bytes that the array would use in a contiguous representation.The underlying object of the memoryview.cast($self, /, format, *, shape) -- Cast a memoryview to a new format or shape.tolist($self, /) -- Return the data in the buffer as a list of elements.hex($self, /) -- Return the data in the buffer as a string of hexadecimal numbers.tobytes($self, /) -- Return the data in the buffer as a byte string.release($self, /) -- Release the underlying buffer exposed by the memoryview object.Move an existing element to the end (or beginning if last==False). Raises KeyError if the element does not exist. When last=True, acts like a fast version of self[key]=self.pop(key). od.__reversed__() <==> reversed(od)od.copy() -> a shallow copy of odod.clear() -> None. Remove all items from od.popitem($self, /, last=True) -- Remove and return a (key, value) pair from the dictionary. Pairs are returned in LIFO order if last is true or FIFO order if false.od.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raised. od.setdefault(k[,d]) -> od.get(k,d), also set od[k]=d if k not in odReturn state information for picklingOD.fromkeys(S[, v]) -> New ordered dictionary with keys from S. If not specified, the value defaults to None. od.__setitem__(i, y) <==> od[i]=yod.__repr__() <==> repr(od)od.__iter__() <==> iter(od)Initialize an ordered dictionary. The signature is the same as regular dictionaries. Keyword argument order is preserved. od.__eq__(y) <==> od==y. Comparison to another OD is order-sensitive while comparison to a regular mapping is order-insensitive. od.__delitem__(y) <==> del od[y]Return state information for picklingReturn True if the view and the given iterable have a null intersection.Return state information for pickling.Private method returning an estimate of len(list(it)).D.copy() -> a shallow copy of DD.clear() -> None. Remove all items from D.fromkeys($type, iterable, value=None, /) -- Returns a new dict with keys from iterable and values equal to value.D.update([E, ]**F) -> None. Update D from dict/iterable E and F. If E is present and has a .keys() method, then does: for k in E: D[k] = E[k] If E is present and lacks a .keys() method, then does: for k, v in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]D.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.keys() -> a set-like object providing a view on D's keysD.popitem() -> (k, v), remove and return some (key, value) pair as a 2-tuple; but raise KeyError if D is empty.D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raisedD.setdefault(k[,d]) -> D.get(k,d), also set D[k]=d if k not in DD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.__sizeof__() -> size of D in memory, in bytesx.__getitem__(y) <==> x[y]__contains__($self, key, /) -- True if D has a key k, else False.L.sort(key=None, reverse=False) -> None -- stable sort *IN PLACE*L.reverse() -- reverse *IN PLACE*L.count(value) -> integer -- return number of occurrences of valueL.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.L.remove(value) -> None -- remove first occurrence of value. Raises ValueError if the value is not present.L.pop([index]) -> item -- remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.L.extend(iterable) -> None -- extend list by appending elements from the iterableL.insert(index, object) -- insert object before indexL.append(object) -> None -- append object to endL.copy() -> list -- a shallow copy of LL.clear() -> None -- remove all items from LL.__sizeof__() -- size of L in memory, in bytesL.__reversed__() -- return a reverse iterator over the listx.__getitem__(y) <==> x[y]Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).F.__sizeof__() -> size of F in memory, in bytesF.clear(): clear most references held by the framefloat.__format__(format_spec) -> string Formats the float according to format_spec.float.__setformat__(typestr, fmt) -> None You probably don't want to use this function. It exists mainly to be used in Python's test suite. typestr must be 'double' or 'float'. fmt must be one of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian', and in addition can only be one of the latter two if it appears to match the underlying C reality. Override the automatic determination of C-level floating point type. This affects how floats are converted to and from binary strings.float.__getformat__(typestr) -> string You probably don't want to use this function. It exists mainly to be used in Python's test suite. typestr must be 'double' or 'float'. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating point numbers used by the C type named by typestr.float.hex() -> string Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'float.fromhex(string) -> float Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -5e-324float.as_integer_ratio() -> (int, int) Return a pair of integers, whose ratio is exactly equal to the original float and with a positive denominator. Raise OverflowError on infinities and a ValueError on NaNs. >>> (10.0).as_integer_ratio() (10, 1) >>> (0.0).as_integer_ratio() (0, 1) >>> (-.25).as_integer_ratio() (-1, 4)close() -> raise GeneratorExit inside generator.throw(typ[,val[,tb]]) -> raise exception in generator, return next yielded value or raise StopIteration.send(arg) -> send 'arg' into generator, return next yielded value or raise StopIteration.close() -> raise GeneratorExit inside coroutine.throw(typ[,val[,tb]]) -> raise exception in coroutine, return next iterated value or raise StopIteration.send(arg) -> send 'arg' into coroutine, return next iterated value or raise StopIteration.aclose() -> raise GeneratorExit inside generator.athrow(typ[,val[,tb]]) -> raise exception in generator.asend(v) -> send 'v' in generator.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Descriptor to change the deleter on a property.Descriptor to change the setter on a property.Descriptor to change the getter on a property.complex.__format__() -> str Convert to a string according to format_spec.complex.conjugate() -> complex Return the complex conjugate of its argument. (3-4j).conjugate() == 3+4j.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytes, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytes and working to the front.rpartition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing two empty bytes objects and the original bytes object.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.partition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing the original bytes object and two empty bytes objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes objects. The bytes whose method is called is inserted in between each pair. The result is returned as a new bytes object. Example: b'.'.join([b'ab', b'pq', b'rs']) -> b'ab.pq.rs'.B.hex() -> string Create a string of hexadecimal numbers from a bytes object. Example: b'\xb9\x01\xef'.hex() -> 'b901ef'.fromhex($type, string, /) -- Create a bytes object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytes.fromhex('B9 01EF') -> b'\\xb9\\x01\\xef'.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytes using the codec registered for encoding. encoding The encoding with which to decode the bytes. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.Set state information for unpickling.Private method returning an estimate of len(list(it)).translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytearray, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytearray and working to the front.rpartition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing two empty bytearray objects and the copy of the original bytearray object.reverse($self, /) -- Reverse the order of the values in B in place.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.remove($self, value, /) -- Remove the first occurrence of a value in the bytearray. value The value to remove.pop($self, index=-1, /) -- Remove and return a single item from B. index The index from where to remove the item. -1 (the default value) means remove the last item. If no index argument is given, will pop the last item.partition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing the copy of the original bytearray object and two empty bytearray objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes/bytearray objects. The bytearray whose method is called is inserted in between each pair. The result is returned as a new bytearray object.insert($self, index, item, /) -- Insert a single item into the bytearray before the given index. index The index where the value is to be inserted. item The item to be inserted.B.hex() -> string Create a string of hexadecimal numbers from a bytearray object. Example: bytearray([0xb9, 0x01, 0xef]).hex() -> 'b901ef'.fromhex($type, string, /) -- Create a bytearray object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\\xb9\\x01\\xef')extend($self, iterable_of_ints, /) -- Append all the items from the iterator or sequence to the end of the bytearray. iterable_of_ints The iterable of items to append.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytearray using the codec registered for encoding. encoding The encoding with which to decode the bytearray. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.copy($self, /) -- Return a copy of B.clear($self, /) -- Remove all items from the bytearray.append($self, item, /) -- Append a single item to the end of the bytearray. item The item to be appended.__sizeof__($self, /) -- Returns the size of the bytearray object in memory, in bytes.__reduce_ex__($self, proto=0, /) -- Return state information for pickling.__reduce__($self, /) -- Return state information for pickling.B.__alloc__() -> int Return the number of bytes actually allocated.This method is called when a class is subclassed. The default implementation does nothing. It may be overridden to extend subclasses. Abstract classes can override this to customize issubclass(). This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). int.from_bytes(bytes, byteorder, *, signed=False) -> int Return the integer represented by the given array of bytes. The bytes argument must be a bytes-like object (e.g. bytes or bytearray). The byteorder argument determines the byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. The signed keyword-only argument indicates whether two's complement is used to represent the integer.int.to_bytes(length, byteorder, *, signed=False) -> bytes Return an array of bytes representing an integer. The integer is represented using length bytes. An OverflowError is raised if the integer is not representable with the given number of bytes. The byteorder argument determines the byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. The signed keyword-only argument determines whether two's complement is used to represent the integer. If signed is False and a negative integer is given, an OverflowError is raised.int.bit_length() -> int Number of bits necessary to represent self in binary. >>> bin(37) '0b100101' >>> (37).bit_length() 6zip(iter1 [,iter2 [...]]) --> zip object Return a zip object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the shortest iterable in the argument sequence is exhausted and then it raises StopIteration.map(func, *iterables) --> map object Make an iterator that computes the function using arguments from each of the iterables. Stops when the shortest iterable is exhausted.filter(function or None, iterable) --> filter object Return an iterator yielding those items of iterable for which function(item) is true. If function is None, return the items that are true.str(object='') -> str str(bytes_or_buffer[, encoding[, errors]]) -> str Create a new string object from the given object. If encoding or errors is specified, then the object must expose a data buffer that will be decoded using the given encoding and error handler. Otherwise, returns the result of object.__str__() (if defined) or repr(object). encoding defaults to sys.getdefaultencoding(). errors defaults to 'strict'.tuple() -> empty tuple tuple(iterable) -> tuple initialized from iterable's items If the argument is a tuple, the return value is the same object.slice(stop) slice(start, stop[, step]) Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object Build an immutable unordered collection of unique elements.set() -> new empty set object set(iterable) -> new set object Build an unordered collection of unique elements.range(stop) -> range object range(start, stop[, step]) -> range object Return an object that produces a sequence of integers from start (inclusive) to stop (exclusive) by step. range(i, j) produces i, i+1, i+2, ..., j-1. start defaults to 0, and stop is omitted! range(4) produces 0, 1, 2, 3. These are exactly the valid indices for a list of 4 elements. When step is given, it specifies the increment (or decrement).Capsule objects let you wrap a C "void *" pointer in a Python object. They're a way of passing data through the Python interpreter without creating your own custom type. Capsules are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another. A simple attribute-based namespace. SimpleNamespace(**kwargs)module(name[, doc]) Create a module object. The name must be a string; the optional doc argument can have any type.memoryview(object) -- Create a new memoryview object which references the given object.Dictionary that remembers insertion orderdict() -> new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)list() -> new empty list list(iterable) -> new list initialized from iterable's itemsstaticmethod(function) -> method Convert a function to be a static method. A static method does not receive an implicit first argument. To declare a static method, use this idiom: class C: @staticmethod def f(arg1, arg2, ...): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.classmethod(function) -> method Convert a function to be a class method. A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom: class C: @classmethod def f(cls, arg1, arg2, ...): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument. Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.function(code, globals[, name[, argdefs[, closure]]]) Create a function object from a code object and a dictionary. The optional name string overrides the name from the code object. The optional argdefs tuple specifies the default argument values. The optional closure tuple supplies the bindings for free variables.float(x) -> floating point number Convert a string or number to a floating point number, if possible.enumerate(iterable[, start]) -> iterator for index, value of iterable Return an enumerate object. iterable must be another object that supports iteration. The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...reversed(sequence) -> reverse iterator over values of the sequence Return a reverse iteratorproperty(fget=None, fset=None, fdel=None, doc=None) -> property attribute fget is a function to be used for getting an attribute value, and likewise fset is a function for setting, and fdel a function for del'ing, an attribute. Typical use is to define a managed attribute x: class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.") Decorators make defining new properties or modifying existing ones easy: class C(object): @property def x(self): "I am the 'x' property." return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._x complex(real[, imag]) -> complex number Create a complex number from a real part and an optional imaginary part. This is equivalent to (real + imag*1j) where imag defaults to 0.code(argcount, kwonlyargcount, nlocals, stacksize, flags, codestring, constants, names, varnames, filename, name, firstlineno, lnotab[, freevars[, cellvars]]) Create a code object. Not for the faint of heart.instancemethod(function) Bind a function to a class.method(function, instance) Create a bound instance method object.bytes(iterable_of_ints) -> bytes bytes(string, encoding[, errors]) -> bytes bytes(bytes_or_buffer) -> immutable copy of bytes_or_buffer bytes(int) -> bytes object of size given by the parameter initialized with null bytes bytes() -> empty bytes object Construct an immutable array of bytes from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - any object implementing the buffer API. - an integerbytearray(iterable_of_ints) -> bytearray bytearray(string, encoding[, errors]) -> bytearray bytearray(bytes_or_buffer) -> mutable copy of bytes_or_buffer bytearray(int) -> bytes array of size given by the parameter initialized with null bytes bytearray() -> empty bytes array Construct a mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a buffer object - any object implementing the buffer API. - an integersuper() -> same as super(__class__, ) super(type) -> unbound super object super(type, obj) -> bound super object; requires isinstance(obj, type) super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super().meth(arg) This works for class methods too: class C(B): @classmethod def cmeth(cls, arg): super().cmeth(arg) int(x=0) -> integer int(x, base=10) -> integer Convert a number or string to an integer, or return 0 if no arguments are given. If x is a number, return x.__int__(). For floating point numbers, this truncates towards zero. If x is not a number or if base is given, then x must be a string, bytes, or bytearray instance representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4type(object_or_name, bases, dict) type(object) -> the object's type type(name, bases, dict) -> a new typebool(x) -> bool Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed.Exception.with_traceback(tb) -- set self.__traceback__ to tb and return self.      `&}@pD`w' @pDw`& 1D@pD=D' @&@pDKD' iD@pDtD@& D@pDD' D@pDw' `&D@pDpx' D@pDD& 7@D!HE!EPE1EX'E?E`5EFEh`' DYE0P&`&`* {E@qEjPH`PEPE!XEE`EEhEEpP` DE@&'` EEE F$F)P!J FN(9Q!0FD@EL& %&  %& %QFЭp@Ьp @@ ``i0 `PpЛ`@ХieFrF0%& P%F j@%ka! &(!&b!&ی&F&F @&F &F` @&Hu & & &F0 &Џ &Bp &J @&F`&K@@&F@&FP &Kp`&K`&ݏ&̌&K &F`&%F%F%F%FP%F@%F0@%F%F@% G%G`%G%#G@ %+GP`%8Gp%l@% %DG%ߥ@%.P} !