ELF>@4@8 @qq` ` ` T}T}p/p/p/Hl0*0*0888$$Ptd))),,QtdRtdp/p/p/PPGNU)aC,|z b+`@#lQHAB`D% " 1QHB@2@"F,  P*Q8 @!! 5BB@8H   $$(@@@BPC   PZPh@,*"jЂ@ 0E0H P @2 j$@ 0"@Y   B@ D &xd2@f 8I30@@  QDP0BC#P@#@. !#!$D."A@"R(BP @0   JA PR *",! @ @H  "@!P AA@Cp @ P 02h (4*MS"A $@  @AJDq!=P@"$xB0P A0 " !` 1D!& H0P1T@@ (@ @B@2bbD D@$`P @b("@H QH 2"`!( *H2@ Ę@ P0)#HD ACȄ  I"d B0D@C!!@@@@  !2! "'LH  BB`( &@ 0 ($EDr8E#XlPH  `PIgebaz @"a@%!$!K$PD  0 BLd  h Q  C @ 'P 0 J,@!ȑHQA@"  `B@aB RX@! @ 2 "$%Q BH!@)*@ D@Q @ aPh $)`(H`@(FP $@" @ () ` h, @@F":@ @VB Q H yB@ B 2@@JB ( 0H0$!D p 8(@ *"PBB  ! 0P $&#ÊЈ4BH"DID@, @@T@ @H -8@@p@ 0i B(DRĈ+@ Ф@JdJp!@)8  B @@i@£Aflmosuwy{}   !"&'(),-0234689:<?ADGJKLQRSUVXYZ\^_`adehkmoqruwy{|    "#%()*+-.02589:;=?@ABCDGJLOQSUVXZ[]_`dfjklpuvwyz{|}  $%(*-/0358;>@ACDGJMPQRTXY\]^_`cdfhklmnprstvz{~     !"'()./47<>ACDEFGHIKLNPQSTUVX[\^`cehjmoqrtwy|}~ "#$&*+,-13567=?CDEIMPRSTWYZ[]_`abdfjlmopsuvwx{|     !"#$&')+-014789:;=?DHIKNOPQSUVXYZ\]abdgjloruvwy}~8(.I)FZguh #D[țW?H wyC.cPС^$V t`8ms%8$rf=T?bD_j_# ].VKxd}bm2b`5Nc*eyo(8i?,BdhIdWkm{wW4D0g}5d;L'XEgV,w^Xӿ@rzk21HoY=GӁVxD)ھw}+>oǠ#,U>wԡ$jXn ( ha2O@R 06ΛhsZ ΏDgIAm`,4 s%zH7#qBڌrBa ~*=)ݕaR&iĻJuhlZPb~8vv.'V q2/rIӦmڰ>`Nh6txB^Vu$( r}Ю4H?C{͜P5bKmFrao9UN-SgL!}02 x]ۼͱ;1ʵrR r^m<+p2P꒑s/w<X%kТ(t^Y@?R4өApZ-[C cW"гh}dtEr/y"#/8 ߤ GOG"V*9a8~!|COpD@ GVQma%ziQLcߺ ,zeUpo,x(U _J5 Z}$4g}RG3UI}FEreQ~=I~E m@rK4cg#޻dWq2y¾k֜sI7߷}ЌI攀+9]LǺ^.cD㤘7Lf'#4?=Ǣ&h3p9^PpUȻ u,*h*mRXna΀* 8n]-n0-wm*Hu?lb1 HmڨaTqƑ1R*TԈ+|X>(zFT}%ȓ,ɋ*,ꞋpF#;:|  3!ݎ!ڟHn^ޠFI 8 e)'`H/t]O06`UH @r>r3ԥ”:o).[V]<˜Eڬ`5ԟܚɁ< ٍ^C=B# dۙ]쯺NΧWȺo_6Ғ9 >7mZ$N)1rWjڻ9)M,F7 p?Y+}c6W"Y~*\aUFō; <@cՍcuua/o҃塓F];axnEÉ̈0ϋWƨ۠ $fHtȼ$ 3M6Q:ILZLe7ڀYSQmm9/OpgСm] -e<'o-s xR*u?"@y(YGcᵇ}2!/UR1Z}5 d$"(ήP9ƨK:dqwˎ T<4\P{Q;;.w[_ҮnӀdȄ3(4\e96ڰь23Ba 'Bp' Vm {LCij݁Q*4^qv$'9}Kj]C ru(NWwmܮ|;2VJ9 8f)Q2mT4svnr 'ny`W~;D}O] ڔFNX UIll5RRz!jFU ,Q `p>`-GiwݳoPI 2 f,ˋב[(u8 StbSYWVEb(& 'GbmMo3Y7/Y$i:=I /-M=q1v- _78M Vzy( `GaPN ѷ̈́_mdkTc?炌6O~(-z I` a?'|ZdIoֳ$CX%}fޘ\f՟uǥJ=h]IGUn`*Pq+;̘/Pݐ}<~ YmUO%#u_Kk0O^p™3d`P\"!p5cLXr:Q|xꫳiєd5xV.:ԞpރZϲbWN81液*butx7Xs=Ho:WH<L ]fueDo]ɍ;)hg -,V~0Alۂ<#gѿĐÕ4\$:恡#f>ͮV8V}`/ӜÁыXgQbJKufRŃ$ ZNځϜeW5̊4hݣ`s jZ"H)R07쇠ߣqr5C||U)sQ@FFg]a?%ecN8pc J.Itz+M"pX(6 T<ix@z&>O1^#o$pꯌ, z)V]~ܪT8Vga&+pj$(ttwgIq&i0T ]I~"#=1#g8nu"?^1'q t&ق9/6ou410!zràbveiK+hsZ`vB`1TlIu®Աz)XOƉ Ky W]4Dr }_oUGר D)+W0Cʏ'.E3,qS>6׸x%clX5̌=F1y 4l\~GCkhYVflX&2஌k+y{-'@^V:|kAC^\f|WUĚB5Mяt63*<QAC[oШU[9B]̒,[(JL6N*RrI8~Lϲcs+ᰀ([H(r@ȂBźZy8P#CٍQui2z3yU?r@,[],좦 H$Zm }ۮ3i D۹Z:;Nf1nkXDYqvAӍn@];NaE֋'Es&u]Ȭ%d#'L 7~T#@ M sv2z'RVY<])?uj׍VJm8kH4|nXqj(n΅BEcꗪ7A'ԂWؙY"I$6ZF^XUǧ罏 vjjgGlwH#%%lX$SYSl+-g/oP- E+dWAZ:/SeESjO.\ul3sΗ X.YlČ?+0rZ"$sarx W؝uyy*=z>G锛d{e*M1Zxj>6Km]M5H :[Hc\rztOw %EOs:hɷ&8hyr_hl=$Uq{80YB>+`Q0w*#f}TQS*5_a/d0wN>G1f]>!xqF1:UX,A" Kfwu&xD'`{o!5>ukaJj.WIÙKfѶ(N*BwKfA0!=?|k +Z_"%QCyޢ" MaGFL QGM e^;65Yl&1j mN{x _tg=NMX3К']IE<.gk;/NO2P,̖ݗ&3RBRk~Lq [f[1J8xB[@:~(0|?(9(Ndž+<0{M)9be]2'~}J[2^2 K}[-ck*Yl_|y+>Q%?E|NJ]n}LLAL-N]}bkK}\z͇~A~1b~>yd[=M&>+} :d~Lq}׈@>`M\r|~"bE^pl}R`8, } >|ǂ/b)Ri}Mm2~Ј8KbT4LF"@l8}O| S`(%f"EKt>RY|z}U}_:[~0(y.\~@[k_}~ 'B+be:/|(J9~1PMQ-?2Rw~7(Y,mNI`|No2[?b$syK6P~+z|[+}X C(6s~G4 0)ʈM:0@/0Vja3*c^1~d(b~Uxa-MAK~J.236[A1}T]r͆FDmUN.1wM(B~|  HNH'4;|q|~ ^#}c~][9/~C}~~}|Ɉ~>'~1V=3.{?T|(2>= ` @X1A H 0> V% P{ r -D!\3< 8Wf ƕ Vc YF # 0 /N 0x pU U' Y P >r> *5 C_1, 0<9 =C$ 0 @gk 7 o Ծ *> б b. m? P ) Cox1\3 W 0H ;  22 p\`: `PJa2 p}/ n B  + ok "Yi -- f9Io @ ,q h "g e E b 0"\ 9`  +u` n "l i UB @3R7 V_p l K P l &38s Xx  { :EZ p8 `>3381! O uX1{ a 1m\3m\3_  >Q @Q7 0 P 6 3 @J ? 3m pY 0gZ @{0  `B`? @' 5FX pOV$6 E  c  4 @4 P9"a 5 A S' *-O G\ * @v7 nd5 v 2R; p6O l 5[E `4 8 ! 'l ͨ ,< `F=K `V Q gx m` i9 P^ 5 w< , ] 01 @ ^ %K 2Z  2. P 6 S;G T. o  ,k ץ 7;^ NPr  <XS p| J Jʅ 'YSf Ȕ AD d Ne Г &  B `  `Y9 4'd |F < W0 6c2Z )5 0 W `101 w T N @/' 89@ PQe  X 1G "2R  1z | Ё +9;n W $B 6   PxV J G1I 2 P<"7 %* `  #A[ i ,I @I. Q pc oF   " Sf{ @2g u ~r , .x1 P9K {"W @1k 0 i# #- 6a 0N  [MV F `&f #$ 0(+ Pr#S: Puhy 4d 7o w 1 =|\3f% Ыq Yu j JC i! @N!U vW {@2 AI m? `= zz   `-3U `dY @X Hg 1 В @$% 2 21 k + z 5D @I i:: z ږ | + P ,S v[^ QI 2! L' v\> ~8. 0Tv . lR Mu RClT ? = `3B `*, 3| X2) ZP5 = 0(1K pdf   M P ! Gh;  k;|9 8E G{ 5 = - @2 1 `3 2 Rq \30M\\3-] | 0z ߖ {X1L\ ./> 't n .l$ p%tl\3  *3a  # 2 9 2L ` . q `2z K S^! >- Xc >F $ Ў9r ,t Rq KX PMl @ ) 2};  {JU HBE p TYm l #1*B , h\3K | o * ?PES n'/D pl-J u9l t c  7, 0L 2  58 Bڃ  XbD Pds F (E v *; f` 1 2  s . PoV TkO 0TTT _׌ Xa <3i \ >  3UT 0/C X4 QA0 u*U pXGc IE UA p nX\3 h}p hk Ѧ Pv   @Nc MF  `qf K u:T ~ 2 \   J GQ 3 @V 1  Jr ?; 04K p~q) 882u  eN #3< 4@ Fao ` PN `NL v 1  3 ) [tIR `d\3Y  ]BZ p 2   H  \] >x2  @ie` 7PP a8  U Ra > PR N@ `6- sU `\3? jD Py 3[ pBR g 2" 0lS `m6 @O   4_ Їb D O\ .T $- =tt 2h )!i ܣ 2m _ V 00G_ Є9#g < Vg@  ]ah +>A  bV %| {  PD xJD } }B @ pp ' 9M1 > H {aR( Hr `fn 4 v! !D V - :*i3! *X Hv / V' em #t ],2 P> @X5 Ms @ (o L ) 2v' `1  ;   3|7 n"|(!2q. poxu_  GW 1  TZ Pl |& V p< '0&  QQs  ([ `{c8 x n W3  /y d X, (T `[# &#kb JC ?y 8d Y( KwHi V @9( @M @53_ &vo *Xx 2r  7 `v1u 2d :I \ tq 6e t 4 !csD oH /JPAX1E5 =w yX L8 x' #q"  Q>[33 $@2 ^ a  2a" _ǃ  |63 / P+  "h d *@@ , \ Yd _M   \F bA2[u  w sO ;2 7 h4 `h[ Nr  -t e IC Xn? Є20  1E x b$H @M3 W= ud YM H >X1yN ` \3f P $ P-B 0WT `? ^x# ʼn(y v"/[j = `W|B pLMp @ oh )r* 0dF `' P9#3Q p(Y P^c qE { +5T U% 0\M o u 00  {\M .U n G [i У  3j, 0ʉ :, U q 9w 2  XH#v6 N(H I'F Z *I U9E' f(\3VI 0Vt  Wb C = ) ^QI2 6c  }OnU B H  A3j A @׊ N _ O Ջ `[h ؛ ] F Hv  @2E `'x @P3v8 ^ U  Kd M Q<+ p B m R I# Pk T049 Pw{ x q2K p]`  e] JS +;N *v .  % {a 4 b- PT5s y x%$ `.' @` 01 " osQ 1'@ ZB X^ TK  f  p+ $>O ! #)[ #z ۗ P~@W3 q # `urxI Hm^ R J z# P'`΂ F#/h 3 P( 3X E2"  [Y 93%/ +; Sc mE 8c @E / P~ 2 IVF )G  ![ h) p AP\32 hz (W 1 n= b! Pg "dN 4>a p5 '~H p= ` 1$A0X 6QS l ? F 2 /3< 3Ks\3ir 3 ? `$:  `B0u  `+4 8# '$ P qe5 `| @ L %s h S @qA+ r  P0$P ]9B*t0z O o 'C p~MQ Jx\3~x _ \3Mg ڙ - YF 6 EY8 U& aj IQ 3B, %U 2C ] C< "1rm ֱ - C$x [  @%37$ kY aw; 9+ $}O '+j s n wE1  33h L  z 0Sa = . i PK pu g \cl g @ %a7 `kp 2 , oow :2 (j  u c ' > 3+ r V0 pm7 py mk P 5 @c  ac E H! Mz cy '   p; Ic bF At (% 4nX2 /P `? < ,;2 `r3)2 C' !3F p^# ^ ^ 2u x@$w 1 % _n1 oZ @YJ {<h p1  Z#b p 5@ 39 ' UC  ;3# \O 3_c P &G  p&2` @1 ' 3 oP 8BL J J @{g8' `O p U ox r` fp\3YC `[o\ `?/ C PWb pT % ? l: q C u  WD 0w#sv A$+ oAw  N3* r A  Ha <5e J #W 01h  )J `\#F E2 g5w D 1 0*r .U2R S3B pQ !' $cq ,.  xi , i# 0'1- 6Q 25_ 0? @^9 b!E AhB =(24 8 , 5~9 4H 4~@ >h { AX1[n { sj  F3+G п 9  @32 0  ( IG#R k- PO3@ O[  '  2+ 5 =Fk )  `']# # N- I; $>{ 78 0q8  Cf _ :  x<4- HnT F `W3, ЈO$ <& 2_12i v , ,. P?P> q at ( J3 " p$ Еl I h 222L 0. D35\ >x #D q]0 1 %/ +   +ff :l @xic vE 2X_ H 8d`2k& 0U_ %]g X9 JY \ ~! ?  