@%OG%ZG0ZG B` & & rF &&  &F` &&  !E:G GK && L @&rF0F && ]  &G H`&Go @&G` `&Gu &Gb @&G} &G &&   &OGpF `&Gp{ &Go  &P 0w P| `p 'g!Z &k!- &G H`&Gn @&Gp &G` `&$H  &Gu &Hv &Gb @&G} &G &@* `&&   &Z(! &OGpF `&Gp{ &Hx &Go  &h &0  P 0w P| `p p w } q rF2 && N `&F`3  &rF@3 && L `&FO  &!E:G IH0P  && K PH ` &BH &> A > E H L &  &   &F xH Hp H H0} Hp H &  H $&H0 @$&H $&H #& `#&H #&H0 "&I "&Iл !&I` !& I `!&I !&P!l `&&-Ip &&p %&5I @%&K`~ (yHK0 `yRK y\K `?&l >&p =&mK zZG@ xK `<&S `:&ߥ :&` @  p ~ `~ @~ p 0 `~ p KP K7` KK`) K#W!@ qQK@ qQKp- qQE!`| qQE!z qQH` T LHp @U xz/L zKE&ZGPߥ@E&@PpХpMMMMM N(N0N8N@'NH3NP`?NhGN$VNpOGH0J8|HJ8|Hp|& PoN0rFF&& ``F&F` F&FC2@ srFPX&& p&FX&P-`.rNNH|N |N ` Nw$ N& p& NO q&!O @q&ߥ& 3OOG0 }F 8}4K x9K`Y yLO }VOpY }>K }bO x&=` u&R  s&HK (~mO P~wO x~RK ~ZG ߥ OGR V pW  ` ` @ p С G PX P @  H H й Op H p O   H  H O O(OOOO OXO0 (O `P E [0 (FP hOG @000 P  {!@'PFPH E @& p U(  @& &D& p+ @&  6J @ @ &KJ p @ &YJ @p 0 &@H @P &kJ J D& `&k'  kJp J P D & 0 &m'  J J J  J HЩ H p @&P P &p' H - @ P &&&K& & &V  K v'@@z b K @ LA&Lj A&#W! ^ @&L@ S % @ (a y' &&LB&Lj  B&#W! ^ A&dL@ S &% @ ({'`&&L( }'@ `c &L(@ p'@ n &! @{ a &s MP S Ђ'% @ (&@&&800D& `&` M D &p &` !M8Т`@&`& &4M0@`&&FM0@&`&@&` XM0P@&`&&0]M0P@&`&&|M 0@P& & &@&&@@&+8D&`Ў@&`&&p  &&@&&`!@&`&&0`N @ &`@&&pQ(@p@`&p @&&`&PЈ-@@&}N @&ZGF:H.FG!V&FF@;F0Fl{U&p``U&BPF#G`9G@9 G9F9F 9F9F9F9`T&J,F:K@S&.!R&ЏQ&(!O&FpFFFK-ݏ N&ی  L&K0K&b!I&̌*I&FFK@H&F;F:LF&F@:l0!pP@'&p&C`@`&&@`'N @P 'N~p&& p&w@p&OGp~o&`o&F Hk!p o&Gpn&@~G!l&Fv'Jl&F@xl k&p0j&Bxvi&#G2G 2 G@3F3F1F5F4Fh&JFдKP@h&. w! g&Џ`e&`d&Z(!c&(!b&.J.@b&F@yFyK@ݏ``&ی`^&K]&b! \&̌p@[&FvKpZ&FF  Y&F@lp`.`@n z-(' b s D&( 'k @u !` p h} ''` @ `(p 0 D& @ p@ ' '' ` @  h@ 'h&@isP ` ' @`Pp PPPp0P2Q@p`еD@@'' ' ý &` & &&0 ы8'''@'&'Q0 @ @ @| `} (`&&&PF o `'F o &P '' PKP`{ &@2'&@P@|&&A@pD`& x@g~HD0''@pD'  'x!7Ɍ%!b!%׌%%%`! '[EN'OIIM%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%  !"#%%%%%%  !"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%'' ' ' @'@' HwHQFx!7QFɌ %!b!0%P%׌p%%'hpDɦ'P @pDp' 'JJIH!EHM!MwiGIIMMwH4K9K@'{E@JHP&  `!@-PKE!ZC2W!L#W!@'hpD'P '|hpD˫'P 'lhpDޫ'P '[hpD'P 'HhpD'P `'6hpDи'P '$hpD 'P 'hpD'P @'hpD2`'P 'hpDD`'P 'ѩhpDX`'P 'hpDl'P 'hpD`'P `'hpD'P 'u@pD`& 'f@pD(`& @'X@pD`& 'J@pDй`& ';@pD(`&  '-@pD``& '@pD`& `'@pD`& '@pD' '@pD@' @'֨@pD' hp( D0P&`&$ h & Dͬ0P&`&#  (@pPD@& (pPDh@`(` `(pPD@&` (x@pD( (n@pD' @(Z@pD@'  (K@pD+@'  (B@pDE'  (XD^@`( (lXD@`'@'' `( @pDp ' (HD( ' '(@pDP ' @(ߧ@pDp' ''sys.float_info A structseq holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.+(!(aXiJ!t|hN8>.J`!PJ(( `!sys.int_info A struct sequence that holds information about Python's internal representation of integers. The attributes are read only.o~`((fO`!!IMI>>>IxHH$HM  isatty($self, /) -- True if the file is connected to a TTY device.fileno($self, /) -- Return the underlying file descriptor (an integer).writable($self, /) -- True if file was opened in a write mode.readable($self, /) -- True if file was opened in a read mode.seekable($self, /) -- True if file supports random-access.close($self, /) -- Close the file. A closed file cannot be used for further I/O operations. close() may be called more than once without error.truncate($self, size=None, /) -- Truncate the file to at most size bytes and return the truncated size. Size defaults to the current file position, as returned by tell(). The current file position is changed to the value of size.tell($self, /) -- Current file position. Can raise OSError for non seekable files.seek($self, pos, whence=0, /) -- Move to new file position and return the file position. Argument offset is a byte count. Optional argument whence defaults to SEEK_SET or 0 (offset from start of file, offset should be >= 0); other values are SEEK_CUR or 1 (move relative to current position, positive or negative), and SEEK_END or 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). Note that not all file objects are seekable.write($self, b, /) -- Write buffer b to file, return number of bytes written. Only makes one system call, so not all of the data may be written. The number of bytes actually written is returned. In non-blocking mode, returns None if the write would block.readinto($self, buffer, /) -- Same as RawIOBase.readinto().readall($self, /) -- Read all data from the file, returned as bytes. In non-blocking mode, returns as much as is immediately available, or None if no data is available. Return an empty bytes object at EOF.read($self, size=-1, /) -- Read at most size bytes, returned as bytes. Only makes one system call, so less data may be returned than requested. In non-blocking mode, returns None if no data is available. Return an empty bytes object at EOF.FileIO(file, mode='r', closefd=True, opener=None) -- Open a file. The mode can be 'r' (default), 'w', 'x' or 'a' for reading, writing, exclusive creation or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. A FileExistsError will be raised if it already exists when opened for creating. Opening a file for creating implies writing so this mode behaves in a similar way to 'w'.Add a '+' to the mode to allow simultaneous reading and writing. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling opener with (*name*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).truncate($self, size=None, /) -- Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new size.seek($self, pos, whence=0, /) -- Change stream position. Seek to byte offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos may be negative; 2 End of stream - pos usually negative. Returns the new absolute position.getvalue($self, /) -- Retrieve the entire contents of the BytesIO object.getbuffer($self, /) -- Get a read-write view over the contents of the BytesIO object.read($self, size=None, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative, read until EOF is reached. Return an empty bytes object at EOF.readlines($self, size=None, /) -- List of bytes objects, each a line from the file. Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned.readline($self, size=None, /) -- Next line from the file, as a bytes object. Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty bytes object at EOF.readinto($self, buffer, /) -- Read bytes into buffer. Returns number of bytes read (0 for EOF), or None if the object is set not to block and has no data to read.read1($self, size, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative or omitted, read until EOF is reached. Return an empty bytes object at EOF.writelines($self, lines, /) -- Write lines to the file. Note that newlines are not added. lines can be any iterable object producing bytes-like objects. This is equivalent to calling write() for each element.write($self, b, /) -- Write bytes to file. Return the number of bytes written.tell($self, /) -- Current file position, an integer.isatty($self, /) -- Always returns False. BytesIO objects are not connected to a TTY-like device.flush($self, /) -- Does nothing.close($self, /) -- Disable all I/O operations.writable($self, /) -- Returns True if the IO object can be written.seekable($self, /) -- Returns True if the IO object can be seeked.readable($self, /) -- Returns True if the IO object can be read.BytesIO(initial_bytes=b'') -- Buffered I/O implementation using an in-memory bytes buffer.K`hKxhKhKR! !)!и$(#(!#(E!"(! (] (V!` (#W!(0@(1!`g(Ț!g(K\`(E!h(ЁKG1!N3(N@3(Ț!`N2(#W!O2(KO`2(E!PO1(01(E!@1(`0(r!/(!.(ZC-(!P,()!,(0+(P@+(!*(V!p )(FpOG:(:(:(:(:(:(:(:(:(:(:(:(:(:(;(;(;(;( ;( ;(0;(0;(@;(@;(P;(P;(`;(`;(p;(p;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(<(<(<(<( <( <(0<(0<(@<(@<(P<(P<(`<(`<(p<(p<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(<(=(=(=(=( =( =(0=(0=(@=(@=(P=(P=(`=(`=(p=(p=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(=(>(>(>(>( >( >(0>(0>(@>(@>(P>(P>(`>(`>(p>(p>(>(>(` Ё 0 0 P r 0 P m Ё 0 o Ё 0 Ё 0 FKkJQFHJHH"-HHHwH0pD%(FG 5(5(`4((F@ D4(GH07(7(( & Т F(N8iF(p_ Ж  E(Н The error setting of the decoder or encoder. Subclasses should override. Line endings translated so far. Only line endings translated during reading are considered. Subclasses should override. Encoding of the text stream. Subclasses should override. Write string to stream. Returns the number of characters written (which is always equal to the length of the string). Read until newline or EOF. Returns an empty string if EOF is hit immediately. Read at most n characters from stream. Read from underlying buffer until we have n characters or we hit EOF. If n is negative or omitted, read until EOF. Separate the underlying buffer from the TextIOBase and return it. After the underlying buffer has been detached, the TextIO is in an unusable state. Write the given buffer to the IO stream. Returns the number of bytes written, which is always the length of b in bytes. Raises BlockingIOError if the buffer is full and the underlying raw stream cannot accept more data at the moment. readinto1($self, buffer, /) -- readinto($self, buffer, /) -- Read and return up to n bytes, with at most one read() call to the underlying raw stream. A short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. Read and return up to n bytes. If the argument is omitted, None, or negative, reads and returns all data until EOF. If the argument is positive, and the underlying raw stream is not 'interactive', multiple raw reads may be issued to satisfy the byte count (unless EOF is reached first). But for interactive raw streams (as well as sockets and pipes), at most one raw read will be issued, and a short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. Returns None if the underlying raw stream was open in non-blocking mode and no data is available at the moment. detach($self, /) -- Disconnect this buffer from its underlying raw stream and return it. After the raw stream has been detached, the buffer is in an unusable state.readall($self, /) -- Read until EOF, using multiple read() call.read($self, size=-1, /) -- truncate($self, pos=None, /) -- tell($self, /) -- seek($self, cookie, whence=0, /) -- isatty($self, /) -- writable($self, /) -- readable($self, /) -- seekable($self, /) -- fileno($self, /) -- close($self, /) -- flush($self, /) -- readline($self, size=-1, /) -- read($self, size=-1, /) -- write($self, text, /) -- detach($self, /) -- reset($self, /) -- setstate($self, state, /) -- getstate($self, /) -- decode($self, /, input, final=False) -- write($self, buffer, /) -- truncate($self, pos=None, /) -- seek($self, target, whence=0, /) -- readline($self, size=-1, /) -- readinto1($self, buffer, /) -- readinto($self, buffer, /) -- read1($self, size, /) -- peek($self, size=0, /) -- read($self, size=-1, /) -- Base class for text I/O. This class provides a character and line based interface to stream I/O. There is no readinto method because Python's character strings are immutable. There is no public constructor. Base class for buffered IO objects. The main difference with RawIOBase is that the read() method supports omitting the size argument, and does not have a default implementation that defers to readinto(). In addition, read(), readinto() and write() may raise BlockingIOError if the underlying raw stream is in non-blocking mode and not ready; unlike their raw counterparts, they will never return None. A typical implementation should not inherit from a RawIOBase implementation, but wrap one. Base class for raw binary I/O.writelines($self, lines, /) -- readlines($self, hint=-1, /) -- Return a list of lines from the stream. hint can be specified to control the number of lines read: no more lines will be read if the total size (in bytes/characters) of all lines so far exceeds hint.readline($self, size=-1, /) -- Read and return a line from the stream. If size is specified, at most size bytes will be read. The line terminator is always b'\n' for binary files; for text files, the newlines argument to open can be used to select the line terminator(s) recognized.isatty($self, /) -- Return whether this is an 'interactive' stream. Return False if it can't be determined.fileno($self, /) -- Returns underlying file descriptor if one exists. OSError is raised if the IO object does not use a file descriptor.writable($self, /) -- Return whether object was opened for writing. If False, write() will raise OSError.readable($self, /) -- Return whether object was opened for reading. If False, read() will raise OSError.seekable($self, /) -- Return whether object supports random access. If False, seek(), tell() and truncate() will raise OSError. This method may need to do a test seek().close($self, /) -- Flush and close the IO object. This method has no effect if the file is already closed.flush($self, /) -- Flush write buffers, if applicable. This is not implemented for read-only and non-blocking streams.Truncate file to size bytes. File pointer is left unchanged. Size defaults to the current IO position as reported by tell(). Returns the new size.tell($self, /) -- Return current stream position.Change stream position. Change the stream position to the given byte offset. The offset is interpreted relative to the position indicated by whence. Values for whence are: * 0 -- start of stream (the default); offset should be zero or positive * 1 -- current stream position; offset may be negative * 2 -- end of stream; offset is usually negative Return the new absolute position.TextIOWrapper(buffer, encoding=None, errors=None, newline=None, line_buffering=False, write_through=False) -- Character and line based layer over a BufferedIOBase object, buffer. encoding gives the name of the encoding that the stream will be decoded or encoded with. It defaults to locale.getpreferredencoding(False). errors determines the strictness of encoding and decoding (see help(codecs.Codec) or the documentation for codecs.register) and defaults to "strict". newline controls how line endings are handled. It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If line_buffering is True, a call to flush is implied when a call to write contains a newline character.IncrementalNewlineDecoder(decoder, translate, errors='strict') -- Codec used when reading a file in universal newlines mode. It wraps another incremental decoder, translating \r\n and \r into \n. It also records the types of newlines encountered. When used with translate=False, it ensures that the newline sequence is returned in one piece. When used with decoder=None, it expects unicode strings as decode input and translates newlines without first invoking an external decoder.BufferedRWPair(reader, writer, buffer_size=DEFAULT_BUFFER_SIZE, /) -- A buffered reader and writer object together. A buffered reader object and buffered writer object put together to form a sequential IO object that can read and write. This is typically used with a socket or two-way pipe. reader and writer are RawIOBase objects that are readable and writeable respectively. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.BufferedRandom(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffered interface to random access streams. The constructor creates a reader and writer for a seekable stream, raw, given in the first argument. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.BufferedWriter(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffer for a writeable sequential RawIO object. The constructor creates a BufferedWriter for the given writeable raw stream. If the buffer_size is not given, it defaults to DEFAULT_BUFFER_SIZE.BufferedReader(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- Create a new buffered reader using the given readable raw IO object.The abstract base class for all I/O classes, acting on streams of bytes. There is no public constructor. This class provides dummy implementations for many methods that derived classes can override selectively; the default implementations represent a file that cannot be read, written or seeked. Even though IOBase does not declare read, readinto, or write because their signatures will vary, implementations and clients should consider those methods part of the interface. Also, implementations may raise UnsupportedOperation when operations they do not support are called. The basic type used for binary data read from or written to a file is bytes. Other bytes-like objects are accepted as method arguments too. In some cases (such as readinto), a writable object is required. Text I/O classes work with str data. Note that calling any method (except additional calls to close(), which are ignored) on a closed stream should raise a ValueError. IOBase (and its subclasses) support the iterator protocol, meaning that an IOBase object can be iterated over yielding the lines in a stream. IOBase also supports the :keyword:`with` statement. In this example, fp is closed after the suite of the with statement is complete: with open('spam.txt', 'r') as fp: fp.write('Spam and eggs!') 7 J(1 0`J(@J(: L()! L(ZCPK(E! K(: Q()!P`O(r!N(!@N(J!@N(E!@M()!@R(R(!E!JK 1 2t 007(z  X!`: T(E!ZT()!HT(ZC@BT(KCPT(#W!0D0T(K/T(P0S(1!0S(Ț!01S(E!1S(!_`S(g0S(V!S(1 2G!NU(!NPU(!.0U( U(K)!pW!r!!J!E!K01!PȚ!p#W!E!KPJPK !(#W!: `1!ЩȚ!@KE! K! V(V!U()! @W(r! W(!V(J! V(ZC`V(W! W(E!U(OGpKPJPK !(#W!: `Ț!@KE! E!U(V!U(K! V(OGpKPJPK !(: KP#W!`1!ЩKE! )! @W(W! W(r! W(!V(J! V(ZC`V(! V(V!U(OGpN& ZGI [ f It   b}O    p 0  p 0!O H OHHOKH @qQ @qQ HqQ HqQIX d K h xpg \ h '  d K  l J 8 l qQ `- U  `- K  pb 0M  pb M @nIpb 0N p~Ipb N  pb 0O  pb O uIm K 0 - \ `% k pV - . `W 5 . 0P @x(pi '  8_ @ @o L qQH `e K `R f K \ f K  f 3 J P n 3 K w 5 J  5 K  6 J ! 6 K P! 9 J ! 9 K ! `; J ! `; K 0" < T p" < T " * K  * K  + K #" ` R #+ @+ K H#6 > J h#A > K #M @ J #X @ K $d B J H$l B K x$u C J $} C K $  0E J %  0E K H% (`+ K x% 8+ K % @+ J % H+ J % P+ J 0& X , J h& `@, J & h`, J & p, J ' x, J H' , J ' , J 'F J 'F K ((!`H J `(-`H K (:- J (H - J )U + K @)_08 J )j08 K )v, J (*[ Q `*J * J *I@* U *bI@* @R +[ Q `*f J P  W ! W P!J@ Y *I) Y *bI) Z +G_ pS 8+  J p+ (W +N8A `W(u(`t(Q @X(u(e @Z(v(`!P50FD c(@y( x( w(P (Ph(`{({(@3 0Dj(p(`|(|( $ Dl(pHH (~(~(p Dm(pHH(((0 Dn(pHH(((K!