p5b@" [ $ P, 56 S$ O: Qg V 6F a. M 7 p{bU 0U Ps c T I k&m W 2  pZC i4( ; \x ^  2Y Zs] @a1c6 LU +{ ` p#}~ 22 d SM % \3m 9 J V[U@  H2YO  an U % дN >g; P `2I  8N LD m 7 2  2V. jI M s (3 *% pUb4 ySt ( ? := > ] FhC k7WR PBM~y 6d 9u  F @.# %J: p!- `VZ2e * }  AN MI X|q1Yw 2 # 81aM P :37 P\'(' 0p , 4ab D ,>x [ . r +ab D 5#P B2 7 p*X 2@ 13o 31[ w Q \y p 4 PfD:  0* K p4 @~; ] ;ET PY `i=vA ` @ 0)g +v  !IY \mE% `qp G }M7s (/8 Pqw IY Q $ bf C A ,> 1O `XF pl 2 0` & Z2xc wE 'g { P/ t4S n:u- U= xg)' -E $q1 #%  @3> ` <@C3Iw 2 T P;, 4m0 tBxY3 2 i ģ ? * & _ 0 m |w& `^  ] J^s  2nX U* !^:P +2E E ` 'H (I Cz | )O ?nC 0b;   B G31 3  R@ gKE 0M py `  : MP @'U `-&{ + ul >R 2yd J ! L^ pAnP [ *,K 0|6*  x2I HA   0 O=B p-K8 V0* ph7 `@0 S {DJ 0u0 p2\Y `:J2 ` PK_ pke  5 `HL? Vy a  2x^ RXbD  ~2 4dH 1t <  2P p@& r V N pHd tJ 0t T $i M S z]' 3o= u] 9 & 0 0b I3i2 =֊ ND9 .)G $; @  P!u   ./6 N  : B[ w9 \ B D/( < h5 ^Gc E ,P 7 ] pA~e  v k OP Ih) P\N, p=nZ Yb D 12 (33 0,'R f(W 6P 8%1K {' 8 Q б[ U ;` дVH$ ЇCb[3* 2#^ NE> ~Ou I: @F] 7<f | JI j'1N bnx ^ k `2H p !& @k C 7g w R# &n wn? `< _! SG ,I65 CJv &  -D{b D  . i= o `  0"w2 C `i P#({:  08Cj  u  - /Z pPU 0.d  9O J, @<,` p -\3! 0?J[ / p1`21 o ź Kl ) Dd F zs n (eW 19R =!k H /" 1x1& ,7 ]6 UGuF B[* A pY+ pI D  Rd' )d GG -QV PQ3ل Am m Z| 2%  r  $O p= t 0n T n\3cL a N  `/S 0y6X @Q<Y i8v -. KK "uV *3   [J zsg E  II< }1g M r< @+8 hap m̌ Ea4  0:R =f H  ]o b2t  xL  S x>m > .I HR 8. o R* po%h `5  y.) J `&+V , e M E R Mp1GF _lI PVW `2t3 @ X81" Xi 3` 1  4Y [O %F i+ Iz q  "@f 8 h 3D& %1  G0# ` _QG a PR{t  1 @2FH pF" g$x w`  \[ OMjp 0 "* 8 $ 'J]3 pb o( :9@A0 2U1 pg u(' 85yS q> 0a A( .1 utE 0*( 9* ` %I(\3& 5G 6b;q @j @ * `38 "] PC * 0T * Z 9\3) `  QL ` x1j d\ @R 7R S\3q J t!S `nF p8 t\ T p| ]$ "E 0Ml @on ' E 7? @q/ t  H, @M1X$ @% @y?pX1i T ' Q\ e g6 +3 Q !H%x `g2 C~#n [4 ? P]< PL !]4F PX_ W`(09 Rq= j)  @__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizePy_BytesMain_PyRuntime_Initialize_PyRuntime_PyRuntimeState_Init_PyMem_SetDefaultAllocatorPyMem_GetAllocatorPyMem_SetAllocatorPyPreConfig_InitPythonConfig_PyPreConfig_InitCompatConfigPyThread_allocate_locksem_initperrorPyThread_init_threadpthread_condattr_initpthread_condattr_setclockPyMem_RawMallocPyThread_get_thread_identpthread_self_Py_PreInitializeFromPyArgvsetlocalePy_UTF8ModestrcmpPy_IsolatedFlagPy_IgnoreEnvironmentFlagwcschrwcscmp_PyMem_RawStrdupstrlen_Py_SetLocaleFromEnv_Py_ResetForceASCII_PyArgv_AsWstrListPy_DecodeLocale_Py_DecodeLocaleExnl_langinfo_Py_ctype_table_Py_ctype_tolowermbrtowcmbstowcs_PyWideStringList_ClearPyMem_RawFreestderrfwritePyWideStringList_Append_Py_get_xoptionwcslenwcsncmpPyWideStringList_Insertmemmove_Py_GetEnvgetenv_PyMem_RawWcsdupPyMem_RawRealloc_Py_LegacyLocaleDetected_Py_CoerceLegacyLocalePyConfig_InitPythonConfig_PyConfig_InitCompatConfigPyConfig_SetBytesArgv_PyMem_SetupAllocators_Py_PreInitializeFromConfigPy_InitializeFromConfig_Py_HashSecret_Py_path_configPyConfig_ClearPyConfig_SetString_PyWideStringList_Copystdout__errno_locationwcstokstrchrPy_NoUserSiteDirectoryPy_BytesWarningFlagPy_InspectFlagPy_InteractiveFlagPy_OptimizeFlagPy_DebugFlagPy_VerboseFlagPy_QuietFlagPy_FrozenFlagPy_UnbufferedStdioFlagPy_NoSiteFlagPy_DontWriteBytecodeFlag_PyWideStringList_Extend_Py_isabs_Py_get_env_flagwcscatfclosewcscpywcsncatmemcpy_Py_GetForceASCII_Py_GetLocaleEncoding_Py_IsLocaleCoercionTargetPy_HashRandomizationFlagstdinsetvbufgetrandomPyExc_ValueErrorfstat64PyExc_NotImplementedErrorPyExc_RuntimeErrorPyExc_OSError_PyInterpreterState_EnablePyThread_tss_createpthread_key_createPyInterpreterState_New_Py_NoneStruct_PyEval_EvalFrameDefaultPyMem_RawCalloccallocPyThread_acquire_lockPyThread_acquire_lock_timedsem_trywaitsem_waitsem_clockwaitPyThread_release_locksem_postPyThreadState_New_PyThreadState_Swappthread_cond_destroypthread_mutex_destroyPyThread_tss_getpthread_getspecificPyThread_tss_setpthread_setspecificpthread_mutex_initpthread_cond_initpthread_mutex_lockpthread_cond_signalpthread_mutex_unlockpthread_cond_timedwaitgettimeofdayPyBytes_TypePyTuple_TypePyBaseObject_TypePyType_TypePyAsyncGen_TypePyBool_TypePyByteArrayIter_TypePyByteArray_TypePyBytesIter_TypePyCFunction_TypePyCMethod_TypePyCallIter_TypePyCapsule_TypePyCell_TypePyClassMethodDescr_TypePyClassMethod_TypePyCode_TypePyComplex_TypePyCoro_TypePyDictItems_TypePyDictIterItem_TypePyDictIterKey_TypePyDictIterValue_TypePyDictKeys_TypePyDictProxy_TypePyDictRevIterItem_TypePyDictRevIterKey_TypePyDictRevIterValue_TypePyDictValues_TypePyDict_TypePyEllipsis_TypePyEnum_TypePyFloat_TypePyFrame_TypePyFrozenSet_TypePyFunction_TypePyGen_TypePyGetSetDescr_TypePyInstanceMethod_TypePyListIter_TypePyListRevIter_TypePyList_TypePyLongRangeIter_TypePyLong_TypePyMemberDescr_TypePyMemoryView_TypePyMethodDescr_TypePyMethod_TypePyModuleDef_TypePyModule_TypePyODictItems_TypePyODictIter_TypePyODictKeys_TypePyODictValues_TypePyODict_TypePyPickleBuffer_TypePyProperty_TypePyRangeIter_TypePyRange_TypePyReversed_TypePySeqIter_TypePySetIter_TypePySet_TypePySlice_TypePyStaticMethod_TypePyStdPrinter_TypePySuper_TypePyTraceBack_TypePyTupleIter_TypePyUnicodeIter_TypePyUnicode_TypePyWrapperDescr_TypePy_GenericAliasType_PyAsyncGenASend_Type_PyAsyncGenAThrow_Type_PyAsyncGenWrappedValue_Type_PyCoroWrapper_Type_PyInterpreterID_Type_PyManagedBuffer_Type_PyMethodWrapper_Type_PyNamespace_Type_PyNone_Type_PyNotImplemented_Type_PyWeakref_CallableProxyType_PyWeakref_ProxyType_PyWeakref_RefType_PyHamt_Type_PyHamt_ArrayNode_Type_PyHamt_BitmapNode_Type_PyHamt_CollisionNode_Type_PyHamtKeys_Type_PyHamtValues_Type_PyHamtItems_TypePyContext_TypePyContextVar_TypePyContextToken_TypePyExc_DeprecationWarningPyExc_PendingDeprecationWarningPyExc_ImportWarningPyExc_ResourceWarningfilenoPyLong_FromLongLongPyImport_InittabPyFilter_TypePyMap_TypePyZip_Type_Py_EllipsisObject_Py_NotImplementedStruct_Py_FalseStruct_Py_TrueStruct_PyLong_New_Py_tracemalloc_configPyExc_OverflowErrorPyObject_Mallocmmap64_Py_NewReferencePyGILState_CheckPyUnicode_NewPyExc_SystemErrorPyThread_tss_is_created_PyObject_GC_NewVarPyList_New_PyObject_GC_New_PyUnicode_FromIdPyUnicode_InternInPlacePyDict_NewPyDict_SetDefaultPyObject_Hash_Py_HashBytesPyObject_IS_GCPyMem_ReallocPyUnicode_InternFromStringPyUnicode_FromStringPyObject_Free_Py_DeallocPyType_ReadyPyObject_HashNotImplementedPyExc_BaseExceptionPyObject_GC_DelPyExc_TypeErrorPyTuple_NewmemsetPyMem_MallocPyMem_CallocPyMem_FreePySequence_TuplePyList_AsTuplePyObject_GC_UnTrack_PyTrash_condPyThreadState_Get_PyTrash_begin_PyTrash_endPyType_IsSubtypePyType_Modified_PyDict_ContainsIdPyDict_ContainsPyCMethod_New_PyDict_SetItemIdPyDict_SetItemPyDescr_NewWrapperPyType_GenericAlloc_PyObject_GC_MallocPyDescr_NewMethodPyDescr_NewClassMethodPyDescr_NewGetSetstrrchrstrncmpPyTuple_PackPyDescr_NewMemberPyLong_FromVoidPtrPyLong_FromUnsignedLongPyWeakref_NewRefPyObject_GC_TrackPyStaticMethod_New_PyTuple_MaybeUntrackPyStructSequence_InitType2_PyStructSequence_InitTypePyLong_FromSsize_tPyDict_SetItemString_PyTuple_ResizePyExc_ExceptionPyExc_StopAsyncIterationPyExc_StopIterationPyExc_GeneratorExitPyExc_SystemExitPyExc_KeyboardInterruptPyExc_ImportErrorPyExc_ModuleNotFoundErrorPyExc_EOFErrorPyExc_RecursionErrorPyExc_NameErrorPyExc_UnboundLocalErrorPyExc_AttributeErrorPyExc_SyntaxErrorPyExc_IndentationErrorPyExc_TabErrorPyExc_LookupErrorPyExc_IndexErrorPyExc_KeyErrorPyExc_UnicodeErrorPyExc_UnicodeEncodeErrorPyExc_UnicodeDecodeErrorPyExc_UnicodeTranslateErrorPyExc_AssertionErrorPyExc_ArithmeticErrorPyExc_FloatingPointErrorPyExc_ZeroDivisionErrorPyExc_ReferenceErrorPyExc_MemoryErrorPyExc_BufferErrorPyExc_WarningPyExc_UserWarningPyExc_EncodingWarningPyExc_SyntaxWarningPyExc_RuntimeWarningPyExc_FutureWarningPyExc_UnicodeWarningPyExc_BytesWarningPyExc_ConnectionErrorPyExc_BlockingIOErrorPyExc_BrokenPipeErrorPyExc_ChildProcessErrorPyExc_ConnectionAbortedErrorPyExc_ConnectionRefusedErrorPyExc_ConnectionResetErrorPyExc_FileExistsErrorPyExc_FileNotFoundErrorPyExc_IsADirectoryErrorPyExc_NotADirectoryErrorPyExc_InterruptedErrorPyExc_PermissionErrorPyExc_ProcessLookupErrorPyExc_TimeoutErrorPyLong_FromLong_PyObject_New_PyModule_CreateInitialized_Py_PackageContextPyModuleDef_InitPyModule_NewPyModule_NewObjectPyModule_AddFunctionsPyModule_GetNameObject_PyDict_GetItemIdWithError_PyDict_GetItem_KnownHashPyObject_SetAttrStringPyObject_SetAttrPyObject_GenericSetAttr_PyObject_GenericSetAttrWithDict_PyType_LookupPyErr_Occurred_PyObject_GetDictPtrPyModule_SetDocString_PyObject_SetAttrIdPyModule_GetDictPyFile_NewStdPrinterPyMapping_GetItemStringPyObject_GetItemPy_GetVersionPy_GetCompilerPy_GetBuildInfoPyOS_snprintfPyOS_vsnprintf_Py_gitversion_Py_gitidentifierPy_BuildValuePyUnicode_FromStringAndSizePy_GetCopyrightPy_GetPlatformPyFloat_GetInfoPyStructSequence_NewPyDict_GetItemWithErrorPyLong_AsSsize_tPyFloat_FromDoublePyLong_GetInfoPyHash_GetFuncDefPyList_AppendPyList_SortPyObject_CallFunction_Py_VaBuildStackPyObject_GetIter_PyObject_NextNotImplementedPyIter_Next_Py_CheckFunctionResult_PyNamespace_NewPyDict_Update_PyInterpreterState_GetConfigPyBool_FromLongPyThread_GetInfoconfstrPyUnicode_DecodeFSDefaultAndSizePyUnicode_FromWideChar_PyImport_FixupBuiltin_PyImport_FixupExtensionObjectPyModule_GetDefPyObject_SetItem_PyState_AddModulePyList_SetItemPyDict_CopyPyExc_EnvironmentErrorPyExc_IOError_PyDict_GetItemStringWithErrorPyImport_ImportFrozenModulePyImport_ImportFrozenModuleObjectPyImport_FrozenModules_PyUnicode_EqualToASCIIStringPyMarshal_ReadObjectFromStringPySys_AuditPyBytes_FromStringAndSizefreadPyUnicode_FromKindAndDataPyCode_NewWithPosOnlyArgsPyUnicode_ComparePyEval_GetBuiltinsPyEval_EvalCodePyObject_GenericGetAttrPyObject_StrPyObject_ASCIIPyObject_ReprPyFunction_NewWithQualName_PyFunction_VectorcallPyTuple_SizePyTuple_GetItem_PyDict_NewPresized_PyType_CalculateMetaclass_PyObject_LookupAttrId_PyObject_LookupAttrPyDescr_IsDataPyObject_VectorcallDict_PyObject_FastCallDictTstatePyMapping_Check_PyObject_MakeTpCallPyArg_ParseTuple_PyByteArray_empty_stringPyUnicode_AsUTF8AndSize_PyDict_DelItemIdPyDict_DelItem_PyDict_DelItem_KnownHash_PyDict_Next_PyObject_LookupSpecial_PyType_LookupIdPyType_GenericNew_PyObject_GetAttrIdPyObject_GetAttrPyTuple_GetSlicePyUnicode_AsUTF8_PyObject_GenericGetAttrWithDictPyMember_GetOnePyObject_TypePyObject_CallFunctionObjArgsPyArg_UnpackTuple_PyArg_CheckPositionalPyCell_NewPyMember_SetOnePyObject_GenericGetDict_PyObject_GetMethodPyUnicode_AppendPyImport_AddModulePyImport_AddModuleObjectPyWeakref_GetObjectPyInit__impPyModule_FromDefAndSpec2PyObject_GetAttrStringPyModule_GetStatePyModule_ExecDefPyModule_GetName_Py_GetConfigPyModule_AddObjectRef_PyImport_SetModuleStringPyMapping_SetItemStringPyObject_CallMethodPyCallable_Check_PyDictView_NewPyObject_IsInstancePySequence_ContainsPyObject_RichCompareBoolPyObject_RichCompare_Py_SwappedOpPyUnicode_RichComparePyFrame_BlockSetupPyFrame_BlockPop_PyErr_RestorePyUnicode_FromFormatVsprintf_PyUnicodeWriter_WriteASCIIString_PyUnicodeWriter_PrepareInternal_PyUnicodeWriter_WriteStr_PyUnicodeWriter_FinishPyObject_Realloc_PyErr_SetObjectPyErr_GivenExceptionMatches_PyErr_NormalizeException_PyArg_ParseTupleAndKeywords_SizeT_PyModuleSpec_IsInitializingPyObject_IsSubclassPyTraceBack_HerePyFrame_GetLineNumberPyCode_Addr2Line_PyCode_CheckLineNumber_PyErr_FetchPyException_SetTraceback_PyStack_AsDict_PyObject_Call_PrependPyObject_IsTruePyUnicode_RPartitionmemchrmemrchrPyNumber_AsSsize_t_PyNumber_IndexPyMethod_New_PyDict_MergeEx_PyObject_CallPyVectorcall_CallPyInit__threadfloorPyType_FromSpecPyType_FromModuleAndSpecPyDict_DelItemStringPyModule_AddType_PyType_Name_PyTime_AsSecondsDoublePyModule_AddObject_PyDict_Pop_PyWarnings_InitPyInit__weakrefgetauxvalPy_FileSystemDefaultEncodingPy_HasFileSystemDefaultEncodingPy_FileSystemDefaultEncodeErrors_Py_wreadlinkwcsncpywcstombs_Py_wgetcwd_Py_wfopenfopen64_Py_EncodeLocaleRawfcntl64ioctl_PyWideStringList_AsList_PyLong_AsIntPyLong_AsLongAndOverflowPyImport_ImportModuleLevelObject_PyTime_GetMonotonicClockPySys_GetObject_PyObject_CallMethodIdObjArgs_PyImport_AcquireLock_PyErr_SetKeyError_PyImport_ReleaseLock_PyTime_FromSecondsPyArg_ParseTupleAndKeywords_PyTime_AsMicrosecondsPyNumber_InPlaceAddPyObject_DelItemPyObject_ClearWeakRefsPyFrozenSet_NewPySet_AddPyObject_LengthHint_PyObject_HasLenPyObject_SizewmemcmpPyUnicode_FindCharPyInit__io_PyBytesIOBuffer_TypePyModule_Create2_PyImport_IsInitializedPyModule_AddIntConstant_PyObject_CallFunction_SizeT_Py_VaBuildStack_SizeTPyEval_GetGlobalsPyNumber_InPlaceSubtractPyThread_free_locksem_destroyPyMarshal_InitPyInit_posix__environqsortPyStructSequence_NewTypePyType_FromSpecWithBases_PyObject_GC_ResizePyUnicode_DecodeASCIIPyGen_NewWithQualNamePyObject_SelfIterPyObject_CallFinalizerFromDeallocPyObject_CallFinalizer_PyGen_FinalizePyUnicode_JoinPySequence_Fast_PyUnicode_JoinArrayPySet_NewPyUnicode_FromOrdinalPyNumber_Addstrncpy_PyArg_ParseTuple_SizeT_PyUnicode_EqualToASCIIId_PyLong_AsByteArrayPyObject_GetBufferPyBuffer_FillInfoPyBuffer_ReleasePyObject_Bytes_PyLong_FromByteArrayPyCell_SetPyImport_ImportModulePyImport_ImportPyImport_ImportModuleLevelPyLong_AsLongPyUnicode_DecodeUTF8PyInit_time_PyTime_localtimelocaltime_rPySlice_NewPySlice_Unpack_PyEval_SliceIndexPySlice_AdjustIndicesPyList_InsertPyInit_faulthandlerPyObject_VectorcallMethod_PyCodec_LookupsigemptysetsigactionPyCodec_RegisterError_PySys_GetObjectIdPyImport_ImportModuleNoBlockPyIndex_CheckPyObject_CheckBufferPyThreadState_GetInterpreterPyUnicode_FSConverterPyOS_FSPathsigaltstackPyUnicode_EncodeFSDefaultPyUnicode_AsWideCharString_Py_EncodeLocaleExPyBytes_FromStringlstat64fstatat64PyEval_SaveThreadpthread_cond_waitPyEval_RestoreThreadPyErr_SetFromErrnoWithFilenameObjectPyErr_SetFromErrnoWithFilenameObjectsstrerrorPyUnicode_DecodeLocale_Py_GetErrorHandlerPyException_GetContextPyException_SetContextPyException_GetTracebackPyUnicode_Substring_PyUnicode_FromASCII_PyLong_FromUidPyLong_FromUnsignedLongLong_PyLong_FromGid_PyLong_FromTime_tPyNumber_Multiply_PyErr_CheckSignalsTstatePyNumber_And_PyList_Extendfrexpmodf_PyLong_Signreaddir64closedirrewinddirfdopendir_PyUnicode_EQ_PyUnicode_XStripPyNumber_LongPyLong_FromDoubleldexpPyFile_OpenCodeObject_PyObject_CallMethodId_SizeTPyNumber_Check_Py_set_inheritable_Py_fstat_noraiseisattylseek64_Py_read_PyBytes_Resize_PyErr_ChainExceptions_PyArg_UnpackKeywordsPyMemoryView_FromObjectPyUnicode_FSDecoder_Py_SourceAsStringPy_CompileStringObject_PyArena_NewPyBuffer_IsContiguousPyInit__codecs__ctype_tolower_locPyFrame_FastToLocalsWithErrorPyMapping_KeysPyDict_KeysPySequence_GetItem_PyErr_ExceptionMatches_PyErr_ClearPyFrame_LocalsToFastPyCodec_LookupError__ctype_b_loc_PyLong_FormatAdvancedWriter_PyUnicode_FormatAdvancedWriter_PyFloat_FormatAdvancedWriter_PyComplex_FormatAdvancedWriterstrcpy_PyArena_AddPyObject_PyUnicodeWriter_WriteSubstringPyCodec_RegisterPyList_SizePyList_GetItem_PyUnicode_IsAlpha_PyArena_Malloc_PyUnicode_IsDecimalDigit_PyUnicode_ToDecimalDigit_PyUnicode_IsDigit_PyUnicode_ToDigit_PyUnicode_IsNumericPyBytes_AsStringPyUnicode_ContainsPyUnicode_DecodeUTF8StatefulPyOS_setsigPyInit__signal__libc_current_sigrtmin__libc_current_sigrtmaxPyErr_NewExceptionPyOS_getsigPyInit__abcPyThreadState_GetFramePyFrame_GetCodePySequence_ListPyDictProxy_NewPyMapping_ItemsPyLong_FromSize_t_PyObject_IsAbstractPyType_GetModuleStatePyType_GetModule_PyType_GetDocFromInternalDoc_Py_HashPointerPySet_ClearPySet_ContainsPySet_Size_PySet_NextEntryPyUnicode_FromFormatPyImport_GetModulePyToken_TwoCharsPyModule_GetFilenameObjectPyToken_OneChar_PyErr_SetStringPy_hexdigitsPyErr_SetImportErrorPyErr_SetImportErrorSubclass_PyObject_CallMethodIdPyErr_SetFromErrno_PyCodec_LookupTextEncoding_PyCodecInfo_GetIncrementalDecoderPySys_SetObject_PySys_SetObjectId_PyCodecInfo_GetIncrementalEncoder_Py_ClearStandardStreamEncodingPyNumber_OrPyInit__statPy_GenericAlias_Py_ascii_whitespacePyNumber_LshiftPyToken_ThreeCharsPyNumber_SubtractPyNumber_FloorDivide_PyErr_ChainStackItemPyCoro_NewPyAsyncGen_NewPyOS_strtoul_PyLong_DigitValuePyUnicode_IsIdentifier_PyUnicode_ScanIdentifier_PyUnicode_IsXidStart_PyUnicode_IsXidContinuePyObject_DirPyOS_strtol_PyAST_CompilePy_GetRecursionLimitgeteuidgetuidgetegidgetgidPyUnicode_AsEncodedStringPyException_SetCausePyUnicode_FromEncodedObjectPyUnicode_DecodePyObject_FormatPyUnicode_Format_PyUnicode_FindMaxCharPyList_SetSlice_PyLong_FormatWriterPyLong_AsUnsignedLong_PyArg_UnpackStackPySet_DiscardPyState_FindModulePyNumber_InPlaceOr_Py_device_encoding_Py_GetLocaleEncodingObjectPyObject_CallocPySymtable_LookupPyMemoryView_FromBufferPyObject_CallMethodObjArgs_PyCode_ConstantKey_Py_BuildValue_SizeTPyEval_GetLocalsPyEval_MergeCompilerFlagsPyRun_StringFlagsPyCapsule_NewPyCapsule_GetPointerPySequence_DelItem_PyArena_FreePyByteArray_ResizePyBuffer_ToContiguousPyMarshal_WriteObjectToString_Py_hashtable_compare_direct_Py_hashtable_hash_ptr_Py_hashtable_new_full_PyUnicode_DecodeUnicodeEscapeInternal_Py_HashPointerRaw_Py_hashtable_set_Py_hashtable_destroymkdirmkdiratPyUnicode_AppendAndDelopenat64_Py_writerenamerenameat_PyBytes_DecodeEscape_PyBytesWriter_Prepare_PyBytesWriter_FinishPyNumber_NegativePyUnicode_Concat_Py_UnhandledKeyboardInterruptPy_RunMainungetcgetpidwcsrchrPyInit_itertoolsPyInit__operatorPyInit__collections_PyBytesWriter_InitPyRun_SimpleStringFlags_PyBytesWriter_Alloc_PyWeakref_ClearRefPyErr_PrintExPyDict_Clearfflush_PyBytesWriter_Resize_Py_HandleSystemExitPy_ExitPy_FinalizeEx_PyImport_GetModuleIdPyWrapper_NewPyImport_GetImporter_PyThreadState_DeleteExcept_PyErr_GetTopmostExceptionPyGC_Collect_PyDict_MaybeUntrackPyInit__functools_PyUnicode_IsPrintable_Py_wrealpath_Py_fopen_objPy_MakePendingCalls_PyRun_AnyFileObject_Py_FdIsInteractive_PyRun_SimpleFileObjectftellrewindPyOS_string_to_doublePyUnicode_TailmatchPyImport_GetMagicNumber_Py_get_387controlwordPyUnicode_CompareWithASCIIString_Py_set_387controlword_Py_dg_strtod_PyModule_ClearPy_UniversalNewlineFgetsflockfilefunlockfile__uflow_PyModule_ClearDictPyBytes_FromObjectPyBytes_ReprPyThreadState_ClearPyFile_WriteObjectPyBytes_AsStringAndSizePyFile_WriteStringPyUnicode_GetLength_PyUnicode_AsASCIIString_Py_HashDoubledlopendlsymdlerror_PyErr_DisplayPyUnicode_DecodeFSDefaultPyException_GetCausePyThread_tss_deletepthread_key_delete_PyFloat_Unpack8PyInterpreterState_DeletePyFrame_GetBack_PyRuntimeState_FiniPySequence_Concat_Py_dg_infinity_Py_dg_stdnanPyNumber_AbsolutePyArg_ValidateKeywordArguments_PyDict_HasOnlyStringKeysPyNumber_DivmodPyType_GetSlotPyLong_AsDouble_PyType_GetModuleByDef_PyBytesWriter_DeallocroundPyErr_WriteUnraisablePyFloat_AsDouble_PyErr_WriteUnraisableMsg_PyLong_NumBitsPyImport_GetModuleDictPyUnicode_CopyCharacters_PyObject_RealIsSubclassPyTraceBack_PrintPyInit__sre_Py_DisplaySourceLinefdopenPyModule_AddStringConstantPyInit__localePyLong_AsSize_tPyLong_FromUnicodeObject_PyUnicode_TransformDecimalAndSpaceToASCIIPyLong_FromStringlog_Py_ctype_toupperPyTuple_SetItem_PySlice_GetLongIndicesPyOS_mystrnicmpPyGILState_EnsurePyObject_CallObjectPyFile_GetLinePyGILState_ReleasePyMapping_SizePySequence_CheckPySeqIter_NewPyNumber_InvertPyNumber_InPlaceAnd_Py_ClearArgcArgvPyByteArray_FromStringAndSize_PyRuntime_Finalize_PyLong_FromBytesPySequence_Size_PyObject_RealIsInstancePyFloat_FromString_Py_string_to_number_with_underscores_PyFloat_Pack8_Py_convert_optional_to_ssize_t_Py_parse_inf_or_nan_PyBytes_Join_PyLong_Formatlocaleconv_PyUnicode_InsertThousandsGroupingPyLong_AsUnsignedLongLongMaskPyBytes_ConcatPyBytes_SizePyInit_errno_PyTrash_thread_deposit_object_PyTrash_thread_destroy_chain_PyDict_SetItem_KnownHashPyNumber_PowerPyNumber_RshiftPyNumber_XorPyUnicode_PartitionPyNumber_InPlaceLshift_PySet_UpdatePyClassMethod_New_PyDict_Contains_KnownHashPyErr_NewExceptionWithDocPy_EnterRecursiveCall_PyUnicodeWriter_InitPy_LeaveRecursiveCallPyIter_SendPy_ReprEnter_PyThreadState_GetDict_PyUnicodeWriter_WriteCharPy_ReprLeave_PyUnicode_AsUTF8StringPyInit__ast_PyUnicode_ToLowercase_PyUnicode_ToUppercase_PyUnicode_IsLowercase_PyUnicode_IsTitlecase_PyUnicode_IsUppercase_PyTime_GetMonotonicClockWithInfoclock_gettimeclock_getres_PyTime_GetPerfCounterWithInfoPyIter_CheckPyConfig_InitIsolatedConfig_PyInterpreterState_GetConfigCopyPyInterpreterState_GetPyStatus_Exception_PyConfig_AsDict_PyConfig_FromDict_PyInterpreterState_SetConfigPyConfig_ReadPyOS_double_to_string_Py_dg_dtoa_Py_dg_freedtoaunamePyInit__stringPyUnicode_SplitlinesPyThread_get_thread_native_idsyscall_PyTime_GetSystemClockWithInfoPyBytes_ConcatAndDelPyUnicodeDecodeError_CreatePyCodec_StrictErrorsPyDict_MergeFromSeq2PyInit_atexitPyNumber_TrueDividefmod_PyOS_URandomNonblockPyInit_gcPyInit_pwdfchdir_Py_VaBuildValue_SizeTsystemgetloadavgunlinkunlinkat_PyUnicode_FormatLongPyNumber_ToBase_PyArg_ParseStackAndKeywords_PyUnicode_FastFill_PyTime_FromSecondsObjectceil_PyMem_StrdupPyThread_start_new_threadpthread_attr_initpthread_attr_setscopepthread_createpthread_attr_destroypthread_detachpthread_attr_setstacksizesigfillsetpthread_sigmask_PyThreadState_Prealloc_PyThreadState_InitPyEval_AcquireThread_Py_IsFinalizingforkPyOS_BeforeForkPyList_GetSlicePyList_ReversePyOS_AfterFork_Parentwaitpid_PyArg_ParseStack_SizeT_PyLong_CopyPyLong_AsUnsignedLongMask_PyErr_Format_PyEval_GetBuiltinId_PyObject_CallMethod_SizeTPyLong_AsLongLong_PyThreadState_DeleteCurrentPyComplex_FromCComplex_PyArg_Parse_SizeTPyCapsule_ImportPyLong_AsUnsignedLongLong_PyFloat_Pack4_PyFloat_Unpack4_PyCodec_EncodeTextPyCapsule_IsValid_PyUnicode_EncodeUTF16PyUnicode_DecodeUTF16PyUnicode_DecodeUTF16Stateful_PyUnicode_EncodeUTF32PyUnicode_DecodeUTF32PyUnicode_DecodeUTF32StatefulPyNumber_RemainderPyErr_BadArgumentPyNumber_InPlaceMultiply_PyObject_FunctionStr_PyArg_NoKeywordsPyObject_CallNoArgs_PyEval_SliceIndexNotNone_PyCrossInterpreterData_RegisterClass_PyImport_SetModulePyContextVar_NewPyUnicode_SplitPy_GetProgramNamePyUnicode_DecodeRawUnicodeEscape_PyUnicode_DecodeRawUnicodeEscapeStateful_PySys_GetSizeOfPyWeakref_NewProxyfchmodatfchmod_PyErr_NoMemory_PyLong_FrexpPyUnicode_AsWideCharPyInterpreterState_ThreadHeadPyThreadState_Next_Py_strhex_bytes_with_sepPyByteArray_Concat_PyAccu_DestroyPyUnicode_AsUCS4_PyAccu_Initpipe2pipe_PySequence_BytesToCharpArray_Py_RestoreSignals_Py_open_noraise_Py_FreeCharPArray_PyLong_FileDescriptor_ConverterPyObject_AsFileDescriptor_PyLong_UnsignedShort_Converter_PyUnicode_ToTitleFull_PyUnicode_ToLowerFullPyErr_WarnEx_Py_strhex_with_sepPyComplex_AsCComplexPyComplex_RealAsDoublePyComplex_ImagAsDoublePyNumber_Float_PyUnicode_AsLatin1String_PyBytes_FromHexPyUnicode_DecodeLatin1_PyArg_BadArgumentPyUnicode_GetDefaultEncodingPyNumber_InPlaceRemainder_PyBytes_FormatEx_PyLong_FormatBytesWriterPyCodec_EncodePySequence_SetItemPyUnicode_BuildEncodingMap_PyUnicode_EncodeCharmapPyLong_AsVoidPtrPyBytes_FromFormatPyBytes_FromFormatV_PyBytesWriter_WriteBytesfaccessataccess_PyArg_NoPositional_PyEval_SetTrace_PyCodec_DecodeTextPyNumber_Positive_Py_c_abshypot_Py_c_quot_Py_c_neg_Py_c_diffPyContextVar_GetPyContextVar_SetPyComplex_FromDoublesPyNumber_InPlaceFloorDivide_PyLong_GCDPyODict_SetItemPyCodec_BackslashReplaceErrorsPyUnicodeEncodeError_GetObjectPyUnicodeDecodeError_GetStartPyUnicodeDecodeError_GetEndPyUnicodeDecodeError_GetObjectPyUnicodeEncodeError_SetStartPyUnicodeDecodeError_SetStartPyUnicodeEncodeError_SetEndPyUnicodeDecodeError_SetEndPyUnicodeEncodeError_SetReasonPyUnicodeDecodeError_SetReasonPyUnicodeEncodeError_GetStartPyUnicodeEncodeError_GetEndPyUnicode_DecodeCharmapPyUnicode_AsRawUnicodeEscapeStringPyUnicode_AsUnicodeEscapeString_PyUnicode_DecodeUnicodeEscapeStateful_PyUnicode_EncodeUTF7PyUnicode_DecodeUTF7StatefulPyCodec_IncrementalEncoderPyCodec_IncrementalDecoderPyCodec_ReplaceErrorsPyCodec_IgnoreErrorsPyCodec_UnregisterPyCodec_Decode_PyErr_TrySetFromCausePyDict_GetItem_PyType_GetTextSignatureFromInternalDocPyCallIter_NewPyErr_WarnFormatPyUnicodeEncodeError_GetEncodingPyUnicodeDecodeError_GetEncoding_PyUnicode_IsLinebreak_PyAccu_Accumulate_PyAccu_FinishPyCodec_NameReplaceErrorsPyCodec_XMLCharRefReplaceErrorsPyUnicode_EncodeLocale_PyGen_SetStopIterationValue_PyGen_FetchStopIterationValuePyNumber_InPlaceXorPyDict_Items_Py_c_powatan2sincos_PyUnicode_IsWhitespace_PyUnicode_FastCopyCharacters_PyUnicodeWriter_DeallocPyNumber_InPlaceTrueDividewcsftimetzset_PyTime_ObjectToTime_t_PyTime_gmtimegmtime_r_PyLong_AsTime_tunsetenvmktimePyUnicode_Fillselect_PyTime_AsTimeval_PyTime_ObjectToTimeval_PyLong_DivmodNear_PyTime_GetSystemClock_PyTime_AsTimevalTime_t_PyUnicode_CopyPyUnicode_WriteCharPyDict_SizePyUnicode_AsUnicodeAndSizePyUnicode_FromUnicode_PyUnicode_Ready_Py_GetLocaleconvNumericPyNumber_InPlacePowerPyNumber_InPlaceRshift_PyArg_NoKwnamesPyErr_WarnExplicitObject_Py_duprmdirstrcspn_PyErr_FormatFromCause_PyEval_GetSwitchInterval_PyEval_SetSwitchIntervalPyObject_GenericSetDictPyDict_Merge_Py_CheckRecursiveCallPySequence_GetSlice_PySlice_FromIndices_PyEval_SignalReceivedPyErr_ProgramTextObject_PyErr_ProgramDecodedTextObject_Py_hashtable_get_Py_strhex_PyLong_UnsignedLong_Converter_PyLong_UnsignedLongLong_ConverterPyErr_FormatVmunmapgetrusagetimes_PyTime_FromTimespec_PyUnicode_IsCasedPyCFunction_GetFunction_PyAccu_FinishAsListPy_SetRecursionLimit_PyLong_LshiftPyLong_AsLongLongAndOverflow_PyLong_Rshift_PySequence_IterSearchPySequence_CountPySequence_IndexPyNumber_InPlaceMatrixMultiplyPySequence_InPlaceConcatPyNumber_MatrixMultiplyPyODict_DelItem_PyDict_SizeOfPyObject_NotPyPickleBuffer_GetBufferfstatvfs64PyMemoryView_FromMemory_PyOS_URandom__ctype_toupper_loc_PyUnicode_ToUpperFull_PyTime_FromMillisecondsObject_PyTime_AsMilliseconds_PyFloat_Unpack2