Ѕa(@a(V!`(K0 `(#W!@_(pF^(1!F`^(Ț!F](   . K0@](E!p\(AIKIZC[(!Z(P`Z(=  `D@o(F0F@(@(\ R H @ x- 5 %  uI  nI~I       IH:!-       v       u } d l M X 6 A + U"           _j  w  f n JGIbIJ 0] 6nI  - !FpC@@e (K8P-K0 p -N!W!W7!L{!RV[f!cnxP!K .`(H ?(!7Low-level inferface to warnings functionality.Issue a warning, or maybe ignore it or raise an exception._warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up./,DЪ((& '@('(!+2+?+JM++xET++h_+f+q+}+t+J+ET++ ++x+FFG++++P!+x+xU}!+xi+xxBIx++BQ++Ji!+dxxx++>x++++++MI +++ +Ji!  IET+xt t t dt {E+++++QI+I+ ++ +++ +++ +++hx,+ x ,x ,xJ,++,J+,',J+,',ET+++++'b!(@(t!8,jPE 'A,x!8,P,x! k!HP!QF}+f+q+_+t+?+2+M+++++GFFU}!i++BQ+d+P!>++M++ Ji!I++Q+IT+d++ ,h + ,Ex{E+,',, +t JJPJvdPj7KKk!jij %jvars([object]) -> dictionary Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.sum($module, iterable, start=0, /) -- Return the sum of a 'start' value (default: 0) plus an iterable of numbers When the iterable is empty, return the start value. This function is intended specifically for use with numeric values and may reject non-numeric types.sorted($module, iterable, /, *, key=None, reverse=False) -- Return a new list containing all items from the iterable in ascending order. A custom key function can be supplied to customize the sort order, and the reverse flag can be set to request the result in descending order.setattr($module, obj, name, value, /) -- Sets the named attribute on the given object to the specified value. setattr(x, 'y', v) is equivalent to ``x.y = v''round(number[, ndigits]) -> number Round a number to a given precision in decimal digits (default 0 digits). This returns an int when called with one argument, otherwise the same type as the number. ndigits may be negative.repr($module, obj, /) -- Return the canonical string representation of the object. For many object types, including most builtins, eval(repr(obj)) == obj.print(value, ..., sep=' ', end='\n', file=sys.stdout, flush=False) Prints the values to a stream, or to sys.stdout by default. Optional keyword arguments: file: a file-like object (stream); defaults to the current sys.stdout. sep: string inserted between values, default a space. end: string appended after the last value, default a newline. flush: whether to forcibly flush the stream.pow($module, x, y, z=None, /) -- Equivalent to x**y (with two arguments) or x**y % z (with three arguments) Some types, such as ints, are able to use a more efficient algorithm when invoked using the three argument form.ord($module, c, /) -- Return the Unicode code point for a one-character string.oct($module, number, /) -- Return the octal representation of an integer. >>> oct(342391) '0o1234567'next(iterator[, default]) Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.min(iterable, *[, default=obj, key=func]) -> value min(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its smallest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the smallest argument.max(iterable, *[, default=obj, key=func]) -> value max(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its biggest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the largest argument.locals($module, /) -- Return a dictionary containing the current scope's local variables. NOTE: Whether or not updates to this dictionary will affect name lookups in the local scope and vice-versa is *implementation dependent* and not covered by any backwards compatibility guarantees.len($module, obj, /) -- Return the number of items in a container.iter(iterable) -> iterator iter(callable, sentinel) -> iterator Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.issubclass($module, cls, class_or_tuple, /) -- Return whether 'cls' is a derived from another class or is the same class. A tuple, as in ``issubclass(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``issubclass(x, A) or issubclass(x, B) or ...`` etc.isinstance($module, obj, class_or_tuple, /) -- Return whether an object is an instance of a class or of a subclass thereof. A tuple, as in ``isinstance(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``isinstance(x, A) or isinstance(x, B) or ...`` etc.input($module, prompt=None, /) -- Read a string from standard input. The trailing newline is stripped. The prompt string, if given, is printed to standard output without a trailing newline before reading input. If the user hits EOF (*nix: Ctrl-D, Windows: Ctrl-Z+Return), raise EOFError. On *nix systems, readline is used if available.id($module, obj, /) -- Return the identity of an object. This is guaranteed to be unique among simultaneously existing objects. (CPython uses the object's memory address.)hex($module, number, /) -- Return the hexadecimal representation of an integer. >>> hex(12648430) '0xc0ffee'hash($module, obj, /) -- Return the hash value for the given object. Two objects that compare equal must also have the same hash value, but the reverse is not necessarily true.hasattr($module, obj, name, /) -- Return whether the object has an attribute with the given name. This is done by calling getattr(obj, name) and catching AttributeError.globals($module, /) -- Return the dictionary containing the current scope's global variables. NOTE: Updates to this dictionary *will* affect name lookups in the current global scope and vice-versa.getattr(object, name[, default]) -> value Get a named attribute from an object; getattr(x, 'y') is equivalent to x.y. When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.format($module, value, format_spec='', /) -- Return value.__format__(format_spec) format_spec defaults to the empty string. See the Format Specification Mini-Language section of help('FORMATTING') for details.exec($module, source, globals=None, locals=None, /) -- Execute the given source in the context of globals and locals. The source may be a string representing one or more Python statements or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.eval($module, source, globals=None, locals=None, /) -- Evaluate the given source in the context of globals and locals. The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.divmod($module, x, y, /) -- Return the tuple (x//y, x%y). Invariant: div*y + mod == x.dir([object]) -> list of strings If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.delattr($module, obj, name, /) -- Deletes the named attribute from the given object. delattr(x, 'y') is equivalent to ``del x.y''compile($module, /, source, filename, mode, flags=0, dont_inherit=False, optimize=-1) -- Compile source into a code object that can be executed by exec() or eval(). The source code may represent a Python module, statement or expression. The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if true, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or false these statements do influence the compilation, in addition to any features explicitly specified.chr($module, i, /) -- Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.callable($module, obj, /) -- Return whether the object is callable (i.e., some kind of function). Note that classes are callable, as are instances of classes with a __call__() method.bin($module, number, /) -- Return the binary representation of an integer. >>> bin(2796202) '0b1010101010101010101010'ascii($module, obj, /) -- Return an ASCII-only representation of an object. As repr(), return a string containing a printable representation of an object, but escape the non-ASCII characters in the string returned by repr() using \\x, \\u or \\U escapes. This generates a string similar to that returned by repr() in Python 2.any($module, iterable, /) -- Return True if bool(x) is True for any x in the iterable. If the iterable is empty, return False.all($module, iterable, /) -- Return True if bool(x) is True for all values x in the iterable. If the iterable is empty, return True.abs($module, x, /) -- Return the absolute value of the argument.__import__(name, globals=None, locals=None, fromlist=(), level=0) -> module Import a module. Because this function is meant for use by the Python interpreter and not for general use, it is better to use importlib.import_module() to programmatically import a module. The globals argument is only used to determine the context; they are not modified. The locals argument is unused. The fromlist should be a list of names to emulate ``from name import ...'', or an empty list to emulate ``import name''. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. The level argument is used to determine whether to perform absolute or relative imports: 0 is absolute, while a positive number is the number of parent directories to search relative to the current module.__build_class__(func, name, *bases, metaclass=None, **kwds) -> class Internal helper function used by the class statement.Built-in functions, exceptions, and other objects. Noteworthy: None is the `nil' object; Ellipsis represents `...' in slices.~)_j )@):)P )~p),) )~)G#!(;i`(~b!@ (i(q%!(i0(bi (]i(p(w0(P(ip(~0@(p`(P!(B(6j`(Aj (  (i!(J(+(!`(J! (E`(~(O! (Eh!p(M}(`(W}`(iP(b}0(2j`(H+P(#~K ))qQ>.JRKj&!/~!1E٪K>_jHKIAI J~LJߧߧ=j!NE{EEjP!EKHk!@UX%(!`(*--p:ϮP$03x--@5 - -P;loads(bytes) Convert the bytes-like object to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra bytes in the input are ignored.dumps(value[, version]) Return the bytes object that would be written to a file by dump(value, file). The value must be a supported type. Raise a ValueError exception if value has (or contains an object that has) an unsupported type. The version argument indicates the data format that dumps should use.load(file) Read one value from the open file and return it. If no valid value is read (e.g. because the data has a different Python version's incompatible marshal format), raise EOFError, ValueError or TypeError. The file must be a readable binary file. Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type.dump(value, file[, version]) Write the value on the open file. The value must be a supported type. The file must be a writeable binary file. If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised - but garbage data will also be written to the file. The object will not be properly read back by load() The version argument indicates the data format that dump should use.This module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues. Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, floating point numbers, strings, bytes, bytearrays, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops). Variables: version -- indicates the format that the module uses. Version 0 is the historical format, version 1 shares interned strings and version 2 uses a binary format for floating point numbers. Version 3 shares common object references (New in version 3.4). Functions: dump() -- write value to a file load() -- read value from a file dumps() -- marshal value as a bytes object loads() -- read value from a bytes-like object_fix_co_filename($module, code, path, /) -- Changes code.co_filename to specify the passed-in file path. code Code object to change. path File path to use.exec_builtin($module, mod, /) -- Initialize a built-in module.exec_dynamic($module, mod, /) -- Initialize an extension module.create_dynamic($module, spec, file=None, /) -- Create an extension module.is_frozen($module, name, /) -- Returns True if the module name corresponds to a frozen module.is_builtin($module, name, /) -- Returns True if the module name corresponds to a built-in module.init_frozen($module, name, /) -- Initializes a frozen module.create_builtin($module, spec, /) -- Create an extension module.is_frozen_package($module, name, /) -- Returns True if the module name is of a frozen package.get_frozen_object($module, name, /) -- Create a code object for a frozen module.release_lock($module, /) -- Release the interpreter's import lock. On platforms without threads, this function does nothing.acquire_lock($module, /) -- Acquires the interpreter's import lock for the current thread. This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.lock_held($module, /) -- Return True if the import lock is currently held, else False. On platforms without threads, return False.extension_suffixes($module, /) -- Returns the list of file suffixes used to identify extension modules.(Extremely) low-level import machinery bits as used by importlib and imp.@sdZeddS)Tz Hello world!N) initializedprintrr./Tools/freeze/flag.pys ) =`) )Rp>`)$)$)˿@#)ؿ@")Z@ ")!)@`!)wC !)׻ )˻@ )f))`@)@)!) &))!E!(! %)&)`lHg-n! %:?M rapfBee"!    l   "  3 l "3 l3 l3  R 3 32 S"! l!yf|}~fy{lwyzxwvur#t#tpscpapqonVmlV kji   hc i hig  c fBecdbca_][\]^_` Z Y XR WU UV VT! TPRS PRS MQPNOML2 KJIDEFGHCBA456789:;<=>?@3 32/2 01/'()*+,-.%&% $"   $    $ " $ ! " $$  $!" "        "  ! "   !"       ,),),) ,),),)(,)$,)<,)8,)0,),,)`,)\,)X,)T,)P,)H,)@,)p,)h,),),)|,)x,),),),),),),),),),),),)`-)P-)D-)8-)0-),-) -)-)-),),),),),)-)x-)p-)-)-)-)-)-)-)-)-)-)-)-)-)-)-).).) .).).).)-)P.)@.)<.)0.)(.) .).).)x.)p.)h.)`.)\.)X.).).).).).).).)/).).)(/)/)?!"@A/BC6DFE L^QGHIu OPRSS!U t)t   t)  s)  r)   r)  q)   q)  o)  @o)  @l)  k),  h)  @h), b g)C  @g)Z & f)Z 1 e)q ; e) E d)q X  d) b c) k @c) u b)  b)   b)  a))  @a)@  ``)W  `)n  _)  @^)  ]),  ]), ! \), "  \), # [), $( @[) %4 Z) &B Y) 'N Y) (\ Y) )g W) *o V)& +z T)= , R)T - Q)k . @Q) / `P) 0 O) 1 N) 2  N) 3 @M) 4 `L) 5 L) 6 K) 7  K) 8J) 9  J) :N I) ; @I) < H) = H) >  H) ? G) @! `G) A& F) B- @F)# C3 E)# D= @D): EB `C)q FP @B)Q GX A)h Hf @)h Ip `@) Jx ?) K `?) L  =) M ;) N `;) O :) P `:) Q @9) R 8) S @8), T 7)@ U @7) `!jKk!E!ECjP{EKHE  7i' iKd!E! 2W!JX V)u)Kjk!i @get_asyncgen_hooks() Return a namedtuple of installed asynchronous generators hooks (firstiter, finalizer).set_asyncgen_hooks(*, firstiter=None, finalizer=None) Set a finalizer for async generators objects.get_coroutine_wrapper() Return the wrapper for coroutine objects set by sys.set_coroutine_wrapper.set_coroutine_wrapper(wrapper) Set a wrapper for coroutine objects._debugmallocstats() Print summary info to stderr about the state of pymalloc's structures. In Py_DEBUG mode, also perform some expensive internal consistency checks. call_tracing(func, args) -> object Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code.gettrace() Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual.settrace(function) Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual.setrecursionlimit(n) Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.getprofile() Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual.setprofile(function) Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual.setdlopenflags(n) -> None Set the flags used by the interpreter for dlopen calls, such as when the interpreter loads extension modules. Among other things, this will enable a lazy resolving of symbols when importing a module, if called as sys.setdlopenflags(0). To share symbols across extension modules, call as sys.setdlopenflags(os.RTLD_GLOBAL). Symbolic names for the flag modules can be found in the os module (RTLD_xxx constants, e.g. os.RTLD_LAZY).getswitchinterval() -> current thread switch interval; see setswitchinterval().setswitchinterval(n) Set the ideal thread switching delay inside the Python interpreter The actual frequency of switching threads can be lower if the interpreter executes long sequences of uninterruptible code (this is implementation-specific and workload-dependent). The parameter must represent the desired switching delay in seconds A typical value is 0.005 (5 milliseconds).getcheckinterval() -> current check interval; see setcheckinterval().setcheckinterval(n) Tell the Python interpreter to check for asynchronous events every n instructions. This also affects how often thread switches occur.is_finalizing() Return True if Python is exiting.intern(string) -> string ``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value._getframe([depth]) -> frameobject Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack. This function should be used for internal and specialized purposes only.getsizeof(object, default) -> int Return the size of object in bytes.getrecursionlimit() Return the current value of the recursion limit, the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.getrefcount(object) -> integer Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().getfilesystemencodeerrors() -> string Return the error mode used to convert Unicode filenames in operating system filenames.getfilesystemencoding() -> string Return the encoding used to convert Unicode filenames in operating system filenames.getallocatedblocks() -> integer Return the number of memory blocks currently allocated, regardless of their size.getdlopenflags() -> int Return the current value of the flags that are used for dlopen calls. The flag constants are defined in the os module.getdefaultencoding() -> string Return the current default string encoding used by the Unicode implementation.exit([status]) Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is an integer, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).excepthook(exctype, value, traceback) -> None Handle an exception by displaying it with a traceback on sys.stderr. exc_info() -> (type, value, traceback) Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame.displayhook(object) -> None Print an object to sys.stdout and also save it in builtins._ _current_frames() -> dictionary Return a dictionary mapping each current thread T's thread id to T's current stack frame. This function should be used for specialized purposes only._clear_type_cache() -> None Clear the internal type lookup cache.callstats() -> tuple of integers Return a tuple of function call statistics, if CALL_PROFILE was defined when Python was built. Otherwise, return None. When enabled, this function returns detailed, implementation-specific details about the number of function calls executed. The return value is a 11-tuple where the entries in the tuple are counts of: 0. all