_PyFloat_Pack2_PyTime_FromNanosecondsObject_PyTime_AsNanosecondsObject_PyTime_AsTimespec_PyTime_ObjectToTimespecclock_settimepthread_getcpuclockid_PyUnicode_IsCaseIgnorable_PyUnicode_ToFoldedFull_PyTraceback_AddPyCode_NewEmptyPyFrame_New_Py_add_one_to_index_F_Py_add_one_to_index_Cfputsfputcwcstol__sysconfabortgetrlimit64setrlimit64PyBuffer_GetPointerPyBuffer_FillContiguousStridesPyAIter_CheckPyByteArray_SizePyByteArray_AsString_Py_c_sum_Py_c_prodPyExceptionClass_NamePyUnicodeTranslateError_SetStartPyUnicodeTranslateError_SetEndPyFloat_GetMaxPyFloat_GetMinPyODict_New_Py_IncRef_Py_DecRef_Py_BreakPoint_PyObject_IsFreed_PyTrash_deposit_object_PyTrash_destroy_chainPyObject_GET_WEAKREFS_LISTPTRPy_NewRefPy_XNewRefPy_IsPy_IsNonePy_IsTruePy_IsFalse_PyMem_GetAllocatorName_PyMem_GetCurrentAllocatorNamePyMem_SetupDebugHooksPyObject_GetArenaAllocatorPyObject_SetArenaAllocatorfeoffgets_Py_GetAllocatedBlocksPyStructSequence_SetItemPyStructSequence_GetItemPyType_ClearCachePyType_GetFlags_PyUnicode_ToNumeric_PyUnicode_ToTitlecase_PyWeakref_GetWeakrefCountPyEval_ThreadsInitializedPyEval_InitThreads_PyEval_SignalAsyncExcPyEval_EvalFramePyEval_EvalFrameEx_PyEval_SetCoroutineOriginTrackingDepth_PyEval_GetCoroutineOriginTrackingDepth_PyEval_GetAsyncGenFirstiter_PyEval_GetAsyncGenFinalizerPyEval_GetFramePyEval_GetFuncDesc_PyEval_RequestCodeExtraIndexPyCompile_OpcodeStackEffectWithJumpPyCompile_OpcodeStackEffectPyCode_OptimizePyObject_CheckReadBuffer_PyErr_GetExcInfoPyErr_SetExcInfo_Py_hashtable_size_Py_hashtable_steal_Py_hashtable_foreach_Py_hashtable_new_Py_hashtable_clearPyImport_GetMagicTagPyImport_ExtendInittabPyImport_AppendInittabPyStatus_OkPyStatus_ErrorPyStatus_NoMemoryPyStatus_ExitPyStatus_IsErrorPyStatus_IsExitPy_SetStandardStreamEncodingPy_GetArgcArgv_PyDebugAllocatorStats_PyTuple_DebugMallocStats_PyDict_DebugMallocStats_PyList_DebugMallocStats_PyFrame_DebugMallocStats_PyFloat_DebugMallocStats_PyObject_DebugTypeStats_PyObject_DebugMallocStatsPy_GetPathPy_GetPrefixPy_GetExecPrefixPy_GetProgramFullPathPy_GetPythonHomePyPreConfig_InitIsolatedConfig_Py_str_to_int_Py_IsCoreInitializedPy_IsInitializedPy_AtExit_PyInterpreterState_RequiresIDRef_PyInterpreterState_RequireIDRef_PyThreadState_UncheckedGetPyThreadState_GetIDPyInterpreterState_HeadPyInterpreterState_MainPyInterpreterState_Next_PyGILState_GetInterpreterStateUnsafe_PyCrossInterpreterData_NewObject_PyInterpreterState_GetEvalFrameFunc_PyInterpreterState_SetEvalFrameFunc_PyTime_MulDiv_PyTime_FromNanoseconds_PyTime_AsTimeval_noraisePyThread_exit_threadpthread_exit_PyThread_at_fork_reinitPyThread_create_keyPyThread_delete_keyPyThread_delete_key_valuePyThread_set_key_valuePyThread_get_key_valuePyThread_ReInitTLSPyGILState_GetThisThreadStatePyThread_get_stacksizePyThread_set_stacksizePyThread_tss_allocPyThread_tss_freePyOS_mystricmpPyConfig_SetWideStringListPy_PreInitializeFromBytesArgsPy_PreInitializeFromArgsPy_PreInitializePyConfig_SetArgvPyConfig_SetBytesStringPy_EncodeLocale_Py_write_noraise_Py_abspath_Py_closerangeclose_rangePyGC_EnablePyGC_DisablePyGC_IsEnabledPyObject_GC_IsTrackedPyObject_GC_IsFinalized_PyOS_InterruptOccurred_PyOS_ReadlineTStatePyOS_InputHookclearerrPyOS_ReadlinePyOS_ReadlineFunctionPointerPyUnicodeEncodeError_Create_PyUnicodeTranslateError_CreatePyEval_CallFunction_PyObject_GC_CallocPyGen_New_PyEval_SetAsyncGenFinalizer_PyEval_SetAsyncGenFirstiterPyUnicodeTranslateError_SetReason_PyTime_GetPerfCounterPyInterpreterState_GetID_PyInterpreterState_IDInitrefPyCapsule_GetNamePyCapsule_GetDestructorPyCapsule_GetContextPyCapsule_SetNamePyCapsule_SetDestructorPyCapsule_SetContextPyCapsule_SetPointer_PyTime_FromTimevalPy_FatalError_Py_FatalErrorFunc_PyInterpreterState_IDIncrefPyThreadState_SetAsyncExc_PyEval_AddPendingCallPy_AddPendingCallPy_SetPathPyEval_ReleaseLock_Py_FatalError_TstateNULLPyEval_AcquireLockPyEval_ReleaseThread_Py_SetProgramFullPathPy_SetProgramNamePy_SetPythonHome_Py_FatalErrorFormatvfprintfPyThreadState_Delete_PyObject_Dump_PyObject_AssertFailedPyInit_xxsubtypePyInit__symtablePyObject_HasAttrPyArg_VaParsePyArg_Parse_PyArg_ParseStackPyErr_ResourceWarning_PyInterpreterState_LookUpID_PyCrossInterpreterData_ReleasePyContext_ExitPyPickleBuffer_ReleasePyContext_CopyPyInstanceMethod_NewPyInterpreterState_GetDictPyDict_GetItemString_PyErr_BadInternalCall_PyContext_NewHamtForTestsPyContext_CopyCurrentPyContext_NewPySet_PopPyCFunction_GetSelfPyCFunction_GetFlagsPySlice_GetIndices_PyLong_UnsignedInt_Converter_PyLong_Size_t_ConverterPyFunction_GetCodePyFunction_GetGlobalsPyFunction_GetModulePyFunction_GetDefaultsPyFunction_SetDefaultsPyFunction_GetKwDefaultsPyFunction_SetKwDefaultsPyFunction_GetClosurePyFunction_SetAnnotations_PyCode_GetExtra_PyCode_SetExtraPyMethod_FunctionPyMethod_SelfPyInstanceMethod_FunctionPyCell_GetPyContext_EnterPyErr_SetInterruptExPyErr_SetInterrupt_PyErr_FormatFromCauseTstatePyByteArray_FromObjectPyState_RemoveModule_PyEval_SetProfile_PyCrossInterpreterData_Lookup_PyObject_GetCrossInterpreterData_PyObject_CheckCrossInterpreterDataPyObject_AsWriteBuffer_PyErr_SetNonePyContextVar_Reset_PyUnicode_AsUnicode_PyUnicode_WideCharString_Opt_Converter_PyUnicode_WideCharString_ConverterPyUnicode_GetSize_PyUnicodeWriter_PrepareKindInternal_PyUnicodeWriter_WriteLatin1StringPySys_HasWarnOptionsPy_VaBuildValuePyEval_EvalCodeEx_PyObject_NewVarPyUnicode_ResizePyObject_InitVarPyObject_Init_PyDict_DelItemIfPySys_GetXOptionsPyCodec_StreamWriterPyCodec_StreamReaderPyCodec_DecoderPyCodec_EncoderPyCodec_KnownEncodingPyFunction_GetAnnotationsgetppidPySys_AddWarnOptionUnicodePyDict_ValuesPyMarshal_WriteLongToFilePyBuffer_FromContiguousPySys_AddAuditHook_PyEval_CallTracingPyCFunction_Call_PyErr_CheckSignalspausePyEval_CallObjectWithKeywordsPyCFunction_NewExPyCFunction_NewPyFunction_SetClosurePyUnicodeTranslateError_GetObjectPyUnicodeTranslateError_GetStartPyUnicodeTranslateError_GetEndPyUnicodeEncodeError_GetReasonPyUnicodeDecodeError_GetReasonPyUnicodeTranslateError_GetReasonPyObject_CopyDataPyObject_AsReadBufferPyObject_AsCharBufferPyPickleBuffer_FromObjectPyMemoryView_GetContiguousPySlice_GetIndicesExstrsignalstrstralarm_Py_Uid_Converter_Py_Gid_Converter_PyInterpreterID_LookUpPySequence_RepeatPySequence_InPlaceRepeatsigismemberPyObject_GetAIterPySequence_InPySys_ResetWarnOptionsPyObject_LengthPyMapping_LengthPySequence_DelSlicePySequence_SetSlicePyObject_DelItemStringPyFrame_FastToLocalsPySequence_Length_PyArg_ParseTupleAndKeywordsFast_PyArg_ParseTupleAndKeywordsFast_SizeT_PyArg_VaParseTupleAndKeywordsFast_PyArg_VaParseTupleAndKeywordsFast_SizeT_PyArg_ParseStackAndKeywords_SizeTPyUnicode_AsUCS4CopyPyUnicode_CountPyUnicode_FindPyUnicode_DecodeLocaleAndSizeftruncate64getitimersetitimerfdatasyncfsyncsched_setschedulersched_setparamsched_getparamwaitidsetgroups_Py_Sigset_Convertersigaddset_Py_get_inheritable_Py_set_inheritable_async_safe_Py_fstat_Py_get_blocking_Py_set_blockingsigwaitinfosigtimedwaitsigpendingsigwaitgetgroupsgetresgidgetresuidnicegetprioritysetprioritycopy_file_rangespliceumasksched_get_priority_maxsched_get_priority_minsched_getschedulersched_rr_get_intervalsched_yield__sched_cpualloc__sched_cpufreesched_setaffinitysched_getaffinity__sched_cpucountopenptysetuidseteuidsetreuidsetgidsetegidsetregidgetpgidgetsidsetsidsetpgidtcgetpgrptcsetpgrpdup3readvpread64preadv64v2writevpwrite64pwritev64v2sendfile64posix_fallocate64posix_fadvise64setresuidsetresgideventfdeventfd_readeventfd_writePyUnicode_EncodeLatin1PyUnicode_EncodeASCIIPyUnicode_EncodePyUnicode_EncodeDecimalPySys_AddXOptionPySys_AddWarnOptionPySys_SetPathPySys_SetArgvExPySys_SetArgvPyUnicode_TransformDecimalToASCIIsetpwentgetpwentendpwentgetpwuid_rPyErr_SetFromErrnoWithFilenamettyname_rctermidgetloginreadlinkatPyUnicode_RSplitPyUnicode_FromObjectPyUnicode_ReadCharPyUnicode_EncodeUnicodeEscapePyUnicode_EncodeRawUnicodeEscape_Py_DumpExtensionModuleswcsxfrmwcscoll_Py_strhex_bytesPyUnicode_ReplacefpathconfPyEval_GetFuncNamePyModule_GetFilenamebind_textdomain_codesetdcgettextgetgrouplist_Py_UTF8_Edit_CostPyUnicode_EncodeUTF8bindtextdomainmemfd_createchrootmknodatmknodmkfifoatmkfifoinitgroupsgetpwnam_r_Py_statPyUnicode_AsUTF32StringPyUnicode_AsUTF16StringPyArg_VaParseTupleAndKeywords_PyArg_VaParseTupleAndKeywords_SizeTPyObject_PrintferrorPyMapping_HasKeyString_PyInterpreterState_GetMainModulePyMapping_HasKeyPyUnicode_AsCharmapStringPyObject_HasAttrStringPyUnicode_DecodeUnicodeEscapePyBuffer_SizeFromFormatPyMapping_ValuesPySys_WriteStdoutPySys_WriteStderrPySys_FormatStdoutPySys_FormatStderr_PyDictView_Intersectwait4wait3PyImport_ReloadModule_Py_GetConfigsAsDictPyCode_NewPyInit__tracemalloc_PyImport_FindExtensionObjectPyImport_ExecCodeModuleObjectPyImport_ExecCodeModuleWithPathnamesPyImport_ExecCodeModuleExPyImport_ExecCodeModule_PyUnicode_CheckConsistency_PyType_CheckConsistency_PyDict_CheckConsistency_PyObject_CheckConsistencyPy_ExitStatusException_PyArg_VaParse_SizeTPyUnicode_DecodeUTF7PyUnicode_TranslatePyUnicode_TranslateCharmap_PyImport_GetModuleAttr_PyImport_GetModuleAttrString_PyThread_CurrentExceptions_PyThread_CurrentFramesPyInterpreterState_ClearPyOS_AfterFork_ChildPyOS_AfterForkutimensatfutimensposix_spawn_file_actions_initposix_spawn_file_actions_addopenposix_spawn_file_actions_addcloseposix_spawn_file_actions_adddup2posix_spawn_file_actions_destroyposix_spawnattr_initposix_spawnattr_setpgroupposix_spawnattr_setsigmaskposix_spawnattr_setsigdefaultposix_spawnattr_setschedpolicyposix_spawnattr_setschedparamposix_spawnattr_setflagsposix_spawnattr_destroyposix_spawnpposix_spawn_Py_openPyErr_ProgramTextPyErr_SyntaxLocationExPyErr_SyntaxLocationPyErr_RangedSyntaxLocationObjectPyErr_SyntaxLocationObjectPyMarshal_WriteObjectToFilePyFile_SetOpenCodeHookpthread_killforkptyfchownlchownfchownatfgetxattrlgetxattrfsetxattrlsetxattrfremovexattrlremovexattrflistxattrllistxattrsymlinkatsymlinkexecvfexecvekillpglockf64PyFunction_NewPyMarshal_ReadShortFromFilePyMarshal_ReadLongFromFilePyMarshal_ReadObjectFromFilePyMarshal_ReadLastObjectFromFilePyFile_FromFdPyFile_OpenCodePyEval_CallMethodPyUnicode_AsDecodedObjectPyUnicode_AsDecodedUnicodePyUnicode_AsEncodedObjectPyUnicode_AsEncodedUnicodePyUnicode_InternImmortalPyErr_WarnExplicitPyErr_WarnExplicitFormatPy_Finalize_PyErr_PrintPy_InitializeExPy_Initialize_Py_InitializeMain_Py_NewInterpreterPy_EndInterpreter_PyInterpreterState_IDDecref_PyInterpreterID_New_PyInterpreterState_GetIDObjectPyRun_InteractiveOneObjectPyRun_InteractiveOneFlagsPyRun_InteractiveOne_PyRun_InteractiveLoopObjectPyRun_InteractiveLoopFlagsPyRun_InteractiveLoopPyRun_SimpleFileExFlagsPyRun_SimpleFilePyRun_SimpleFileExPyRun_AnyFileExFlagsPyRun_AnyFilePyRun_AnyFileExPyRun_AnyFileFlagsPy_FrozenMainsetbufPyRun_FileExFlagsPyRun_FilePyRun_FileExPyRun_FileFlagsPy_CompileStringExFlagsPy_CompileStringPy_CompileStringFlagsPyRun_SimpleStringPy_MainPyRun_String_PyOS_IsMainThreadPyTraceMalloc_TrackPyTraceMalloc_Untrack_PyTraceMalloc_GetTraceback_PySet_Dummy_PyParser_TokenNameslibm.so.6libc.so.6libpython3.10.so.1.0GLIBC_2.29GLIBC_2.2.5GLIBC_2.14GLIBC_2.6GLIBC_2.28GLIBC_2.3.4GLIBC_2.25GLIBC_2.15GLIBC_2.26GLIBC_2.27GLIBC_2.4GLIBC_2.7GLIBC_2.33GLIBC_2.3GLIBC_2.5GLIBC_2.17GLIBC_2.32GLIBC_2.16GLIBC_2.34GLIBC_2.3.2GLIBC_2.9/opt/alt/python310/lib64:/opt/alt/sqlite/usr/lib64                           ֍0 ui  ii !+ti 6BMXcii nii x ii ii  Žri ͎ii َui  p/ x////*h /@\$/i /@#/Fy /l#/ / l#/ / l#/ / l#P/ X/ / /: /!/Ց /:g / /E /!/ / / /E /!/ / / @/ H/ ]P/V X/O `/h h/Lp/ x/0P / / /' /O / /?9/ /P / /O /R / /R / /R (/ @/2 `/n h/ p/y x/ /1,!/n / / /E /!/ /y / /J /R /Z 0/b @/j P/r `/z p/H /P /X /` /h /p /x / / / / / 0/ @/ P/ `/ p/ / / / / / / / / / / / 0/ @/ P/ `/ p/ / /1 /' /= / / / / / /# /- 0/9 @/C P/N `/V p/] /d /# /d / /F-!/5 /v / /d / 0/d 8/ `/d h/. p/ /p /E /!/p /E /!/ / / /.| / / /.| (/ 0/ @/.| H/ `/.| h/ p/ / /.| /J / /.| /J /.| / / /.| / / /.| / / /\ (/ 0/u 8/ @/N H/$ `/4 p/@ /N /X /e /o /z / / / / / / 0/ @/N!H/ `/N!p/<!x/ / / / / /1,!/1,!/1,!/ /1,!(/)w 0/ @/1,!H/)w P/ X/ `/ /1,!/)w / /1,!/ /1,!/ / / / / / 0/ @/N!P/N!`/N!p/1,!x/'!/1,!/ / /t!/1,!/ /t!/N! /D!(/K!0/$ 8/J `/N!h/Q!p/!/N!/N!/1,!/ / /t!/ / / /{ /{ / 0/U!@/U!`/ h/ p/ /1,!/ / / /1,!/" / /t!/ /1,!/t!/1,!/t!0/ @/!H/!P/\!X/t!p/1,!x/t!/!/!/p!/{!/!/!/p!/{! 0!(0!00J 80!@0!H0 `0!h0!p0J x0!0!01,!0t!0 0 0 0!0!0!0!0!0!0T 0 (0 00 80!@0!H0!P0!X0!`0!h0T 0!0!0 0!0!01,!0 0t!01,!0t!01,! 0!(0!00p!80{!@0 P01,!`01,!h0 p0 0N!0 0 01,!0 0 0t!0 0N!0 01,!0 0t!0 001,!@01,!H0 P0t!X0!`0 01,!0t!0 0!0!000 !0!0#!0@01!0=!0P0K! 0X!(0`00g!@0v!H0 P0!`0!p0!x0p0!0!0!00!0!0!0!0 !00!00'!0 04!(000@!80Ў@0P!H0P0^!X0`0m!h0p0{!x00Z 0Z 0@"0!0!0!0!0!0 0 0 00#@0 H0 P0 X0 p0!0$!0 0 0!0`!0!0m!0v!0~!0!0!0F 0!0!0!0!0!0! 0 (0!00!80!@0!H0!P0#!X0(!`00!h08!p0F!x0P!0U!0^!0*h 0i 0 0k!0q!0z!0Sh 0 0!0c 0!0!0!0!0!0!0!0! 0( (0!00!80!@0!H0!P0 !X0!`0!h0#!p0*!x02!0;!0A!0I!0O!0, 0W!0e!0m!0/ 0v!0E 0{!0!0 0!0G 0(  0! 