function calls 1. calls to PyFunction_Type objects 2. PyFunction calls that do not create an argument tuple 3. PyFunction calls that do not create an argument tuple and bypass PyEval_EvalCodeEx() 4. PyMethod calls 5. PyMethod calls on bound methods 6. PyType calls 7. PyCFunction calls 8. generator calls 9. All other calls 10. Number of stack pops performed by call_function()asyncgen_hooks A struct sequence providing information about asynhronous generators hooks. The attributes are read only.sys.flags Flags provided through command line arguments or environment vars.sys.version_info Version information as a named tuple.hash_info A struct sequence providing parameters used for computing hashes. The attributes are read only.This module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter. Dynamic objects: argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these. stdin -- standard input file object; used by input() stdout -- standard output file object; used by print() stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O. last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are only available in an interactive session after a traceback has been printed. Static objects: builtin_module_names -- tuple of module names built into this interpreter copyright -- copyright notice pertaining to this interpreter exec_prefix -- prefix used to find the machine-specific Python library executable -- absolute path of the executable binary of the Python interpreter float_info -- a struct sequence with information about the float implementation. float_repr_style -- string indicating the style of repr() output for floats hash_info -- a struct sequence with information about the hash algorithm. hexversion -- version information encoded as a single integer implementation -- Python implementation information. int_info -- a struct sequence with information about the int implementation. maxsize -- the largest supported length of containers. maxunicode -- the value of the largest Unicode code point platform -- platform identifier prefix -- prefix used to find the Python library thread_info -- a struct sequence with information about the thread implementation. version -- the version of this interpreter as a string version_info -- version information as a named tuple __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch! Functions: displayhook() -- print an object to the screen, and save it in builtins._ excepthook() -- print an exception and its traceback to sys.stderr exc_info() -- return thread-safe information about the current exception exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setcheckinterval() -- control how often the interpreter checks for events setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function df 0 p X Vz } j  E! E!. C I ^ x k r X 9K ( k!!J!;!`))R!)) \!@))m!)@) )@)!OGf p E!z7j} K `) Z) 0Y@)@I)!( ) L)>(!pM`) !M)!@),!Y)?!0@)U!)o!){!) @X) O)L N)! )i N)! ) R )!pS)| O)!pQ@)!) S)!R )!) @Y)!Y)!T)! U)$!PU)7!V)sys.thread_info A struct sequence holding information about the thread implementation.J!U!!P!!W!) )/!#W!d!2W!_set_sentinel() -> lock Set a sentinel lock that will be released when the current thread state is finalized (after it is untied from the interpreter). This is a private API for the threading module.stack_size([size]) -> size Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself. Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32kB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4kB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information)._count() -> integer Return the number of currently running Python threads, excluding the main thread. The returned number comprises all threads created through `start_new_thread()` as well as `threading.Thread`, and not yet finished. This function is meant for internal and specialized purposes only. In most applications `threading.enumerate()` should be used instead.get_ident() -> integer Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.interrupt_main() Raise a KeyboardInterrupt in the main thread. A subthread can use this function to interrupt the main thread.exit() (exit_thread() is an obsolete synonym) This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.allocate_lock() -> lock object (allocate() is an obsolete synonym) Create a new lock object. See help(type(threading.Lock())) for information about locks.start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym) Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. _release_save() -> tuple For internal use by `threading.Condition`._acquire_restore(state) -> None For internal use by `threading.Condition`._is_owned() -> bool For internal use by `threading.Condition`.release() Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, and must be locked by the same thread that unlocks it; otherwise a `RuntimeError` is raised. Do note that if the lock was acquire()d several times in a row by the current thread, release() needs to be called as many times for the lock to be available for other threads.acquire(blocking=True) -> bool Lock the lock. `blocking` indicates whether we should wait for the lock to be available or not. If `blocking` is False and another thread holds the lock, the method will return False immediately. If `blocking` is True and another thread holds the lock, the method will wait for the lock to be released, take it and then return True. (note: the blocking operation is interruptible.) In all other cases, the method will return True immediately. Precisely, if the current thread already holds the lock, its internal counter is simply incremented. If nobody holds the lock, the lock is taken and its internal counter initialized to 1.This module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.locked() -> bool (locked_lock() is an obsolete synonym) Return whether the lock is in the locked state.release() (release_lock() is an obsolete synonym) Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.acquire(blocking=True, timeout=-1) -> bool (acquire_lock() is an obsolete synonym) Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return True once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is interruptible.get_referents(*objs) -> list Return the list of objects that are directly referred to by objs.get_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.is_tracked(obj) -> bool Returns true if the object is tracked by the garbage collector. Simple atomic objects will return false. get_stats() -> [...] Return a list of dictionaries containing per-generation statistics. get_objects() -> [...] Return a list of objects tracked by the collector (excluding the list returned). collect([generation]) -> n With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid. The number of unreachable objects is returned. get_threshold() -> (threshold0, threshold1, threshold2) Return the current collection thresholds set_threshold(threshold0, [threshold1, threshold2]) -> None Sets the collection thresholds. Setting threshold0 to zero disables collection. get_count() -> (count0, count1, count2) Return the current collection counts get_debug() -> flags Get the garbage collection debugging flags. set_debug(flags) -> None Set the garbage collection debugging flags. Debugging information is written to sys.stderr. flags is an integer and can have the following bits turned on: DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). isenabled() -> status Returns true if automatic garbage collection is enabled. disable() -> None Disable automatic garbage collection. enable() -> None Enable automatic garbage collection. This module provides access to the garbage collector for reference cycles. enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. get_stats() -- Return list of dictionaries containing per-generation stats. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. is_tracked() -- Returns true if a given object is tracked. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. A lock object is a synchronization primitive. To create a lock, call threading.Lock(). Methods are: acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue.AIWKIt#W!@tJX?!?!n%! ?!%!в8@!&!jp@!\%!@!&!@!&!W A!$#! `)'! `)'!|) E!|)'!`)>(!`)+'!):'!Ѕ)'! )#!)D'!  )"!x )P!y`)R'!z )"!@z)\'!r`)AIx )KIy`)˿`w)"!`w)ؿPr)P!Pr)j'!j`)}j`)AI`w)KIPr)!T)v'!T@)~'!j)!!l)'!i)'!Pi )!!Pl)'! i)'!@k)'!pZ`)'!i)'!U`)'!X)'!Y)'!%'!У%(!%/(!%;(! %C(!@%S(!p%a(!%o(!%y(!%(!%(! %(!`%(!%(!%(!%(!%(! %)!@%)!`%")!%/)!%8)!%B)!%L)!%[)!%e)! %n)!@%)!p%)!%&!)!@`Vpx ))%!)!_)!/)!0)!`)!1*!2*!4*!3**!a3*!.@*!R*!]*!s*!~*! *!W*!V*!$*!%*!&*!'*!-+!e+!f+!g'+!4+!?+!(S+!e+!)x+!*+!+!E+!F+!h+!i+!<+!+!++!G,!j,!$,!l2,!=,!N,!c,!v,!,!,!,!w,!x,!y,!z,!{,!|,!S-!T-!m"-!.-!:-!G-!XS-!Ua-!5h-!8x-!>-!=-!9-!@-!?-!A-!7-!6-!:-! .! '.! ;.!,I.!V.!c.!op.!p}.!;.!.! .!!.!.!q.!r.!".!n/!/!&/!C1/!MJ/!N@A!Ic/!Jv/!O/!P/!Q/!R/!D/!K0!L0! (0!#50!HE0!S0!B`0!sm0!ty0!<0!u0!v0!0!k0!}0!~0!0! 1!\1!]*1!:1!L1!f1!^s1![1!Y1!Z1!b1!c1!d1!1!1!2! 2!.2!A2!O2!^2!j2!{2!2!L2!M2!N2!O2!P 3!Q*3!R`A!SD3!T^3!Uy3!V3!W3!X3!Y3!ZA![4! 4!!4! 14!=4!J4!W4!c4!o4!{4!4! 4! 4! 4!4!4!4!4! 5!5!j5}!!&!+5!&!!))k!G5!@DV5!U(}h5!~5! t5!))!!)!`@ )`95!0s0x(){5!(psw)getpwall($module, /) -- Return a list of all available password database entries, in arbitrary order. See help(pwd) for more on password database entries.getpwnam($module, arg, /) -- Return the password database entry for the given user name. See `help(pwd)` for more on password database entries.getpwuid($module, uidobj, /) -- Return the password database entry for the given numeric user ID. See `help(pwd)` for more on password database entries.pwd.struct_passwd: Results from getpw*() routines. This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.This module provides access to the Unix password database. It is available on all Unix versions. Password database entries are reported as 7-tuples containing the following items from the password database (see `'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.This module makes available standard errno system symbols. The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2. The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'. Symbols that are not relevant to the underlying system are not defined. To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.getrandom($module, /, size, flags=0) -- Obtain a series of random bytes.fspath($module, /, path) -- Return the file system path representation of the object. If the object is str or bytes, then allow it to pass through as-is. If the object defines __fspath__(), then return the result of that method. All other types raise a TypeError.scandir(path='.') -> iterator of DirEntry objects for given pathset_blocking(fd, blocking) Set the blocking mode of the specified file descriptor. Set the O_NONBLOCK flag if blocking is False, clear the O_NONBLOCK flag otherwise.get_blocking(fd) -> bool Get the blocking mode of the file descriptor: False if the O_NONBLOCK flag is set, True if the flag is cleared.set_inheritable($module, fd, inheritable, /) -- Set the inheritable flag of the specified file descriptor.get_inheritable($module, fd, /) -- Get the close-on-exe flag of the specified file descriptor.cpu_count($module, /) -- Return the number of CPUs in the system; return None if indeterminable. This number is not equivalent to the number of CPUs the current process can use. The number of usable CPUs can be obtained with ``len(os.sched_getaffinity(0))``Return the size of the terminal window as (columns, lines). The optional argument fd (default standard output) specifies which file descriptor should be queried. If the file descriptor is not connected to a terminal, an OSError is thrown. This function will only be defined if an implementation is available for this system. shutil.get_terminal_size is the high-level function which should normally be used, os.get_terminal_size is the low-level implementation.listxattr($module, /, path=None, *, follow_symlinks=True) -- Return a list of extended attributes on path. path may be either None, a string, a path-like object, or an open file descriptor. if path is None, listxattr will examine the current directory. If follow_symlinks is False, and the last element of the path is a symbolic link, listxattr will examine the symbolic link itself instead of the file the link points to.removexattr($module, /, path, attribute, *, follow_symlinks=True) -- Remove extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, removexattr will modify the symbolic link itself instead of the file the link points to.setxattr($module, /, path, attribute, value, flags=0, *, follow_symlinks=True) -- Set extended attribute attribute on path to value. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, setxattr will modify the symbolic link itself instead of the file the link points to.getxattr($module, /, path, attribute, *, follow_symlinks=True) -- Return the value of extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, getxattr will examine the symbolic link itself instead of the file the link points to.getresgid($module, /) -- Return a tuple of the current process's real, effective, and saved group ids.getresuid($module, /) -- Return a tuple of the current process's real, effective, and saved user ids.setresgid($module, rgid, egid, sgid, /) -- Set the current process's real, effective, and saved group ids.setresuid($module, ruid, euid, suid, /) -- Set the current process's real, effective, and saved user ids.urandom($module, size, /) -- Return a bytes object containing random bytes suitable for cryptographic use.getloadavg($module, /) -- Return average recent system load information. Return the number of processes in the system run queue averaged over the last 1, 5, and 15 minutes as a tuple of three floats. Raises OSError if the load average was unobtainable.abort($module, /) -- Abort the interpreter immediately. This function 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system. This function never returns.pathconf($module, /, path, name) -- Return the configuration limit name for the file or directory path. If there is no limit, return -1. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fpathconf($module, fd, name, /) -- Return the configuration limit name for the file descriptor fd. If there is no limit, return -1.sysconf($module, name, /) -- Return an integer-valued system configuration variable.confstr($module, name, /) -- Return a string-valued system configuration variable.statvfs($module, /, path) -- Perform a statvfs system call on the given path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fstatvfs($module, fd, /) -- Perform an fstatvfs system call on the given fd. Equivalent to statvfs(fd).WSTOPSIG($module, /, status) -- Return the signal that stopped the process that provided the status value.WTERMSIG($module, /, status) -- Return the signal that terminated the process that provided the status value.WEXITSTATUS($module, /, status) -- Return the process return code from status.WIFEXITED($module, /, status) -- Return True if the process returning status exited via the exit() system call.WIFSIGNALED($module, /, status) -- Return True if the process returning status was terminated by a signal.WIFSTOPPED($module, /, status) -- Return True if the process returning status was stopped.WIFCONTINUED($module, /, status) -- Return True if a particular process was continued from a job control stop. Return True if the process returning status was continued from a job control stop.WCOREDUMP($module, status, /) -- Return True if the process returning status was dumped to a core file.fdatasync($module, /, fd) -- Force write of fd to disk without forcing update of metadata.sync($module, /) -- Force write of everything to disk.fsync($module, /, fd) -- Force write of fd to disk.fchdir($module, /, fd) -- Change to the directory of the given file descriptor. fd must be opened on a directory, not a file. Equivalent to os.chdir(fd).strerror($module, code, /) -- Translate an error code to a message string.unsetenv($module, name, /) -- Delete an environment variable.putenv($module, name, value, /) -- Change or add an environment variable.posix_fadvise($module, fd, offset, length, advice, /) -- Announce an intention to access data in a specific pattern. Announce an intention to access data in a specific pattern, thus allowing the kernel to make optimizations. The advice applies to the region of the file specified by fd starting at offset and continuing for length bytes. advice is one of POSIX_FADV_NORMAL, POSIX_FADV_SEQUENTIAL, POSIX_FADV_RANDOM, POSIX_FADV_NOREUSE, POSIX_FADV_WILLNEED, or POSIX_FADV_DONTNEED.posix_fallocate($module, fd, offset, length, /) -- Ensure a file has allocated at least a particular number of bytes on disk. Ensure that the file specified by fd encompasses a range of bytes starting at offset bytes from the beginning and continuing for length bytes.truncate($module, /, path, length) -- Truncate a file, specified by path, to a specific length. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ftruncate($module, fd, length, /) -- Truncate a file, specified by file descriptor, to a specific length.makedev($module, major, minor, /) -- Composes a raw device number from the major and minor device numbers.minor($module, device, /) -- Extracts a device minor number from a raw device number.major($module, device, /) -- Extracts a device major number from a raw device number.mknod($module, /, path, mode=384, device=0, *, dir_fd=None) -- Create a node in the file system. Create a node in the file system (file, device special file or named pipe) at path. mode specifies both the permissions to use and the type of node to be created, being combined (bitwise OR) with one of S_IFREG, S_IFCHR, S_IFBLK, and S_IFIFO. If S_IFCHR or S_IFBLK is set on mode, device defines the newly created device special file (probably using os.makedev()). Otherwise device is ignored. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.mkfifo($module, /, path, mode=438, *, dir_fd=None) -- Create a "fifo" (a POSIX named pipe). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.pipe2($module, flags, /) -- Create a pipe with flags set atomically. Returns a tuple of two file descriptors: (read_fd, write_fd) flags can be constructed by ORing together one or more of these values: O_NONBLOCK, O_CLOEXEC.pipe($module, /) -- Create a pipe. Returns a tuple of two file descriptors: (read_fd, write_fd)isatty($module, fd, /) -- Return True if the fd is connected to a terminal. Return True if the file descriptor is an open file descriptor connected to the slave end of a terminal.fstat($module, /, fd) -- Perform a stat system call on the given file descriptor. Like stat(), but for an open file descriptor. Equivalent to os.stat(fd).sendfile(out, in, offset, count) -> byteswritten sendfile(out, in, offset, count[, headers][, trailers], flags=0) -> byteswritten Copy count bytes from file descriptor in to file descriptor out.pwrite($module, fd, buffer, offset, /) -- Write bytes to a file descriptor starting at a particular offset. Write buffer to fd, starting at offset bytes from the beginning of the file. Returns the number of bytes writte. Does not change the current file offset.writev($module, fd, buffers, /) -- Iterate over buffers, and write the contents of each to a file descriptor. Returns the total number of bytes written. buffers must be a sequence of bytes-like objects.write($module, fd, data, /) -- Write a bytes object to a file descriptor.pread($module, fd, length, offset, /) -- Read a number of bytes from a file descriptor starting at a particular offset. Read length bytes from file descriptor fd, starting at offset bytes from the beginning of the file. The file offset remains unchanged.readv($module, fd, buffers, /) -- Read from a file descriptor fd into an iterable of buffers. The buffers should be mutable buffers accepting bytes. readv will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data. readv returns the total number of bytes read, which may be less than the total capacity of all the buffers.read($module, fd, length, /) -- Read from a file descriptor. Returns a bytes object.lseek($module, fd, position, how, /) -- Set the position of a file descriptor. Return the new position. Return the new cursor position in number of bytes relative to the beginning of the file.lockf($module, fd, command, length, /) -- Apply, test or remove a POSIX lock on an open file descriptor. fd An open file descriptor. command One of F_LOCK, F_TLOCK, F_ULOCK or F_TEST. length The number of bytes to lock, starting at the current position.dup2($module, /, fd, fd2, inheritable=True) -- Duplicate file descriptor.dup($module, fd, /) -- Return a duplicate of a file descriptor.device_encoding($module, /, fd) -- Return a string describing the encoding of a terminal's file descriptor. The file descriptor must be attached to a terminal. If the device is not a terminal, return None.closerange($module, fd_low, fd_high, /) -- Closes all file descriptors in [fd_low, fd_high), ignoring errors.close($module, /, fd) -- Close a file descriptor.open($module, /, path, flags, mode=511, *, dir_fd=None) -- Open a file for low level IO. Returns a file descriptor (integer). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.tcsetpgrp($module, fd, pgid, /) -- Set the process group associated with the terminal specified by fd.tcgetpgrp($module, fd, /) -- Return the process group associated with the terminal specified by fd.setpgid($module, pid, pgrp, /) -- Call the system call setpgid(pid, pgrp).setsid($module, /) -- Call the system call setsid().getsid($module, pid, /) -- Call the system call getsid(pid) and return the result.waitpid($module, pid, options, /) -- Wait for completion of a given child process. Returns a tuple of information regarding the child process: (pid, status) The options argument is ignored on Windows.waitid($module, idtype, id, options, /) -- Returns the result of waiting for a process or processes. idtype Must be one of be P_PID, P_PGID or P_ALL. id The id to wait on. options Constructed from the ORing of one or more of WEXITED, WSTOPPED or WCONTINUED and additionally may be ORed with WNOHANG or WNOWAIT. Returns either waitid_result or None if WNOHANG is specified and there are no children in a waitable state.wait4($module, /, pid, options) -- Wait for completion of a specific child process. Returns a tuple of information about the child process: (pid, status, rusage)wait3($module, /, options) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status, rusage)wait($module, /) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status)setpgrp($module, /) -- Make the current process the leader of its process group.getpgid($module, /, pid) -- Call the system call getpgid(), and return the result.initgroups(username, gid) -> None Call the system initgroups() to initialize the group access list with all of the groups of which the specified username is a member, plus the specified group id.setgroups($module, groups, /) -- Set the groups of the current process to list.setregid($module, rgid, egid, /) -- Set the current process's real and effective group ids.setegid($module, egid, /) -- Set the current process's effective group id.setgid($module, gid, /) -- Set the current process's group id.setreuid($module, ruid, euid, /) -- Set the current process's real and effective user ids.seteuid($module, euid, /) -- Set the current process's effective user id.setuid($module, uid, /) -- Set the current process's user id.killpg($module, pgid, signal, /) -- Kill a process group with a signal.kill($module, pid, signal, /) -- Kill a process with a signal.getlogin($module, /) -- Return the actual login name.getuid($module, /) -- Return the current process's user id.getppid($module, /) -- Return the parent's process id. If the parent process has already exited, Windows machines will still return its id; others systems will return the id of the 'init' process (1).getpgrp($module, /) -- Return the current process group id.getpid($module, /) -- Return the current process id.getgroups($module, /) -- Return list of supplemental group IDs for the process.getgrouplist(user, group) -> list of groups to which a user belongs Returns a list of groups to which a user belongs. user: username to lookup group: base group id of the usergetgid($module, /) -- Return the current process's group id.geteuid($module, /) -- Return the current process's effective user id.getegid($module, /) -- Return the current process's effective group id.forkpty($module, /) -- Fork a new process with a new pseudo-terminal as controlling tty. Returns a tuple of (pid, master_fd). Like fork(), return pid of 0 to the child process, and pid of child to the parent process. To both, return fd of newly opened pseudo-terminal.openpty($module, /) -- Open a pseudo-terminal. Return a tuple of (master_fd, slave_fd) containing open file descriptors for both the master and slave ends.sched_getaffinity($module, pid, /) -- Return the affinity of the process identified by pid (or the current process if zero). The affinity is returned as a set of CPU identifiers.sched_setaffinity($module, pid, mask, /) -- Set the CPU affinity of the process identified by pid to mask. mask should be an iterable of integers identifying CPUs.sched_yield($module, /) -- Voluntarily relinquish the CPU.sched_setscheduler($module, pid, policy, param, /) -- Set the scheduling policy for the process identified by pid. If pid is 0, the calling process is changed. param is an instance of sched_param.sched_setparam($module, pid, param, /) -- Set scheduling parameters for the process identified by pid. If pid is 0, sets parameters for the calling process. param should be an instance of sched_param.sched_rr_get_interval($module, pid, /) -- Return the round-robin quantum for the process identified by pid, in seconds. Value returned is a float.sched_getscheduler($module, pid, /) -- Get the scheduling policy for the process identifiedy by pid. Passing 0 for pid returns the scheduling policy for the calling process.sched_getparam($module, pid, /) -- Returns scheduling parameters for the process identified by pid. If pid is 0, returns parameters for the calling process. Return value is an instance of sched_param.sched_get_priority_min($module, /, policy) -- Get the minimum scheduling priority for policy.sched_get_priority_max($module, /, policy) -- Get the maximum scheduling priority for policy.fork($module, /) -- Fork a child process. Return 0 to child process and PID of child to parent process.execve($module, /, path, argv, env) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings.execv($module, path, argv, /) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings._exit($module, /, status) -- Exit to the system with specified status, without normal exit processing.times($module, /) -- Return a collection containing process timing information. The object returned behaves like a named tuple with these fields: (utime, stime, cutime, cstime, elapsed_time) All fields are floating point numbers.utime($module, /, path, times=None, *, ns=None, dir_fd=None, follow_symlinks=True) -- Set the access and modified time of path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If times is not None, it must be a tuple (atime, mtime); atime and mtime should be expressed as float seconds since the epoch. If ns is specified, it must be a tuple (atime_ns, mtime_ns); atime_ns and mtime_ns should be expressed as integer nanoseconds since the epoch. If times is None and ns is unspecified, utime uses the current time. Specifying tuples for both times and ns is an error. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, utime will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be available on your platform. If they are unavailable, using them will raise a NotImplementedError.remove($module, /, path, *, dir_fd=None) -- Remove a file (same as unlink()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.unlink($module, /, path, *, dir_fd=None) -- Remove a file (same as remove()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.uname($module, /) -- Return an object identifying the current operating system. The object behaves like a named tuple with the following fields: (sysname, nodename, release, version, machine)umask($module, mask, /) -- Set the current numeric umask and return the previous umask.system($module, /, command) -- Execute the command in a subshell.symlink($module, /, src, dst, target_is_directory=False, *, dir_fd=None) -- Create a symbolic link pointing to src named dst. target_is_directory is required on Windows if the target is to be interpreted as a directory. (On Windows, symlink requires Windows 6.0 or greater, and raises a NotImplementedError otherwise.) target_is_directory is ignored on non-Windows platforms. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.stat_float_times([newval]) -> oldval Determine whether os.[lf]stat represents time stamps as float objects. If value is True, future calls to stat() return floats; if it is False, future calls return ints. If value is omitted, return the current setting. rmdir($module, /, path, *, dir_fd=None) -- Remove a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.replace($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory, overwriting the destination. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError."rename($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.readlink(path, *, dir_fd=None) -> path Return a string representing the path to which the symbolic link points. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.setpriority($module, /, which, who, priority) -- Set program scheduling priority.getpriority($module, /, which, who) -- Return program scheduling priority.nice($module, increment, /) -- Add increment to the priority of process and return the new priority.mkdir($module, /, path, mode=511, *, dir_fd=None) -- Create a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError. The mode argument is ignored on Windows.lstat($module, /, path, *, dir_fd=None) -- Perform a stat system call on the given path, without following symbolic links. Like stat(), but do not follow symbolic links. Equivalent to stat(path, follow_symlinks=False).listdir($module, /, path=None) -- Return a list containing the names of the files in the directory. path can be specified as either str, bytes, or a path-like object. If path is bytes, the filenames returned will also be bytes; in all other circumstances the filenames returned will be str. If path is None, uses the path='.'. On some platforms, path may also be specified as an open file descriptor;\ the file descriptor must refer to a directory. If this functionality is unavailable, using it raises NotImplementedError. The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.link($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None, follow_symlinks=True) -- Create a hard link to a file. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. If follow_symlinks is False, and the last element of src is a symbolic link, link will create a link to the symbolic link itself instead of the file the link points to. src_dir_fd, dst_dir_fd, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.getcwdb($module, /) -- Return a bytes string representing the current working directory.getcwd($module, /) -- Return a unicode string representing the current working directory.ctermid($module, /) -- Return the name of the controlling terminal for this process.chroot($module, /, path) -- Change root directory to path.lchown($module, /, path, uid, gid) -- Change the owner and group id of path to the numeric uid and gid. This function will not follow symbolic links. Equivalent to os.chown(path, uid, gid, follow_symlinks=False).fchown($module, /, fd, uid, gid) -- Change the owner and group id of the file specified by file descriptor. Equivalent to os.chown(fd, uid, gid).chown($module, /, path, uid, gid, *, dir_fd=None, follow_symlinks=True) -- Change the owner and group id of path to the numeric uid and gid.\ path Path to be examined; can be string, bytes, a path-like object, or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, chown will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.fchmod($module, /, fd, mode) -- Change the access permissions of the file given by file descriptor fd. Equivalent to os.chmod(fd, mode).chmod($module, /, path, mode, *, dir_fd=None, follow_symlinks=True) -- Change the access permissions of a file. path Path to be modified. May always be specified as a str, bytes, or a path-like object. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. mode Operating-system mode bitfield. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, chmod will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.chdir($module, /, path) -- Change the current working directory to the specified path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ttyname($module, fd, /) -- Return the name of the terminal device connected to 'fd'. fd Integer file descriptor handle.access($module, /, path, mode, *, dir_fd=None, effective_ids=False, follow_symlinks=True) -- Use the real uid/gid to test for access to a path. path Path to be tested; can be string, bytes, or a path-like object. mode Operating-system mode bitfield. Can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. effective_ids If True, access will use the effective uid/gid instead of the real uid/gid. follow_symlinks If False, and the last element of the path is a symbolic link, access will examine the symbolic link itself instead of the file the link points to. dir_fd, effective_ids, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path.stat($module, /, path, *, dir_fd=None, follow_symlinks=True) -- Perform a stat system call on the given path. path Path to be examined; can be string, bytes, a path-like object or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be a relative string; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. It's an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor.uname_result: Result from os.uname(). This object may be accessed either as a tuple of (sysname, nodename, release, version, machine), or via the attributes sysname, nodename, release, version, and machine. See os.uname for more information.times_result: Result from os.times(). This object may be accessed either as a tuple of (user, system, children_user, children_system, elapsed), or via the attributes user, system, children_user, children_system, and elapsed. See os.times for more information.A tuple of (columns, lines) for holding terminal window sizesched_param(sched_priority) -- Current has only one field: sched_priority"); sched_priority A scheduling parameter.statvfs_result: Result from statvfs or fstatvfs. This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on. See os.statvfs for more information.stat_result: Result from stat, fstat, or lstat. This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on. Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only. See os.stat for more information.waitid_result: Result from waitid. This object may be accessed either as a tuple of (si_pid, si_uid, si_signo, si_status, si_code), or via the attributes si_pid, si_uid, and so on. See os.waitid for more information.This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls.O!O!O!O!O!P! P!P!P!"P!,P!3P!BP!KP!YP!T*O!d*bP!@@*kP!sP!P!B!P!P!P!P!P!P!P!P!r(!P!P!Q!Q!*Q!BQ!B!JQ! C!!PC!&!RQ!jQ!rQ!{Q!Q!Q!Q!Q!Q!Q!Q!Q!Q!Q!&!Q!Q!Q!Q! R!R!"R!)R!;R!CR!XR!C!tR!R!`R!R!R!R!|R!R!C!R!C!R!D!R!R!S!S!6S!>S!\S!cS!jS!sS!}S!\%!p*mR!p*%! *h)! *U)!*E)! `*)! * )!*(!*;)!`*S!*S!`*S!p@*(!*(!~*)!~*(!|*%!|*(!{*(!@{*8%!y*(!@w*(!u*(!`t*$!P`s*AW!p*r(!`p*%!Pp*S!W o*h(!m*Z(!`l*M(!@g*$!0@f*=(!e*$! e*4(!d**~ c*(! c*'!b*&!Pa*&! a*'&! `*$!_*$! ^*S!^*K&!]*&!]*S!`\*S!@[*S!Z*S!@Z*S!@Z*$!Y*S!W Y*S! X*D!0X*S!PW*S!`W*S!@W*&D!W*.D!V*D!`V*D! V*:D!U*D!@`U*D!U*HD!0T*S! @T*$!``S*\W!S*aD! R*)PR*TW!P`Q*LW!@P*6E!` N*dE!PN*D!M*T!``M*TD!M*D!PL*_D!PL*2W!`J*#W!0 J*D!I*_V!02H*E!!`H*W!H*D!F*BE!F*)!!E*E!0&D*E!p"B*E!)B*E!0$A*E!P(@*F%!0?*W!@?*E!`*@>*T!=*qE!<*W! @;*V!@8*E!-7*E!-7*E!0.7*mD!6*V!5*E!p `4*E!` `2*F!.2*F!01*FP1`1*^)!`0*2)!0*+t@0*%)!p/*E!*`/*V!@+.*V!+ .*V! ,-*V!, -*V!p,*V!@,*V!@+*)E!` @+*V! **D!)*YE!`)*LE!(*tV!'*T!J&*T!%* A@%*~D!P$*D!@$*%T!0#*/T!2@#*TV!4!*CV!7 *,V!0:*V!=*9T!*KT!*2F!PB*~E! *%!`*%!`*%!@* V!B *V!p<*mT! **R*`*{!*/Q!J!@**J!@*@*U!`**J!**J! ** J!@** J!**L*`*U!% V!%V!%$V! %8V!@%LV!%]V!%oV!%}V!Ш%V!%V!%V!%V!%V! %V!0%V!@%V!P%V!%W!%W!%W!%!W! %)W!@%7W!%IW!%RW!Ъ%ZW!%getlower($module, character, flags, /) -- getcodesize($module, /) -- compile($module, /, pattern, flags, code, groups, groupindex, indexgroup) -- __deepcopy__($self, /, memo) -- __copy__($self, /) -- expand($self, /, template) -- Return the string obtained by doing backslash substitution on the string template, as done by the sub() method.groupdict($self, /, default=None) -- Return a dictionary containing all the named subgroups of the match, keyed by the subgroup name. default Is used for groups that did not participate in the match.groups($self, /, default=None) -- Return a tuple containing all the subgroups of the match, from 1. default Is used for groups that did not participate in the match.span($self, group=0, /) -- For MatchObject m, return the 2-tuple (m.start(group), m.end(group)).end($self, group=0, /) -- Return index of the end of the substring matched by group.start($self, group=0, /) -- Return index of the start of the substring matched by group.group([group1, ...]) -> str or tuple. Return subgroup(s) of the match by indices or names. For 0 returns the entire match.The result of re.match() and re.search(). Match objects always have a boolean value of True.__deepcopy__($self, /, memo) -- __copy__($self, /) -- scanner($self, /, string, pos=0, endpos=sys.maxsize) -- finditer($self, /, string, pos=0, endpos=sys.maxsize) -- Return an iterator over all non-overlapping matches for the RE pattern in string. For each match, the iterator returns a match object.split($self, /, string=None, maxsplit=0, *, source=None) -- Split string by the occurrences of pattern.findall($self, /, string=None, pos=0, endpos=sys.maxsize, *, source=None) -- Return a list of all non-overlapping matches of pattern in string.subn($self, /, repl, string, count=0) -- Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.sub($self, /, repl, string, count=0) -- Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.search($self, /, string=None, pos=0, endpos=sys.maxsize, *, pattern=None) -- Scan through string looking for a match, and return a corresponding match object instance. Return None if no position in the string matches.fullmatch($self, /, string=None, pos=0, endpos=sys.maxsize, *, pattern=None) -- Matches against all of the stringmatch($self, /, string=None, pos=0, endpos=sys.maxsize, *, pattern=None) -- Matches zero or more characters at the beginning of the string.Compiled regular expression objectssearch($self, /) -- match($self, /) -- ~b!*a!Ч*`!*a!a!Pa!06)(a!0a!8`!@*!E*1E*`!*%!0@*Yb!p`*ob!*a!P*Ib!`*b!(`!a!0Wi8%!b!@*b!`*b!`*b!*b!*b!0@*b!0 *b!*b!*a! p*Ib!@@*a!b!*b!@%* b!%,b! %V*8b!X`0@*** **Gb!@%Vb!P%cb!`%mb!p%vb!%Gb!%b!%b!%b! %b!@%b!`%b!%b!%b!%b!@%b!``*Ц@`**`* c!@**Private method returning an estimate of len(list(it)).D.__sizeof__() -- size of D in memory, in bytesRotate the deque n steps to the right (default n=1). If n is negative, rotates left.D.reverse() -- reverse *IN PLACE*D.__reversed__() -- return a reverse iterator over the dequeD.remove(value) -- remove first occurrence of value.Return state information for pickling.Remove and return the leftmost element.Remove and return the rightmost element.D.insert(index, object) -- insert object before indexD.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.Extend the left side of the deque with elements from the iterableExtend the right side of the deque with elements from the iterableD.count(value) -> integer -- return number of occurrences of valueReturn a shallow copy of a deque.Remove all elements from the deque.Add an element to the left side of the deque.Add an element to the right side of the deque.deque([iterable[, maxlen]]) --> deque object A list-like sequence optimized for data accesses near its endpoints.length_hint(obj, default=0) -> int Return an estimate of the number of items in obj. This is useful for presizing containers when building from an iterable. If the object supports len(), the result will be exact. Otherwise, it may over- or under-estimate by an arbitrary amount. The result will be an integer >= 0.compare_digest(a, b) -> bool Return 'a == b'. This function uses an approach designed to prevent timing analysis, making it appropriate for cryptography. a and b must both be of the same type: either str (ASCII only), or any bytes-like object. Note: If a and b are of different lengths, or if an error occurs, a timing attack could theoretically reveal information about the types and lengths of a and b--but not their values. Operator interface. This module exports a set of functions implemented in C corresponding to the intrinsic operators of Python. For example, operator.add(x, y) is equivalent to the expression x+y. The function names are those used for special methods; variants without leading and trailing '__' are also provided for convenience.methodcaller(name, ...) --> methodcaller object Return a callable object that calls the given method on its operand. After f = methodcaller('name'), the call f(r) returns r.name(). After g = methodcaller('name', 'date', foo=1), the call g(r) returns r.name('date', foo=1).attrgetter(attr, ...) --> attrgetter object Return a callable object that fetches the given attribute(s) from its operand. After f = attrgetter('name'), the call f(r) returns r.name. After g = attrgetter('name', 'date'), the call g(r) returns (r.name, r.date). After h = attrgetter('name.first', 'name.last'), the call h(r) returns (r.name.first, r.name.last).Return state information for picklingitemgetter(item, ...) --> itemgetter object Return a callable object that fetches the given item(s) from its operand. After f = itemgetter(2), the call f(r) returns r[2]. After g = itemgetter(2, 5, 3), the call g(r) returns (r[2], r[5], r[3])Convert a cmp= function into a key= function.reduce(function, sequence[, initial]) -> value Apply a function of two arguments cumulatively to the items of a sequence, from left to right, so as to reduce the sequence to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the sequence in the calculation, and serves as a default when the sequence is empty.Tools that operate on functions.Create a cached callable that wraps another function. user_function: the function being cached maxsize: 0 for no caching None for unlimited cache size n for a bounded cache typed: False cache f(3) and f(3.0) as identical calls True cache f(3) and f(3.0) as distinct calls cache_info_type: namedtuple class with the fields: hits misses currsize maxsize partial(func, *args, **keywords) - new function with partial application of the given arguments and keywords. proxy(object[, callback]) -- create a proxy object that weakly references 'object'. 'callback', if given, is called with a reference to the proxy when 'object' is about to be finalized.getweakrefs(object) -- return a list of all weak reference objects that point to 'object'._remove_dead_weakref($module, dct, key, /) -- Atomically remove key from dict if it points to a dead weakref.getweakrefcount($module, object, /) -- Return the number of weak references to 'object'._forget_codec($module, encoding, /) -- Purge the named codec from the internal codec lookup cachelookup_error($module, name, /) -- lookup_error(errors) -> handler Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name.register_error($module, errors, handler, /) -- Register the specified error handler under the name errors. handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple.readbuffer_encode($module, data, errors=None, /) -- charmap_build($module, map, /) -- charmap_decode($module, data, errors=None, mapping=None, /) -- charmap_encode($module, str, errors=None, mapping=None, /) -- ascii_decode($module, data, errors=None, /) -- ascii_encode($module, str, errors=None, /) -- latin_1_decode($module, data, errors=None, /) -- latin_1_encode($module, str, errors=None, /) -- raw_unicode_escape_decode($module, data, errors=None, /) -- raw_unicode_escape_encode($module, str, errors=None, /) -- unicode_internal_decode($module, obj, errors=None, /) -- unicode_internal_encode($module, obj, errors=None, /) -- unicode_escape_decode($module, data, errors=None, /) -- unicode_escape_encode($module, str, errors=None, /) -- utf_32_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_32_be_decode($module, data, errors=None, final=False, /) -- utf_32_le_decode($module, data, errors=None, final=False, /) -- utf_32_decode($module, data, errors=None, final=False, /) -- utf_32_be_encode($module, str, errors=None, /) -- utf_32_le_encode($module, str, errors=None, /) -- utf_32_encode($module, str, errors=None, byteorder=0, /) -- utf_16_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_16_be_decode($module, data, errors=None, final=False, /) -- utf_16_le_decode($module, data, errors=None, final=False, /) -- utf_16_decode($module, data, errors=None, final=False, /) -- utf_16_be_encode($module, str, errors=None, /) -- utf_16_le_encode($module, str, errors=None, /) -- utf_16_encode($module, str, errors=None, byteorder=0, /) -- utf_7_decode($module, data, errors=None, final=False, /) -- utf_7_encode($module, str, errors=None, /) -- utf_8_decode($module, data, errors=None, final=False, /) -- utf_8_encode($module, str, errors=None, /) -- escape_decode($module, data, errors=None, /) -- escape_encode($module, data, errors=None, /) -- decode($module, /, obj, encoding='utf-8', errors='strict') -- Decodes obj using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.encode($module, /, obj, encoding='utf-8', errors='strict') -- Encodes obj using the codec registered for encoding. The default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.lookup($module, encoding, /) -- Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.register($module, search_function, /) -- Register a codec search function. Search functions are expected to take one argument, the encoding name in all lower case letters, and either return None, or a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object).rFG@*& Z*i!Gxp!@*Di!*k!.*a!*G*p *'J *Oi!`*B*v *`*Zi! *& *Z(!P*IH0`*.J+ *h!*OGPG*@,PJ`@0-bi!sp! h!Pp!h! q!h!`Xq!>f!Mhi!Bf!Nq!Bq!'g!si!b!Pti!5g!ti! *a!*d!=*a!`*d!> *d!?*e! @*c!/`*c!0*c!1*c!2@*%e!@*7e!pA*Le!B*c!3@*c!4*d!5*'d!6 *ae!B*=d! 7*d! <`*va!p *{e!@C*k!7*e!C`*Xd!8 *e!pD*ld!9*e!E`*d!`:*e!E*d!P;*e! F@*e!F`*a!*In* +l!c@* +*nl!R(D*(`)++nll!R l!l!l!Hf!hv!+[@+@v!8T@-K +l!8T@-@K +l!P+@+D*P,.H0++0l!(TД @`*+`+PFl! S@*`++Zl! TY@@*@++0l!8-@' (l! P.P] 'p'Pa@+l!8RW@UD`*&0@++@+(Osigtimedwait($module, sigset, timeout, /) -- Like sigwaitinfo(), but with a timeout. The timeout is specified in seconds, with floating point numbers allowed.sigwaitinfo($module, sigset, /) -- Wait synchronously until one of the signals in *sigset* is delivered. Returns a struct_siginfo containing information about the signal.sigwait($module, sigset, /) -- Wait for a signal. Suspend execution of the calling thread until the delivery of one of the signals specified in the signal set sigset. The function accepts the signal and returns the signal number.sigpending($module, /) -- Examine pending signals. Returns a set of signal numbers that are pending for delivery to the calling thread.pthread_sigmask($module, how, mask, /) -- Fetch and/or change the signal mask of the calling thread.pthread_kill($module, thread_id, signalnum, /) -- Send a signal to a thread.pause($module, /) -- Wait until a signal arrives.siginterrupt($module, signalnum, flag, /) -- Change system call restart behaviour. If flag is False, system calls will be restarted when interrupted by signal sig, else system calls will be interrupted.set_wakeup_fd(fd) -> fd Sets the fd to be written to (with the signal number) when a signal comes in. A library can use this to wakeup select or poll. The previous fd or -1 is returned. The fd must be non-blocking.getsignal($module, signalnum, /) -- Return the current action for the given signal. The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handlersignal($module, signalnum, handler, /) -- Set the action for the given signal. The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.getitimer($module, which, /) -- Returns current value of given itimer.setitimer($module, which, seconds, interval=0.0, /) -- Sets given itimer (one of ITIMER_REAL, ITIMER_VIRTUAL or ITIMER_PROF). The timer will fire after value seconds and after that every interval seconds. The itimer can be cleared by setting seconds to zero. Returns old values as a tuple: (delay, interval).alarm($module, seconds, /) -- Arrange for SIGALRM to arrive after the given number of seconds.default_int_handler(...) The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.struct_siginfo: Result from sigwaitinfo or sigtimedwait. This object may be accessed either as a tuple of (si_signo, si_code, si_errno, si_pid, si_uid, si_status, si_band), or via the attributes si_signo, si_code, and so on.This module provides mechanisms to use signal handlers in Python. Functions: alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame._ncallbacks() -> int Return the number of registered exit functions._run_exitfuncs() -> None Run all registered exit functions.unregister(func) -> None Unregister an exit function which was previously registered using atexit.register func - function to be unregistered_clear() -> None Clear the list of previously registered exit functions.register(func, *args, **kwargs) -> func Register a function to be executed upon normal program termination func - function to be called at exit args - optional arguments to pass to func kwargs - optional keyword arguments to pass to func func is returned to facilitate usage as a decorator.allow programmer to define multiple exit functions to be executedupon normal program termination. Two public functions, register and unregister, are defined. tee(iterable, n=2) --> tuple of n independent iterators.Private method returning an estimate of len(list(it)).Returns size in memory, in bytes.Functional tools for creating and using iterators. Infinite iterators: count(start=0, step=1) --> start, start+step, start+2*step, ... cycle(p) --> p0, p1, ... plast, p0, p1, ... repeat(elem [,n]) --> elem, elem, elem, ... endlessly or up to n times Iterators terminating on the shortest input sequence: accumulate(p[, func]) --> p0, p0+p1, p0+p1+p2 chain(p, q, ...) --> p0, p1, ... plast, q0, q1, ... chain.from_iterable([p, q, ...]) --> p0, p1, ... plast, q0, q1, ... compress(data, selectors) --> (d[0] if s[0]), (d[1] if s[1]), ... dropwhile(pred, seq) --> seq[n], seq[n+1], starting when pred fails groupby(iterable[, keyfunc]) --> sub-iterators grouped by value of keyfunc(v) filterfalse(pred, seq) --> elements of seq where pred(elem) is False islice(seq, [start,] stop [, step]) --> elements from seq[start:stop:step] starmap(fun, seq) --> fun(*seq[0]), fun(*seq[1]), ... tee(it, n=2) --> (it1, it2 , ... itn) splits one iterator into n takewhile(pred, seq) --> seq[0], seq[1], until pred fails zip_longest(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ... Combinatoric generators: product(p, q, ... [repeat=1]) --> cartesian product permutations(p[, r]) combinations(p, r) combinations_with_replacement(p, r) repeat(object [,times]) -> create an iterator which returns the object for the specified number of times. If not specified, returns the object endlessly.product(*iterables, repeat=1) --> product object Cartesian product of input iterables. Equivalent to nested for-loops. For example, product(A, B) returns the same as: ((x,y) for x in A for y in B). The leftmost iterators are in the outermost for-loop, so the output tuples cycle in a manner similar to an odometer (with the rightmost element changing on every iteration). To compute the product of an iterable with itself, specify the number of repetitions with the optional repeat keyword argument. For example, product(A, repeat=4) means the same as product(A, A, A, A). product('ab', range(3)) --> ('a',0) ('a',1) ('a',2) ('b',0) ('b',1) ('b',2) product((0,1), (0,1), (0,1)) --> (0,0,0) (0,0,1) (0,1,0) (0,1,1) (1,0,0) ...permutations(iterable[, r]) --> permutations object Return successive r-length permutations of elements in the iterable. permutations(range(3), 2) --> (0,1), (0,2), (1,0), (1,2), (2,0), (2,1)zip_longest(iter1 [,iter2 [...]], [fillvalue=None]) --> zip_longest object Return a zip_longest object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the longest iterable in the argument sequence is exhausted and then it raises StopIteration. When the shorter iterables are exhausted, the fillvalue is substituted in their place. The fillvalue defaults to None or can be specified by a keyword argument. count(start=0, step=1) --> count object Return a count object whose .__next__() method returns consecutive values. Equivalent to: def count(firstval=0, step=1): x = firstval while 1: yield x x += step compress(data, selectors) --> iterator over selected data Return data elements corresponding to true selector elements. Forms a shorter iterator from selected data elements using the selectors to choose the data elements.combinations_with_replacement(iterable, r) --> combinations_with_replacement object Return successive r-length combinations of elements in the iterable allowing individual elements to have successive repeats. combinations_with_replacement('ABC', 2) --> AA AB AC BB BC CCcombinations(iterable, r) --> combinations object Return successive r-length combinations of elements in the iterable. combinations(range(4), 3) --> (0,1,2), (0,1,3), (0,2,3), (1,2,3)accumulate(iterable[, func]) --> accumulate object Return series of accumulated sums (or other binary function results).filterfalse(function or None, sequence) --> filterfalse object Return those items of sequence for which function(item) is false. If function is None, return the items that are false.chain.from_iterable(iterable) --> chain object Alternate chain() constructor taking a single iterable argument that evaluates lazily.chain(*iterables) --> chain object Return a chain object whose .__next__() method returns elements from the first iterable until it is exhausted, then elements from the next iterable, until all of the iterables are exhausted.starmap(function, sequence) --> starmap object Return an iterator whose values are returned from the function evaluated with an argument tuple taken from the given sequence.islice(iterable, stop) --> islice object islice(iterable, start, stop[, step]) --> islice object Return an iterator whose next() method returns selected values from an iterable. If start is specified, will skip all preceding elements; otherwise, start defaults to zero. Step defaults to one. If specified as another value, step determines how many values are skipped between successive calls. Works like a slice() on a list but returns an iterator.takewhile(predicate, iterable) --> takewhile object Return successive entries from an iterable as long as the predicate evaluates to true for each entry.dropwhile(predicate, iterable) --> dropwhile object Drop items from the iterable while predicate(item) is true. Afterwards, return every element until the iterable is exhausted.cycle(iterable) --> cycle object Return elements from the iterable until it is exhausted. Then repeat the sequence indefinitely.Returns an independent iterator.Iterator wrapped to make it copyableData container common to multiple tee objects.Set state information for unpickling.groupby(iterable, key=None) -> make an iterator that returns consecutive keys and groups from the iterable. If the key function is not specified or is None, the element itself is used for grouping. Return state information for pickling.D.copy() -> a shallow copy of D.__missing__(key) # Called by __getitem__ for missing key; pseudo-code: if self.default_factory is None: raise KeyError((key,)) self[key] = value = self.default_factory() return value _count_elements(mapping, iterable) -> None Count elements in the iterable, updating the mappingdefaultdict(default_factory[, ...]) --> dict with default factory The default factory is called without arguments to produce a new value when a key is not present, in __getitem__ only. A defaultdict compares equal to a dict with the same items. All remaining arguments are treated the same as if they were passed to the dict constructor, including keyword arguments. High performance data structures. - deque: ordered collection accessible from endpoints only - defaultdict: dict subclass with a default value factory jS!{!}S!{!{!!\S!{!cS!@!sS!{!{!{!z!0/ 8+Vy!'7+y!-6+y!. 6+{!<4+^y!P(@3+y!0`2+y!*1+{!P<@1+l{! >0+y!)`0+{!`2/+|!+.+|!>.+v!@-+!&A+k!!@+!P#@+|!%?+)|!"`?+}!B+rF0 C+& \+& 0 \+FZ+OG `C+&  \+FZ+OG `C+& \+FZ+& \+& p\+&  \+FZ+OG@ `C+& p \+FZ+OG` `C+& \+FZ+& \+5|!@S+&  \+F Z+& \+& @ \+FZ+& \+FZ+& \+FZ+& @\+F0Z+a! Z+& \+F@Z+& \+& \+FZ+& `\+C|!0`!  \+G`@\+a!`@\+& *v!p@]+S|!8+`+9+`+@B+b+ ""#C+@c+!$!!EG!}!+x!x!x!Fa!>x@_+l+IMi|! DH+0c+@z|!0D I+0c+|!@DL+ P`d+ |!8 DL+`d+p|!(@pDN+@@e+|! DO+ e+p!8pDP+`e+|!8DQ+p@f+P|!(`DR+ppf+}! 0D S+p g+(}! DT+`g+8}! DU+@g+J}!8`D@V+  h+0[}!(D X+ h+o}!(PDX+`h+}!0DY+@i+}!( @`Z+ i+p}!p@Z+p j+}!8pD [+`j+}! 0@ j+@}!8TYD]+0--`k+k+0writable($self, /) -- Returns True if the IO object can be written.readable($self, /) -- Returns True if the IO object can be read.seekable($self, /) -- Returns True if the IO object can be seeked.write($self, s, /) -- Write string to file. Returns the number of characters written, which is always equal to the length of the string.seek($self, pos, whence=0, /) -- Change stream position. Seek to character offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos must be 0; 2 End of stream - pos must be 0. Returns the new absolute position.truncate($self, pos=None, /) -- Truncate size to pos. The pos argument defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new absolute position.tell($self, /) -- Tell the current file position.readline($self, size=None, /) -- Read until newline or EOF. Returns an empty string if EOF is hit immediately.read($self, size=None, /) -- Read at most size characters, returned as a string. If the argument is negative or omitted, read until EOF is reached. Return an empty string at EOF.getvalue($self, /) -- Retrieve the entire contents of the object.close($self, /) -- Close the IO object. Attempting any further operation after the object is closed will raise a ValueError. This method has no effect if the file is already closed.StringIO(initial_value='', newline='\n') -- Text I/O implementation using an in-memory buffer. The initial_value argument sets the value of object. The newline argument is like the one of TextIOWrapper's constructor.open($module, /, file, mode='r', buffering=-1, encoding=None, errors=None, newline=None, closefd=True, opener=None) -- Open file and return a stream. Raise IOError upon failure. file is either a text or byte string giving the name (and the path if the file isn't in the current working directory) of the file to be opened or an integer file descriptor of the file to be wrapped. (If a file descriptor is given, it is closed when the returned I/O object is closed, unless closefd is set to False.) mode is an optional string that specifies the mode in which the file is opened. It defaults to 'r' which means open for reading in text mode. Other common values are 'w' for writing (truncating the file if it already exists), 'x' for creating and writing to a new file, and 'a' for appending (which on some Unix systems, means that all writes append to the end of the file regardless of the current seek position). In text mode, if encoding is not specified the encoding used is platform dependent: locale.getpreferredencoding(False) is called to get the current locale encoding. (For reading and writing raw bytes use binary mode and leave encoding unspecified.) The available modes are: ========= =============================================================== Character Meaning --------- --------------------------------------------------------------- 'r' open for reading (default) 'w' open for writing, truncating the file first 'x' create a new file and open it for writing 'a' open for writing, appending to the end of the file if it exists 'b' binary mode 't' text mode (default) '+' open a disk file for updating (reading and writing) 'U' universal newline mode (deprecated) ========= =============================================================== The default mode is 'rt' (open for reading text). For binary random access, the mode 'w+b' opens and truncates the file to 0 bytes, while 'r+b' opens the file without truncation. The 'x' mode implies 'w' and raises an `FileExistsError` if the file already exists. Python distinguishes between files opened in binary and text modes, even when the underlying operating system doesn't. Files opened in binary mode (appending 'b' to the mode argument) return contents as bytes objects without any decoding. In text mode (the default, or when 't' is appended to the mode argument), the contents of the file are returned as strings, the bytes having been first decoded using a platform-dependent encoding or using the specified encoding if given. 'U' mode is deprecated and will raise an exception in future versions of Python. It has no effect in Python 3. Use newline to control universal newlines mode. buffering is an optional integer used to set the buffering policy. Pass 0 to switch buffering off (only allowed in binary mode), 1 to select line buffering (only usable in text mode), and an integer > 1 to indicate the size of a fixed-size chunk buffer. When no buffering argument is given, the default buffering policy works as follows: * Binary files are buffered in fixed-size chunks; the size of the buffer is chosen using a heuristic trying to determine the underlying device's "block size" and falling back on `io.DEFAULT_BUFFER_SIZE`. On many systems, the buffer will typically be 4096 or 8192 bytes long. * "Interactive" text files (files for which isatty() returns True) use line buffering. Other text files use the policy described above for binary files. encoding is the name of the encoding used to decode or encode the file. This should only be used in text mode. The default encoding is platform dependent, but any encoding supported by Python can be passed. See the codecs module for the list of supported encodings. errors is an optional string that specifies how encoding errors are to be handled---this argument should not be used in binary mode. Pass 'strict' to raise a ValueError exception if there is an encoding error (the default of None has the same effect), or pass 'ignore' to ignore errors. (Note that ignoring encoding errors can lead to data loss.) See the documentation for codecs.register or run 'help(codecs.Codec)' for a list of the permitted encoding error strings. newline controls how universal newlines works (it only applies to text mode). It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If closefd is False, the underlying file descriptor will be kept open when the file is closed. This does not work when a file name is given and must be True in that case. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling *opener* with (*file*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None). open() returns a file object whose type depends on the mode, and through which the standard file operations such as reading and writing are performed. When open() is used to open a file in a text mode ('w', 'r', 'wt', 'rt', etc.), it returns a TextIOWrapper. When used to open a file in a binary mode, the returned class varies: in read binary mode, it returns a BufferedReader; in write binary and append binary modes, it returns a BufferedWriter, and in read/write mode, it returns a BufferedRandom. It is also possible to use a string or bytearray as a file for both reading and writing. For strings StringIO can be used like a file opened in a text mode, and for bytes a BytesIO can be used like a file opened in a binary mode.The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module. At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an IOError if they do not support a given operation. Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files. BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes. Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text. Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments. data: DEFAULT_BUFFER_SIZE An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. bind_textdomain_codeset(domain, codeset) -> string Bind the C library's domain to codeset.bindtextdomain(domain, dir) -> string Bind the C library's domain to dir.textdomain(domain) -> string Set the C library's textdmain to domain, returning the new domain.dcgettext(domain, msg, category) -> string Return translation of msg in domain and category.dgettext(domain, msg) -> string Return translation of msg in domain.gettext(msg) -> string Return translation of msg.nl_langinfo(key) -> string Return the value for the locale information associated with key.strxfrm(string) -> string. Return a string that can be used as a key for locale-aware comparisons.string,string -> int. Compares two strings according to the locale.() -> dict. Returns numeric and monetary locale-specific parameters.(integer,string=None) -> string. Activates/queries locale processing.Support for POSIX locales.get_clock_info(name: str) -> dict Get information of the specified clock.perf_counter() -> float Performance counter for benchmarking.process_time() -> float Process time for profiling: sum of the kernel and user-space CPU time.monotonic() -> float Monotonic clock, cannot go backward.tzset() Initialize, or reinitialize, the local timezone to the value stored in os.environ['TZ']. The TZ environment variable should be specified in standard Unix timezone format as documented in the tzset man page (eg. 'US/Eastern', 'Europe/Amsterdam'). Unknown timezones will silently fall back to UTC. If the TZ environment variable is not set, the local timezone is set to the systems best guess of wallclock time. Changing the TZ environment variable without calling tzset *may* change the local timezone used by methods such as localtime, but this behaviour should not be relied on.strptime(string, format) -> struct_time Parse a string to a time tuple according to a format specification. See the library reference manual for formatting codes (same as strftime()). Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. strftime(format[, tuple]) -> string Convert a time tuple to a string according to a format specification. See the library reference manual for formatting codes. When the time tuple is not present, current time as returned by localtime() is used. Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. mktime(tuple) -> floating point number Convert a time tuple in local time to seconds since the Epoch. Note that mktime(gmtime(0)) will not generally return zero for most time zones; instead the returned value will either be equal to that of the timezone or altzone attributes on the time module.ctime(seconds) -> string Convert a time in seconds since the Epoch to a string in local time. This is equivalent to asctime(localtime(seconds)). When the time tuple is not present, current time as returned by localtime() is used.asctime([tuple]) -> string Convert a time tuple to a string, e.g. 'Sat Jun 06 16:26:11 1998'. When the time tuple is not present, current time as returned by localtime() is used.localtime([seconds]) -> (tm_year,tm_mon,tm_mday,tm_hour,tm_min, tm_sec,tm_wday,tm_yday,tm_isdst) Convert seconds since the Epoch to a time tuple expressing local time. When 'seconds' is not passed in, convert the current time instead.gmtime([seconds]) -> (tm_year, tm_mon, tm_mday, tm_hour, tm_min, tm_sec, tm_wday, tm_yday, tm_isdst) Convert seconds since the Epoch to a time tuple expressing UTC (a.k.a. GMT). When 'seconds' is not passed in, convert the current time instead. If the platform supports the tm_gmtoff and tm_zone, they are available as attributes only.sleep(seconds) Delay execution for a given number of seconds. The argument may be a floating point number for subsecond precision.clock_getres(clk_id) -> floating point number Return the resolution (precision) of the specified clock clk_id.clock_settime(clk_id, time) Set the time of the specified clock clk_id.clock_gettime(clk_id) -> floating point number Return the time of the specified clock clk_id.clock() -> floating point number Return the CPU time or real time since the start of the process or since the first call to clock(). This has as much precision as the system records.time() -> floating point number Return the current time in seconds since the Epoch. Fractions of a second may be present if the system clock provides them.This module provides various functions to manipulate time values. There are two standard representations of time. One is the number of seconds since the Epoch, in UTC (a.k.a. GMT). It may be an integer or a floating point number (to represent fractions of seconds). The Epoch is system-defined; on Unix, it is generally January 1st, 1970. The actual value can be retrieved by calling gmtime(0). The other representation is a tuple of 9 integers giving local time. The tuple items are: year (including century, e.g. 1998) month (1-12) day (1-31) hours (0-23) minutes (0-59) seconds (0-59) weekday (0-6, Monday is 0) Julian day (day in the year, 1-366) DST (Daylight Savings Time) flag (-1, 0 or 1) If the DST flag is 0, the time is given in the regular time zone; if it is 1, the time is given in the DST time zone; if it is -1, mktime() should guess based on the date and time. Convert a file's mode to a string of the form '-rwxrwxrwx'Return the portion of the file's mode that describes the file type.Return the portion of the file's mode that can be set by os.chmod().S_ISWHT(mode) -> bool Return True if mode is from a whiteout.S_ISPORT(mode) -> bool Return True if mode is from an event port.S_ISDOOR(mode) -> bool Return True if mode is from a door.S_ISSOCK(mode) -> bool Return True if mode is from a socket.S_ISLNK(mode) -> bool Return True if mode is from a symbolic link.S_ISFIFO(mode) -> bool Return True if mode is from a FIFO (named pipe).S_ISREG(mode) -> bool Return True if mode is from a regular file.S_ISBLK(mode) -> bool Return True if mode is from a block special device file.S_ISCHR(mode) -> bool Return True if mode is from a character special device file.S_ISDIR(mode) -> bool Return True if mode is from a directory.S_IFMT_: file type bits S_IFDIR: directory S_IFCHR: character device S_IFBLK: block device S_IFREG: regular file S_IFIFO: fifo (named pipe) S_IFLNK: symbolic link S_IFSOCK: socket file S_IFDOOR: door S_IFPORT: event port S_IFWHT: whiteout S_ISUID: set UID bit S_ISGID: set GID bit S_ENFMT: file locking enforcement S_ISVTX: sticky bit S_IREAD: Unix V7 synonym for S_IRUSR S_IWRITE: Unix V7 synonym for S_IWUSR S_IEXEC: Unix V7 synonym for S_IXUSR S_IRWXU: mask for owner permissions S_IRUSR: read by owner S_IWUSR: write by owner S_IXUSR: execute by owner S_IRWXG: mask for group permissions S_IRGRP: read by group S_IWGRP: write by group S_IXGRP: execute by group S_IRWXO: mask for others (not in group) permissions S_IROTH: read by others S_IWOTH: write by others S_IXOTH: execute by others UF_NODUMP: do not dump file UF_IMMUTABLE: file may not be changed UF_APPEND: file may only be appended to UF_OPAQUE: directory is opaque when viewed through a union stack UF_NOUNLINK: file may not be renamed or deleted UF_COMPRESSED: OS X: file is hfs-compressed UF_HIDDEN: OS X: file should not be displayed SF_ARCHIVED: file may be archived SF_IMMUTABLE: file may not be changed SF_APPEND: file may only be appended to SF_NOUNLINK: file may not be renamed or deleted SF_SNAPSHOT: file is a snapshot file ST_MODE ST_INO ST_DEV ST_NLINK ST_UID ST_GID ST_SIZE ST_ATIME ST_MTIME ST_CTIME FILE_ATTRIBUTE_*: Windows file attribute constants (only present on Windows) K1 @ #W!+@`+)!+ZC +`+V!+!+E! ++1!`+Ț!`+pF@@H2W!0`+:! q+}! v+v!r +!}+!r@+!s+!t+!t@+!u+! +!u +Š!ʊ!!!!!*!2!G!N!e!l!!!!!!!!!ߋ!!P!X+l!U+c!X+!PZ@+s!Y+![ +!`_+!_+!d+)!e+ !b+!b+!Pd+!n+@!f`+W!X+J!g+1! i`+!@@+!@+'!@A@+/!A+7!@B+@!B +H!@C+Q!C+Z!0D@+c!D+k!E+s!E@+z!I+KJ)!r!! %!@%#W!J'J)!W!!!!!xD+pqqpP+ +hp!p+@PH#W!KR!E!ˌ!%@++p0++!!`+ P!`+ + !@++#W!E!G!!K)! (!r! Ț!1!!K-!%C!%H!%KJ!N!%a! %t!@%E!#W!Ț!1!KE!J!!W!xxsubtype is an example module showing how to subtype builtin types from C. test_descr.py in the standard test suite requires it in order to complete. If you don't care about the examples, and don't intend to run the Python test suite, you can recompile Python without Modules/xxsubtype.c.get_traced_memory() -> (int, int) Get the current size and peak size of memory blocks traced by the tracemalloc module as a tuple: (current: int, peak: int).get_tracemalloc_memory() -> int Get the memory usage in bytes of the tracemalloc module used internally to trace memory allocations.get_traceback_limit() -> int Get the maximum number of frames stored in the traceback of a trace. By default, a trace of an allocated memory block only stores the most recent frame: the limit is 1.stop() Stop tracing Python memory allocations and clear traces of memory blocks allocated by Python.start(nframe: int=1) Start tracing Python memory allocations. Set also the maximum number of frames stored in the traceback of a trace to nframe._get_object_traceback(obj) Get the traceback where the Python object obj was allocated. Return a tuple of (filename: str, lineno: int) tuples. Return None if the tracemalloc module is disabled or did not trace the allocation of the object._get_traces() -> list Get traces of all memory blocks allocated by Python. Return a list of (size: int, traceback: tuple) tuples. traceback is a tuple of (filename: str, lineno: int) tuples. Return an empty list if the tracemalloc module is disabled.clear_traces() Clear traces of memory blocks allocated by Python.is_tracing()->bool True if the tracemalloc module is tracing Python memory allocations, False otherwise.Debug module to trace memory blocks allocated by Python.faulthandler module.is_package(fullname) -> bool. Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found.get_filename(fullname) -> filename string. Return the filename for the specified module.get_source(fullname) -> source string. Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it.get_code(fullname) -> code object. Return the code object for the specified module. Raise ZipImportError if the module couldn't be found.get_data(pathname) -> string with file data. Return the data associated with 'pathname'. Raise IOError if the file wasn't found.load_module(fullname) -> module. Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it wasn't found.find_loader(fullname, path=None) -> self, str or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, a string containing the full path name if it's possibly a portion of a namespace package, or None otherwise. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol.find_module(fullname, path=None) -> self or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, or None if it wasn't. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol.zipimport provides support for importing Python modules from Zip archives. This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files. It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives.zipimporter(archivepath) -> zipimporter object Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive. 'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive. The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted./__init__.pyc/__init__.py.pyc.pyճ!!!!۳!!!!p ! !p#+!!0!! ۳!!0!lp0!C!0+N!`+[!P+g!p+!E+:``+}!+!@+!@+!x!v'!v!! !! !ͱ!!Ŵ!P!!!!!! ! !`!!!!w! !  !!H! !0!0!K Q! ή! ,8! ,!p+]!@+"!P+t!+!`+!p++ ,,R!0 ,@ ,te!8 ,@ ,t ,`+@ ,!+ ,rx!٪!2}!u"!s|!٪>(!٪!!!!µ! ʵ!٪!KKk!,!!%ݵ!(@D@,q ,,Plibpython3.6m.so.1.0-3.6.15-4.el9.x86_64.debug"z7zXZִF!t/3]?Eh=ڊ2NE2M ﴀ|a?Ad*OZ6(&.w# x S4BȄ+kxhwD'} Z}w^.S vDmIt]T&4gaqhoAH+$HK !҈1v`(Щ[1(Ev ї}MSQe{G8p9,: ;őCR, ˎFj$`R80z/Bwparvnj{5[*5]#ţ #ܣNVJ:TyWvzPy4F2ɒEG@U7I \ t2ME C D%YsV 6b^\]|,s'AX=W(}?cF 2+s+i4b@l-l:B)Aah •YQ~$n`r[byZ"kD6`.znlH\]+Dst+~YaC'n2'k?)mwҁnY`'UI,f$\='4Q t 8k*/w ZEC!>Cd%`mHې?|ٿڵ}Q,fs@_O/'Qkn|v`o9;҄S2^ݭ֦+%sof'.vyjUTʅL]45Ȯ?[^z;ʄ0FMrME )!Svh?KChQ6Yb4oDSm k )e3^ضQcr-^m9V3$^̓a2c6ŖRS=!Aa2X|@AQ2&rӤB8ɛ (`8B5ԊCy&,4Z-NQs&j.Xifw@0R^bHUTpLYx9%E eq:s`;mV^+.rk׎Cx줤azG/Lz `nrtֽƃ# NdXck0VeYGZJ{`VvX?a$&aq=ktY7288Ŧ[/kkkKtH +K%Ӿ pX}َ&.m34_Z*g ?^wc R!x 7K vD:B0M(raE cRDZJYҶj E(rNʏ;ra1J4-[ UB$C/8>寧TS[խiǼ@űah-vZ=Gi^Q -GM;w>,m>[|\VhkZL6xđCЙEP[ZI$^1>S/aNJ9W`ސ z=rs⨋N}/$/{G0e[tlꁍo?h ܌"7oh'!2Rb;]UmTFDwSA #UeHULp{1Ċsa-{h쨄 c'@f{@CxD1A 0t/ʎjόpg:Nƻpjl3Sp32(#DbܯIc8?]a;AT"8|]湙fA)\z>f + w# *J3-8[SOդ]:u^mdɯ89Z$8)vXAzpCjKUq$=һ 4EH "0UdR`m1""2{; RW".cz0l9- r"(vĿR޵IW[0ϙ܆G!O[oLyXg A3{y,~+?]@A\,D'ϞѻrŔJt[? b^wETUK3.*[?iޅR x^KfQJ 7B @-"d#iy@I|-CG+5f߭ƳEB86qJO ױm2>O)!p`#vzePtZ04 >8i%= Bw`~F\2a%%\e! [Ike?}wO5I'2Е~(QreUfue-6F~_^~Y-ˑIװeƞR'VsҖhw[Cmw+γqcrOj&Irl #OޮYESODeFg7غjR6$GH]rgΟ8~\B1Ϟݷ`/ u>j,KMNJ܇4?Јz?rR"E䋱D(%)OŸ9F_boGϯ !_p;aHeL 5L{9TH'8&i"Y kah@>ѧFjUjYZ߭ti$SҌ (A?"L!fX(#bK`m5 ag2h5g 'MjtUC^WV.Q 3 X{ɺ@/R)mMn[v$Re9/e_<8EX  2&V9kQOcTxJ_$szuI)f<ƒb~C>+R14igxKpK; HTZg_,|og#rO+,ӉNbۣ8TŅbcU~kHNq2M]`_k'R8P/'egJ ͸92G u2uL=ŗ"‘5P55:2e /SO\IXuÃJ )heUr s-)f;N 1^0*ɓpu"g]w2=3R 3Q&#JU-)W zaznl0qeaא`,{pP{אDBkP7?[]0mo[DTZJHqZ7-+٫"gb0TkxEUnJLWRLy ! 2z}pw|, 7Kqh'ҐNJ41=0/2H2#iaΩ-r}bQ0z|+Net :3I*.%Vg/Աw ɴWY~ ;LYG`c{0XWoi?Z-y<&UՆ1?ֵDt P=ZM΋dcGhɦ&Z穚SYß'X~~A^ [7L|Z e17Ak-p4h 1@CGDi Qì+$ U~nm- M5Б\SiT:)Jƴroqܠ'-Us0&E#~ 8,!+zt,!awۼ2tH$_vg{޼6߂'*X/n1؃1ѣ2YfqyeUl+Ad-WKmqޓlCߨX#ð=imNYTvf1l'xa(/@ ۘaYdcPc'ySG~,a?Vӵ3eCrRwTECX,?M [=[rI%^rX,k}D̘.We.I 3C >Y`\j{ / L[a!%sum}vxpdRB㉷cXpƉj:@ =sj /O!y֗R+tj]J,)Ȁ?]{Fe0Rxu OIkq3B@Z[-7.^O<9;a?fv訤3Ge lui|/J"iRQ TIG2ns"S|@uʐ~$Ɵm!(pk,'Y*uv]c0"e&hx7.oq*S#Q t@" 1H3+PPh(L̹I_%iĂՇ5DJ {^΢rvyC#O-;%D&U_y6CDhd.q`3hwc6Kn?};<@yob7blוZI/1Is%E "j,Iʂag䜼5quQlXb?Lna<7 -lmsij"Q:iIaS ^b`YȕGwoJIMB 'rvTҏ*$0zf6}*|m%1. ]ƛ{0HQဨ#KZHA,lOJ;C\d&޶Ĺ!c4Q;+w4yB3a۝$F"s[t4>dh||=$QdaЧc#]`R Cbz]k"e.:*[OLQZ ug.s7e#O1i̺8 Y<:(oD +C?]ZjӸeSQ?緡h84PoYJ"\[8fa!EhNu1lY,Qsan~D”2WU_9 ,R!e0mND1-_A0V~Ƃ}vl a}&0{7ف/;f%#r֧go"v 6 撧'թ3.Q{t3cP#hUe%:嶎k3JoQh1T'ǾlC|fqAdz|/ٜ6Rz*κ3ƾGC2*,TQB`|xk8(J'Cgf-&ԣPki=-^M@Ewo,3 us/Qk6v-o#=fa%"(-NLϩWN{ZٶU-lWS( G8ۿ5/Tݦ·.v4.sck[FkR"dfM[o!Ebozl&Scr݃gB+qO0CBGG`S"6w$dmj|#*̡t?Bp!n#WTbzyϩdc]Nfԥ$r;etrX}[qnԒ4# T;,JһgkOKr0Ơd8e&Sp10l0,h|u9g3 4"pӳ9G5-S </ڋUa/ѥ͠:fi%Ј!^Yki,UeT+\ xfXQ8FM@gl:2.ELA.?Vd#L($}Gć„?}OD<k㸘G"^")p0FX]RvLtqoLx[ęLћ:0Hlk2IKLY3 X*OXz/%W4t)ktQtF ((`g.NA wJSZH5НW ؤkIVw]9M >؈p vQv3lC_a!*.\#uĤFijnod/)̨Q8 rUnYWrv̮ΏVLXZ1f}~la\4! &ByZ N]e^,KB"}EQp41#s}>U`[(Z Lbi$Q /0K ;%s?mUI1.ʀLyZ׹)9.]dSy"TyA_Z왨>~e4,\Sop7 HD3?H&Ovf|py8|bH>e(Chk/^rƆHF9};9"R]8Dė-[TzN!zD2 CC"I~"=PKK}o6`w+N+c>l X2,%g dq3(8GfQ ta2qZ{=<;f]yi*y˦Bmi p&g`)DU'-f/|5g`젮xtQα}]DLSU l ǯϒR;eLb!OkR'k"}]s<w"yߝn_Ojn5xPٻUy[Z!.ef^࿗vrziS8512bd ׷od`&%8 m?jD p0i`LBuӧGE*FY///'c!j<^G{N7woXt͗I7tY78uw}FV"oI#_0Z.To ` ^0ux ~e:\ ZQ]50b/r pn֣L(b0婠Z S`GfX^XJ )!Z?-}9Œ(Lщ%Aˮ Pޟ2ɽf!mgw[ƣ&Zmt4}w׸&璞F^e+w=("(/"mY %ZixHL^$wDz8ՆVDBY7PŝUND[e 1]Y$IO]1kNO|? 4Wդl-4d/ǟBg-u3twd "(:COk?z ;*IG*VLDK9X,X^kY^ yjXOdj uXp^241DaPk>6TGz.|J~I 6uBxk) 5 "mv{("Q+ȵ5[xgN^HP-ıXGNQaIKI$/ؓI{=hjI6 cM/W-˓/BÃCLbɣǿvhU ݩ2~Ua{[$ ̶ˌ.g#W1AtK-K;$9:UsY0 \R{_[Y9> v#U`B\gЅx꼝zKe$HlhhiUZҡ+X:4j\ԒtDqwR%Kfq:w±!cE;{p4=&6׿tNqxc%('sfco8V5»se27 ;dm[F`KEW 4WM CeMv,E,-]r,%GwfXZp;lbdCX㨱]u/@5yYM~WP<Q ۱; ;yApH 0R7@S_{"<$c8?),CzS@rMi]@k*,p( E:Nv8}ݹ1 zTf%\f2bjS?챬y9l/S%ohRI'˛@)bS)~_;;Ѝ#z;b3/QqL >@TeV>$uE^sШjvᎪ mk C뷚!\* zUZl?RleåuZg醸tb:L$^>e](]<&iՋ-y>aU5!1`L (ɢTħ UXJVa+uGp43,T\, ᰿)1ǣ< Trx<≗f 9Ei;tq* N  ȯdPzuT% eh![~. Wd`KhCxB +n8q_ʰ{O=/*NlwD HEԚr2m潛<]c#BɫgIMffa-PY3%zѹ!:6tOo#c1l.ϸ[7Y2-&4L1evń=? heݯnȴHrѼ@j PNəseSY<*LgwcY¬UF+T HcTOsWU*3h[;q I-O î#=T4 Udٮ"ΒtF.ew7DFC3͔aQM'bV z '}tC|4K_hDj/Y~'v88ƪ/|uV;pUVd,S6kM}3vW /=Uk]kF}{UK?w$%BVlWEOвT4^{L|h/|_8{x\^jxcWR4vB l t?D%Y(R4TVLuK]2Gs4G_8Im*t7 :$ež*n^lYXcJ/,Z5v\ [;Զ0ĮcL8Qٜ1FWًI>ZIaGԇtDmS߾S JDxf!tijlg>HƮcyǶ$J{=[3٣rk3׎@Y9`6i Ye@!QS?@)R%;HC@×0ڤ'Y%_,",F#F!߶(Eb@"R`ӥ"6hjbtN*Jl'oʛIwg v~´SYY0iJ|sm :JgYf TmrPverLԖ@59jYpuO[ioy%`[@ҚӿnN֪] VZ{VrNQ(f?D_£bcld\o}iД5!F |x$CU0+XX EU$op&Lc|kHQ1ITYy97[ ~c1ֈer#DӬ(%ڇ`>22^o."jtiܲb O1Gr\Ԟ<QĴ5QeCťyXBP@ ;~BCfLk_a 8 vD Vs0Cdjgަd eM^)f܄KHkS mh*[&t~AlĨQ-#2$ Bm ?f@o%&T6K~"y၏Bl9]?G Qs38֡20p`=k s#>+~ӌBTVjxa[؍( hdq+2g`Zb$99J2v|EZT9 F2[ SڎTӐx'$K$yv`5GXuY>4gN7IGYX?/A5ROC=6rn*E+ I$c80KMXS,_(z~(o`+e,h bb +l2sjPBXߎkӑj_մ4aSO\6 J8V|?GD:, { kV8 *ޫK2Iibv!T/>H֛Gؽ"Pi_tlʮ ^T]N 4MMTk| ZOz`*t7Ln83\*\6zUt|S,ޢʙlY.H5uiNщ!Y5<Å*8n pC-[Mo >NFԟ ؓJ8[1E^41Vq4i#"j%1AƶCb,Hdk %C{ϐS]Trr7L"t *`3ɺeXQN} i$x}l`[oROkւrw军]񰘮ަBS ev>5"BAc*>5geMMV٩+z%HuIw.A' r#ٻw~N]^6mDOIYBP Irzm˻rfdjz2J8/ˉ"8_g>?%/lqi =頖ZS hdMIQhL|g*o«$E eS 91dFB jZb50odžUo <3/S|AH? (.ޖcn 7f~ ' ٍYј=E ǑYɘHVF7BlnW)%HKl FFpJo61ծ@Uir8(?ZuF+˨F.zw L{8m5WX{5Řy9hnX817TV+}ޞa.`NvCv|{!}r¦"!RNr'ַ B'hm h@6$s `@G'r8܎ӗQr@_X8@)7g)M--@jrڻ!󢬗3|O;>Ɖ mܩ0v?o 7 \;YJTdTw!jqtաgw%U#Q{`LL7]pz2xb)hp9!bvIG'pR U0 E.ĒeBoe_Dꛖ3s։a* 9>:P,,Q"ob~WۚBO hFK\{%!󦢱B;=tMʡtJk<ESBI't2zk&2&EY{6@+y۬Y[]uM|(O4"G0Ɋ2߭-bpLTių2BО㑝8Q!q"@gB16 z}VԶm"u{YHz!V:Z8DQ2'[Gÿ!;3g[Å|9ʲܓβ,LF ꃄZcb-Ytk|9 xiJII dz.AfdZ"o+;ixhf(٘bf5j*{ۙ;h 'P&~=.(k% G4}OW<3|܊$(@$\ӽ$4gf#ȩLwyd*P7rm¾%>?FC kĴ6ksglcv%X14eC .)n6)=' AHxUasﳢ\w6ױ: _iCk"FpۈiS v)d~&6[n};rNs [Q@I?t`$dIdmjBt1g Կ>Tor,.N9T1%zy^v֜o)X`-^lS;a>n ׍YPo.Y]hۨv$dܱga/NwDz~N'ʋׇl%h2`?+KYKC.VE}(,\*H.bWչցY!X٣C?BHP,xYbB?GgyoEk#yů2?gYgtpkN#RfHmenR}v`AfUZX+}:C,XUg#oT_SUf&_vŽ ?q54%\ӡQI& \6H:R}'Q?DeuVFDT'`zvRF`tM 梩bP:)i,1`/MOxEԒ:߹f} a-r< +=6^gE}+ӥW)n$phP1k (pՓ /A9K͐┧% UVjXQ-[#{eoGn6K\, .6Wnko /g_3lW YiO}"LxB#-oP5Կ-cVyϲ~Fa>1LJB.$_T3\>*[6TC34 'X #"g#ʹ'_CL ^>[KTo'ITRXjugNPMg]^WSs2#m_֮–IL#k\ jp#*:4>L{m I.4G ٽ箉BGj o'}%e7Wȷn<4*!t+x@%oJ9x^~]aykĕ$ƜEoHV {R7Ju@ΐΛ>h&5v@6UDž^/Db2uIP,RbUϙO*˅ 88r{boY߬l[$NPkpg~6AI{ϻmc4C}8Yca> Q5t= "_qpLy!(v2,E! {_l[䂴cg9? !U)^qXXaZesoom-C>s;*V(Ku)huɮS1 +~d;OUmת2wk?aY&}gHX ,)_:'\0]w+)Sy"Z;6Z7PeY废4[(x1ڙN5 .p4 VR> Jm bI㭨B[u'iL8ɘ1Q 2}dVFƷ$Bmİ/|JC$A$էy) ;N#"!6H;}=O_9Gpcl4-l0d]Ȑf,$@'X?\cM~`qk)珽]}0V|9;S 2QAC+G"b=P/Yt{g,Z йc ݋5Ҹ ^x0 E.8Qi38'5{tP13{b'N@o/C.T 18G^ofz(`)G|d3KٹP^m2x3J QX>\e4ssQ.횶idhnu s ˅=WbA< Z9iGɊ?Qa -/ĥƞ[Y`VzbuW'\q ck)\ămv ZprQ smoU֍2io \ A:5~¨*LXaiuִ~tPswy$C摡.:BbZ!9"ʟVM-GL'2ּL_T*LpQ]0n)S[\DW.ke{E(Z;{k;]O|WtҮ9%m> _8AR2< KPY4 #X!ky_ꄰUyY>[Az#7`O$#78}̎i| (bڡҡnf'!qf@xZQW"y!.3l$,PDÊ`MϾ ״21EcJL*P!*!njΘͻധt, ӏy" 9o AXy[) 1@tU4R?8&8b;*)mc L9Ȋ=LtxUtZJH0,-c]=Of-Ndg8J|y!&/mCc x7QA PP>g荎WMvps[?a*34b.0Lt5,:h,j6S mܠpI :%=4#sDªctثFk:L+;/m46k#} O]ZؘPp&qs܈jj=N@lCPǵYYg) ,՞8kqHvN޳0s+dq5%T[-7!*q$2ZAiuM 75-pT%if=|%P J_XsӺYdM0z nrAf#pT@D#dP(DHlQ>&e *me5wHmXSF'q(P'ĶT?|B?tOg1tKMH z#@C P]&rUM nv"ƅ*ؓZu688Ǜ)B  |QhMar(Q94We5:޽$!4L;';,L's1ö:K9Čzw⦏FZxYRoNn! W)58#_~ X8.s3sdkTodճTFֿ^q9 <P)&[H#^{@\Xƣ!c*Ie[x z8WpňOR{EH*\"\I$=8?.g4`Ϯ1gf/ ?Y._u7±Xr$AGQkv5[ Pc)caRaQCFϪw٪,A\B%4\gJ$?DVMZ{@7A 0wM=nr6-SjIuow<+(t ߪ?6 +[o!At8z;e/aad1@4&H%V홒e"9|_gӕ#-:=|JDIۜ\k!HOŚrLV&[;fh}w*W^9*Qצk=Q i_Z$r_ǢWg|Fq +C u4/&Pmi,ku~.ĕ5dч8t ˨%s#"qlކ?lF<))iYB %x>/4OtLڗWr_V\EM#If[`վ\)X!ᕎ*Y8hABK. Puw8N:h t cz2Rx.B9PVB L*Abpv>lu"HaoB^~1Q̨E;98G$Pl7y)I%!QqGaT@5Ἕla:2A|$(F]NJ(B(U 1 t\ېÉ@}3>M3$$MNQԐPzQl߅l:0FvCZI nm1O#uv;)׉,ʑ^0X}{7i t3e})|`UN y9 1h9FKjhNeXNUk唷ZhMA$E-Č6ǟCYM o0NePkbJYЧ%`3(UTE0:ŭ c*=C,?&ŽQf\-:n Ɩ7GR$;wY }Zk9w>rN:U:~XX$ͩGl"rơW`ӡv*6/vO^f["N`걪9זFy=ߘ(RFB {Kl ?ï4tEʆ*>d~fab7ɔg^whaծoAZ!o rwk$BSԪN3%@Cf-J F5BlVG|ǵfMv땿k7 903Ϸ~{SF$E(:|M^.'~kxrYTȲ*x5ѧ1H ٝaֻx+cjw6KB9 ʁqD)z]>8Å_Ls,F}VUYY0!ht^Pl2[X9~ZjM &R"Ct:hhJZI)"-/D;iX|Pnz '[헧Nk?bzIS\U;8GS":-câ}r;0Ըi 7I ӺҤo诉`dzO v8͗hrba['4c&]#/=> i+fu&$R]Rt3pi$.##x9u%KNW!lM7UI{);X_Z?y}ߔ<9s?e͋ m}\Dɵ6?VJKzx?AǴwg">kH?f|$cCN?^v41~p#mm伫|TUR BGಃOCE.Ai]AhRgsz^SD2 |rwߧ˲iS_~\Zy)3) dkTf3>R!C#U';l5 .7*0}v.YYa6Dَ!bXOҳؕOleB1TGtm膚w% .A}1+帿_ sHQzf >߰qRnZwa3rd"A( :bp@2fi \'|>4 TBFT})C_B}EaMN7'g4zFE@@SGW۾$lҩX{g]vhIujn^ύx$cAιGmG!jL 澫rh}V" d*d~^}?ge r/A 132qCΟI`h%eTγΰT}2zƕP c!啉4gSz᳈$0i{r= 0@`CG?%&$#o)HUXLz3gC9FcAm.Su 3fŭ96fxXK6]tLv46ànyϡAW.lA f:U S򤆌&?ـsVO`zJEB){cRwc++}33*S+ qړ~S/6.y' 5 !gnLPxJX6_3֪ixpOx=)}SzmKya[`iQu EDǣlj,k { u, 2LY2VfEWN873r`'J%Z.=ٛT/Б03!+J*R$ QԆE|}I"aQONӯZt9<(q6 uLɞR+ao//`{MN]fv/i\cca rMʏ6-w SF~BP[|a97ϡ($hfD(%vZTF}BQS#Z|ꁈ}l$e'bl|$`1ӽlF2jj 3I< Y~4"x\IsH9ԄWZ=Nv%I7$Uʧ0fOE*\B, ^n(+{PƖ7u,z慠hm"qȏfNtSx0}{ʹO_Z6JсY4B 0ZNpbŪH Aԧ~U^F7'4~پ́<@3*tVɌ~drfk_>.6KrU- 7,, ϝfZddȷ-lPjZqSxۀLxw~_Tk.%n"J~W ,4ГaL{9JErr>s >]^>jajzhʱysA,tRM]g- +Lvtޗk{D)ț!੟ \;92Rj"dJ.u,e=bW#m2Js+`SpiI%pߜRvmQM=*D ۑNƣ|B!2`-U җK$u|啅.>(s <?ӌ18P'ѫ`8څt8נ./, "r?ms Q⚱vp 3(ev|;g`hH@ l=@3Kqj3\,Pj%CLvPFθYXu@$\qn 3 "{/nyXD\6#dDI./#䤾{Enl'N3@cy`&YD<˸/4ۜ JxWޯ'ZC[\@R\1tU$p=qEhb1W#LeW(k[ OzP9􆸜uLoZG2 U/ i< x|Bea=1[a.iZ(-Vj9V<5Eci]}_p##@$Kd!yǼ{(]ɖ)(Ш zVe& R|v FTu[UXm*J%J5aNoJ^agbq1P{W) ݿon@ n%ZhܡJbRiOXAi-<džgy\A@͎7O%ڧw[fGey˚JDB 6<%ejfR[%jI? ؃K$4Z׊_5_b'w5dl4NĨJV8]z'4+x(seM5T&!X}ExݸʨOܽ:35sXmrq ^-K d:q!Cub8]#RM|1ttދرS`pZ3ȳs'y{GӊfW pIGi.XX+aFTejNQgGņiDqW/+޴r]Q =HuՂlSy@k6g\u{tH;1yE1gb2v/0s#HI*#?VYmL[hZ? ̮n`pǓ?SDS[y[nҘPH_N-?l|1el~bK]39 A8 [J 084+e0 j~6Ǭ8I;u ea)߉73@x흊K8=ݞ缩s<&|9){UЀCl l &@!,ic'7b1R`YVȒH0&hVmLm)ݽ;cݯG`}GaQ\\ Oxx?71.5z>E?b MnPc@a smV_l[ui!XM Ff̭PMpW e#%޽P}Ci^! !wG9 X8/u!;^#Cm >=5P[5Q =Ae|Ӌ-rO,w$0Q|x"h[z?yڡ0.V)p:h@GytfeW[wCM gnrΚ BU^$\ Zp"ցiJgh1_dҀ^< $b@wj5.!SW'qJhh}bI+\a Vry_sR{ʭ{.gë΂"²2+$eAW+ XRK@k9%ơdGóY?fֳ(Hܧ:>k{KeUag0 ۃP!÷)oK鴳uL$ޝ av3&s@0Blv`SBK$ ڕ'I[)=ETr{?=SJfL$VxZ׬y&ܨs5Xʛmo_+;R,hTIJCM p߸ @;I@T]nU&(*xuBSL SP@'P `U"] I?u@̙ņp&oQ$deܹɨU c:z87kՆŎW3-xI$1ΖS[ U jryCl{5X;Jȸ,a+\=Rwή#@,Jׂv,}GǔD֩!vh>@<,ql2!3 >.|M(ėŲST+ё{"f4,d? }zy0ofqD~:*|\74ЫyBp+&NߟH s}ơFTYF(*?_wDx@}xAf zoGQ(,UGyu9d!)kcnxp%Agv#T膰Q5tnoI#tpyЍ&P_L\܊&Rdq6eZ )sn #/A\dD ߆$b?n:ZdgmUCdDžoC{Ǫr_dD,R[w@Q̾WeCf/ғ-LSڪ|5`Bߐ*ﻉo`*/tg{畚bn&StӀpwq]W]˶8-._PE)Vl[oGo&{gxwCZ:֦ P;|aoV=XI%+ߌ똏s&lXvN? vT;&z9/ރuK޳as@K`='IXQy[dz=\4Vi*75r 3%#&IRsXZny$xYgJCAJAb>g(`NAui"p R3G>ޭoU0%1#O OpKM+yGW`/I Q=UsDHTCXNg&ʼnհ\H\$tKL~ z|2.ir}0i׋:Ȇ@_d sCwr:ژ8 J  a/g_/ n~[]_" A\dQنfTEfVwbVX5G(K:HfA#p](al]^ vѮEK0d% 8E2뾋i% -:3['Uf5Gz3W WVa#hgwfviw  { DVѣ^DExˑcv(&&[.+6*M%W#pƇ:dQ`H˾t\X МcqMFEjE= p*Y.x.!鰱!Q+IatHR;Ӗ8ئFp#E]j{AӻlZ`Hn2Qΰ-C>!5¸ܫf9R 6TS.)U{2j{ou'k%\ ]=TSP#w= }zEWȊ*ڌAoѤ;y{z=pABjn A&~NXMg(/N CEou VaG?y ` A]Z!c9)y4*Ly "^q-Iyq*<8Jtgj`^/h(^rԈLewP dnr#t9c5}gg#$"3!cDxOp1sK*$ An7'<!5.Ŋ tvxjڽS&1L)߇qQqVT&]D%MW͖Pr;khc)P!<$y㆟]jZ"N,DPKף"aV{ >DǮz\d])<<2okDv50MCBCķ$I͒=;2jǮM,iϬ^$n54EeTQjɊha_z,|%V/)@zq3D>Y(PUǬ?%lJT`y3֔YPF:pIz][s+S lB3IżuOOR0+̲c)kSmBhr<&mjhS[ cB,ZKy4aA׸iI!ZfzaS;|; y(S/m@`դ:{r:s^?rlwW&)9{](BArs> ZeD^?3<:Lj@L@v4M}~30  Z_S Ln5Sq'5dZ]8E$MvzNK_Љƚf_bVzŢ}U<+i;*y_ӄp3;i b6%FNe(2q0"1A/g"z܆;)/ywJ[w3M+?~.h8CNt~N =1xpܗi0*./bF;+perw#^ފ&]=)rG6Tz0Ͼ)5UNH8P%xwe;^K5âu\)w 8=Fr ߑo"bk|_nb\qؼq0dvf%[%d&خB[C6nQm庤S} {t(ibBt1y deh(nZ=I°jh<9!Be pCF\DfAWBm/] WzFv詢3h;O֢%RAWIJW9\'1i0(?K"fɏDʡ;q6eJdEAj_U˙J=A`<(}NTt'2*$`e3a9$S+Yʫt%,C:< .zQߓH xo.SƩl5>P]?n (-|WO4M/lxW?zzky(P2%Wƨ|`%:auSI!a4_.Vkޙ6,sD eyo|$6st:mXc8)S?vb,4̄H ;\ֶjB0^0c2O^ CK!a nU>q[V"3m~ctS՘Efaէ' Ƨ񗷊&P³+ 4[Ǐ O`GU1I#+aT?6:j)~KO=w!,o}Uig@v9J2\,E[Tmf|VwB0YJϺVKళrW^j)t`4+ 2m+]D5aҪzc':gӆFr;m\K B+tEu1`Y7k@JSzL6P, ZSRxRb Քְ6RsHo ˆo45´av ;aW\;v˼v"*vKւ?xK /Fq!opx7&?!O~]D:=.Q=deCp'>MTȿ}aֈ}Oc^AbVNH(;\A;cf&qF_/ Dpcܨ>جK1љQ{d{#EWJWۑ6'C܀ϐJR/c6phMA 1C};|C1a r0/~B sMPҸ{6:hjץ_hj̬4cBب7,_k6]UU<M3{.[h`TM 5*"{Lۇ$'yk/`KfJ_Y&c'JëxCLZJe^ ?G\w{6jjL znZPA0+FW 7l"z8)7&!N,'8/ qdx(|8(Kn|-Sbkk 5hѐ҇[B>&E@ dR|houhD \Gn?_2N .8)9rG1Z>pԪ"-fr [ IU& W!ދFKGx -Jԡu{OV5n z~ @__'*dW1JހE2QPd6HUo#xF&wt5>iui\922Ar*E]$_`7__2zbxϜNP֫$kpZZlGX){QkKu+[ďrbtkj9|T C~hRanq$4)S,奟dGn~^(u ΄̉rE3SgvUFp;A<;ۼ{$p:o(͈}RR .tp3fo%?G拫Um[©4iey_[޴{v!T}(/|pi?+,y%b ^6CV b&Иk.x fkZ3z>Y,!w&f]c U5@?<|-'>NAf |t Eғ mx!t $Z G4OXA]" Bw[u LsDb4k+a_Hw3A5_8i,'N_52|<dtnm]?3BV)4JӑS% Cv[E;M$aLʘq~Yrr!ƞu%sS;iZ^Wq*mn0qmza2׼# SkoO/4d V#؏/akBl*A+Ԉ.߯H Sc{XJW?T-lƢk_=1xONP'0*ٷBդAs#}L~ëF$YjN^-n .UW3U-:#5avf9,TТ׻J]SD ֵ,tʓpE.탔\}}/NcKc-*AQ.YbbOS+̷{Оٚ(Ptm]MeJ$-ҧ;v9u/~չ=MvRԌ*(dXmmb`1V>딡^:?nؑ3`mߗ/G47D?'𩓢0/F`5]a'@Rbe0z:UTQg&O⺶/FW,_lw4׆!MqT$G!xE*©—SOA,P1L߿9g5x^t`L2YWVnu|~},&v 㼵l=FnGt<CEvM7[ثh a匜hߐpΊ6ɞo:4IwzRv7]o~ nI~(|FqGpq4m>iEY,XjcY> oи uo,vwy'[g#(1 LVs*VsbD3 ALz3US4j}wF p_ 3߾:sXa1"~2_RbD ZXys]ރz>($<Iʑi;)\h}ozY[w|*^t@xB~8-e0+,S%4BPVICv(I1@( !&sn8_Y^AV?y/Tk=MAV0\;! v&u9KR\/j t9ˡY=<p ahSJ'ZE˔?=MzF~=O@owR#uCn^̦[ď_qU6[ulsȯvLD k:Z݊,,;E?h#;$tA³!D/mmx&4ia x M~n BZb~F  ~I@ }qE 5˰oʏUURW%uzI7]ES&]+ͯfYFwӔ׾P=δ͠6_Fk|ט3yG@dQ-.?5%-OAv{ޮYV.޿>Hj=|$㽍 u&mxT:{R_n?(5%JQ'm(.y0 Y+ҎQ[*fm)Bb968.P- U5Mz9/v̂ f#PK*o` Ƃ6`\yE/gXZ#4q^2dCnvq7KL8k㶮#'뺾J+==A-mtDCfۅu\Kѭ]ퟶoO g(v$쥺B2l@fG1#Q&T=R4|\X Zh71Uoό|`aF#Cuђm5k^9^k8Z:Re{gGr`\cY]g#5LJ~sPAk!r^I带e9[9 )gdBS*)ͥ(kg00K)rþ۳r2<@1 R[iNGxi7NF8 գI;AeJjo:l$\UOːLs 7jZ^ګDk AOBIT xn28xVne! `4zol5{?!f[:0gI[ x`qӴ,e_BL2tJ?֦qhYģ33v@Pœ4[1_ 鿋@Cnj)xej˗ՉZ?D5ƢDL*%D\W)k>@9溼;px_Tzu=Q;eKnM~aߙ{# g.MHָy;Oe Cֲ{;![h:p װ8,:٪,󧿒@F5톫A1:fbkuR7pe#+1w\rh:ŝ{'=i٤! @;F=rJĺb` _8/9aW܍>g4'[u|M/?"9VP./l0\wyӷbIK݆Hp>ySlU1 UkRs pKBOhA?(R`8}Ji[bEXpf_X#Iɣ9}UeJ5\+$V•k0}qcS]j=ICÐZVN5p³m&Unˌ°JHhˬa1[d-NJhpUfH; q6I酱e/ }WNlUm)ߓWczގb*E QD"c흜,/_"Ct3t;J?8\Wk/u[ s;]AtX@*&l zOHr .L ±&j-ǵkh ă䭭bߑ~/$eY!&i);t-*.3 i陞O J@S޻HPvUJmq82ްl=L+/){b y( 0)W FBrf,,|9Zk Hy\7L¯E|8Ҷ!ʾ`і ]}{-/d<$-^*s7F2ekS>'etm%9_&gY4Ϟi~LψΧ3|8d>qI/%TW`K-7rtpJ,s(N%mrl3ir| +EjݟgӊQ+g?[QL6k~qQeE>$QLhbu֎7P9Z#t&}= >YV=i!JMCk(]7VǓ|}LV.OXWfTM~VR1C7yQ*;a%^}D`IJGRm~]&=0b@IX' m_ߚ,8bzߕUu:wڀ ߵA;jK7[AVnZe1Y͐S`6V*c|chBa %=Y"İD'y!<_ "UJFϬ׷A/l,0_nKZae:bYhJBTx|k)\'- ՞CE6C!(+їfՊF`vRvSk$Z<>-zrۚ YF>u,Pl: Ĩ:M!wwulO tju@&C< fl7Sųc+9.xfꆾP*]R:-v^,mrn$QK14*n0DŽ/JZIBhub5vAU: r/PiDȸ"?xI:#ּlYrr汶%H2`>81k@2d{~'r &J;r{@c8VChH{XEq'88F>'f!Ù)fv˷JYt.j[U)m>V)hSݒvZY\C=lOB,X1V{{^w7d|0-jj A_Wa#9vYtS3rifbϮ 9wgYZ.shstrtab.note.gnu.property.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata  $1o3; 660C4Ko44Xo0gqBh@h@{v  ^ . .]r33 @@tw t!t! @" @"8Hp%p%x%x%%%0 %%%%(8%%, , ,  ,4 ,tX,