0! 0 0!( 0ز 0 0 8 0!@ 0!H 0!P 0!X 0!` 0!h 0!p 0i x 0! 0! 0n! 0! 0 0! 0! 0! 0 ! 0! 0w! 0)! 0! 0! 0%! 0.! 02! 08! 0>! 0D! 0u 0G ( 0H!0 0 8 0O!@ 0X!H 0c!P 0n!X 0{!` 0!h 0K p 0!x 0! 0$! 0)! 01! 0! 0G! 0Q! 0V! 0! 0! 0! 0! 0! 0 0! 0! 0y 0x  0! 0! 0! 0!( 0!0 0!8 0 @ 0ʢ H 0!P 0 !X 0!` 0$ h 0!p 0!x 0! 0'! 0r! 0{! 0,! 01! 06! 0;! 0C! 0K! 0Th 0 0 0 0R! 0 0! 0  0\! 0d! 05` 0n!( 0!0 0v!8 0~!@ 0!H 0?!P 0!X 0!` 0!h 0!p 0!x 0! 0! 0! 0! 0 0! 0! 0! 0q 0 0! 0 0! 0! 0! 0! 0! 0 ! 0! 0f  0! 0 !( 0!0 0'!8 01!@ 0}!H 08!P 0` X 0!` 0?!h 0J!p 0Q!x 0W! 0b! 0$! 0j! 0+! 0 0 0q! 00 0y! 0 0! 0! 0! 0 0! 0!0!0{ 0!0! 0!(0!00f!80!@0!H0n!P0!X0!`0!h0w!p0F x0|!0.| 0!0!0!0!0 0T!0 !0!0!0$!0,!06!0?!0G!0P!0U!0 0_!0! 0 (0f!00{)!80$ @0x H0V} P0o!X0v!`0s h0 p0V x0!0!0!0!0!04f 0!0/ 0!0!0!0!0!0!0!0!0!0Fy 0!0! 0_ (0!00 80!@0!H0!P0!X0q `0 h0z p0 x0z 0~e 0Ff 01,!0 0T!0P!0;!00!0!!0y 0g 0g 0 0# 0! 0=(0?0080&@0H0P0X0=`0=h0Ȼp0x00d0=0=000B0=000=000Y0000000 0(0n0080=@0=H0=P0=X0=`0=h0=p0=x0=0=0=0=0=0=00b:0;0;0=0F0P0t00=0000K02 0(00080@0H0*P0X0`0h05p0x0d000*00=0=0=0000000=0!0#00000  0(000#780*@0*H0P0X0`0h0Hp0_x00V0 0"0ڶ050Т00900K00l0=0}00=000O0= 0=(00080@0SH0P0=X08`0h0<p0x0=0=0{000|0010A00=0=0=00=0@Q000t0=0= 0(0K00S80@0pH0P0=X0=`0=h0=p0=x0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0= 0=(0=00=80=@0=H0=P0=X0=`0=h0=p0=x0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0= 0=(0=00=80=@0=H0=P0=X0=`0=h0=p0=x0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0= 0 (0F-!@0 H0!`0&!h0V-!p0n x0M} 0!0)!0 0!0y,!0 0 0!0!0!0 0g 0g 0,!(0Zg 00 @0\ H0 P0 `0- h0 p0ҋ x0܋ 0&'!0 0! 0 0 0 0,!0i 0t 0e 0\ 0 0 01 0 0,!(0i 00t 80e @0 H0 `0,!h0i p0t x0e 0,p 0 0,!0i 0t 0e 0,p 0| 0J 0 0 0d 0 0 0̋ 0Ë 0%!(0 00 @0,!H0i P0t X0e `0# h0!p0 x0 0 0!05 0` 0I 0` 0I 0 0I 0 0I 0 0? 0I 0 09 0I 0 (0 o 00='!@0 H0> P0 `0. h0 p0 0F 0 0m 0 0 0 0\ 0 0# 0 0 0\ 0 0\ 0 0` 0&'!0='! 0!(0 00 @0 H0 P0L!X0 `0F h0L!p0f 0# 0 0L!0='!0,!0i 0t 0e 0 0g 0g 0wx 0g 03 0g 0!0,! 0 (0C 00 80 @0 H0+!P0: X0' `01'!h0 p0J 01'!0 0J 0!0 0 0!0 0 0# 0!0 0 0J 0# ( 0!0 0 8 0 @ 0J ` 0# h 0| p 0 x 0. 0# 0L! 0 0B 0 0J 0B 0 0 0! 0 0 !0M !0 (!0 0!0 8!0M @!0& H!0J `!0 h!0 p!0 x!0M !0& !0J !0,!!0i !0t !0e !0 !0& !0 !0 !0 !0W "0",!"0n!"0w!"0!@"0J H"0E P"0!`"0Z !p"0c !"0&!"0 "0&!"0 "0E "0!"0 "0 "0 #0= #0{ #0o (#0y 0#0&!8#0 @#0ϯ H#0? P#0 X#0S!p#0J #0 #0~&!#0&!#0&!#0+g #0# #0'!#0'!$0# $0 $0# ($0 @$0d H$0 `$0 h$0!$0 $0'g $0(!$0'!$0'g $0(!$0# $0p $0u $0{ $0 $0W)!%0_)! %0 (%0N!0%0?!8%09!@%0 H%0 P%0 X%0 p%0d x%0F-!%0` %0K0!%0!%0P0!%0S!%0'!%0=!&00!&00!&01!&01! &0 1!(&0-1!0&0}1!8&061!@&0>1!H&0H1!P&0Q1!X&0]1!`&0i1!h&0> p&0u1!x&01!&0!&0E &0!&0 &0<!&0Z !&0&!&0 '0&!'0 0'0&!8'0&!P'0c !`'0E h'0!'0!'0E '0!'0 '0<!'0Z !'0&!'0 '0&!'0 (0&!(0&!0(0c !@(0E H(0!`(082!h(0B2!p(0 x(0G2!(0N2!(0V2!(0]2!(0d2!(0i2!(0n2!(0s2!(0x2!(0~2!(02!(02!(02!(03!(03!(02!(02!)02!)02!)03!)0 )02!()02!0)02!8)02!@)02!H)02!P)02!X)02!`)02!h)02!p)03!x)03!)03!)0%3!)03!)03!)0.3!)0;3!)0F3!)0P3!)0`3!)0o3!)03!)03!)03!)0.!)03!)03!*03!*03!*0> *0Q *0~ (*03!0*03!8*03!@*03!H*04!P*0 4!X*04!`*04!h*0&p*0 *0`B0/B0 B04 B0h"B0 B0;B0 C0 C0`;C0 C0 (C0" 8C0 @C0 HC0" XC0 C0 C0h"C0 C09;C0 D0 D0:D0 HD0e`D0 hD0D0 D0$D0`D0D0@D08E0! F0B0F0B0HF0< F04 G0C0G0C0G0< hH0 xH0 H0 H0bH0 $I0G I0H0(I0`H0`I0Q hI03D xI0@$I0\ I0 I0$I0i I0U I0$I0u I0D3 I0$I0F-!I0ƶ I0$J0 J0 J0$ J0 (J04 8J0$@J0 HJ0k4 XJ0$`J0 hJ0$ xJ0`$J0 J0 J0$J0 J0$K0`I0HK0`K0 hK0КxK0"K0 K0A K0"K0 K0CD K0"K0 K0|K0@"K0 K0@K0"L0 L0PLL0" L0= (L08L0"@L0 HL0:<XL0"`L0 hL0O5 xL0@"L0 L0;L0"L0 L0 L0"L00 L0B< L0"L09 L05 L0@"M0A M0 M0h"hM0x pM0 $M0`K0M0@K0M0M0n M0Q M0 M0n M0Q M0 N0n N0Q @N0| HN0 PN0n XN0 pN0 N0M} N0F} N0~e N0] xO0g (P0{ P0 Q0 @R0 HR0hR0Z} pR0wR0 R0 R0+!R0R0@$S0 S00S0$ S0!(S0i8S0 $@S0 HS0CXS0$`S0} hS0A xS0`$S0* S0`S0$S0 S0@S0@$S0!S0lS0$S0} S0 S0@$T0\ T0 T0$ T0w (T0 8T0$@T0 HT0B`T0 hT0DT0P/T0 T0 U0`kU0$U0iU0& U0CU0R0U0@R0V0PdV0 dV0E V0PM V0$V0Z} V0S V0`$V0!V0S V0$ W0 (W0  8W0`$@W0!HW0PU XW0$`W0 hW0 xW0`$W0!W0 W0$W0 pX0 $X0 W0X0V0X0[2`Y0Z} hY0g% Y0 Y0 Y0@$Y0 Y0Y0 $Z0 Z0#Z0$ Z0} (Z08Z0$`Z0 hZ0yZ0 Z0Z0Z} Z0AKZ0!Z0[0 [0@ [0h `[0E [0 [0 [0 \0;!`\0 h\0L x\0`$\0. \0,\0$\0!\0-\0P$\0!\0\00$\0 \0P\0$]0M} ]0]0$ ]0+!(]08]0$@]0F} H]0X]0$`]0} h]0x]0p$]0\ ]0]0P$]0w ]0]00$]0S} ]0^]0$]0 ]0;]0$^0} ^00^0$ ^0* (^068^0$h^0/p^0 ^0!^0!^0 ^0} ^0 ^0} _0+!_0M} _0D H_0/P_0i _0R _0/_0. _0 _0 `0 `0F} `0} 0`0\ @`0w P`0S} h`0/p`0d `0Yb `0 `0 `0$`0!`0$`0`$a0h} a0 a0$ a0v} (a0+&8a0$@a0& Ha0o%Xa0@$`a0!ha0 xa0@$a0~ Pb0$b0`0b0[2@c0 Hc0hc0 pc0c0 c0Dzc0R d0;!`d0 hd0PP d0M} d0d0+!d0@d0} d00d0\ d0Pe0F} e0p e0S} (e0 @e0D He0@`e0!he0`xe0$e0c} e0 e0$e0h} e0e0$e0v} e0 e0$e0& e0e0@$f0 f0Pf0$ f0 (f08f0 $@f0} Hf0`f0* hf0 xf0$f0 f0@ f0 f0f0 f0g0 g0Dz`g0R g0;!g0+!g0@h0 h0PP h0} (h00@h0w Hh0P`h0F} hh0ph0S} h0 h0D h0@h0!h0Jh0$h0* h0 h0$i0M} i0 i0 (i08i0 $@i0} Hi0`i0 hi0@ i0 i0ܡj0!j0d| j0c} (j0Q|@j0h} Hj0>|`j0v} hj0+|j0& j0|j0!j0|j0M} j0{j0\ j0{k0w k0{ k0+!(k0>{@k0S} Hk0zk0 k0k0 k0k0 k0Dz l0R Hl0;!l0+!l0@l0 l0PP l0} l00m0\ m0P m0w (m0P@m0F} Hm0p`m0S} hm0 m0D m0@m0M} m0m0 m0m0 $m0} m0n0* n0 n0$ n0!(n0`8n0$@n0h} Hn0Xn0$`n0v} hn0 xn0$n0& n0n0@$n0 n0Pn0$n0c} n0 n0$n0!n0Jn0$o0 o0@ @o0c} Po0v} `o0& po0!o0M} o0\ o0w o0+!o0S} o0/o0 (p0 /0p0 `p0 pp0D p0 p0/p0 p0!p0h} q0 q0 q0 `q0\ hq0 xq0 %q0} q0@ q0 %q0w q0 q0` %q0+!q0 q0 %q0M} q00M q0%r0S} r0" r0`% r0} (r0p8r0 %@r0!Hr0Xr0%`r0 hr0cxr0%r0h} r0h r0 %r0v} r0r0`%r0 r0r0`%r0Y r0r0@%s0!s0s0% s0 (s0 8s0 %@s0 Hs0cXs0%`s0 hs0Qxs0%s0* s0 s0$s0 s0s0 s0s0 s0y@ t0@ (t0 Ht0@/Pt0* t0@ t0 u0 t08u00 v0!(v02 8v0%@v0n} Hv0@Xv0 %`v0v} hv0@"xv0%v0!v0`v0%v0 v0v0%v0} v0Pv0`%v0* v02 v0`%w0+!w0w0% w0} (w08w0%@w0\ Hw0PXw0@%`w0w hw0 xw0%w0F} w0w0%w0S} w0w0@%w0D w0x0 x0x0^ (x0y 0x0OD @x0"Px0 Xx0 hx0 x0 x0;! y0+!Hy0`/Py0W y0 y0 y00 y0%y0} y0&y0`%y0* y0$ y0%z0M} z0Pz0@% z0+!(z0@8z0%@z0} Hz0P Xz0%`z0\ hz0@xz0%z0w z0 z0%z0 z0Kz0 z0 z0 z0{0 {00 {0F} ({0Q 8{0`%@{0S} H{0KX{0%`{0 h{0{0 {0{0 {0'{0%{0Y {0p{0%{0 {0p;{0% |0!(|08|0p%%@|0n} H|0)X|0 %%`|0v} h|0 |0!|0 |0 p}0%%}0 |0}0[2`~0n} p~0!~0 ~0 ~0 ~0;!~0\x ~0~0`(%~0B!~0@~0&%0 00%%h0 p0@A%0~00 0p00/0\x 0+!0 0 00S} H0/P0 0`0> 000L%0 Ȁ0`؀0K%0 00@K%0 0V0J% 0' (0) 80@J%@0$ H0'X0I%`0, h0%x0`I%0" 0$0H%0F 0#0`H%0B ȁ0+؁0H%0 0"0G%03 0 0 G%h0c p0pL%00000000w 0g (0p_80 N%@0| H0p_X0 N%`0t h0bx0 M%0 0b0 M%0 00L%0J ȃ0؃0L%0 0p_0 N%0 0b0 M% 0 (0 h0rx0t 0O%0 00 e000w @0| H0X0T%`0 h0 x0R%0 00R%0 000 R%0 ȅ0؅0Q%0 00T%0 0 0R% 0 (0B `0w Ȇ0M؆0 0`00w h0Lx0 00 0"0Lȇ0؇000 0 0 0 0 (0 00 80. `0e h0x0c%05 00c%0? 0\0 c%0$ Ȉ0\؈0 c%0M 0 0`b%0 0 0`b% 0Y (0^=80a%@0h H0P_X0 _%`0r h0`x0`^%0!0S0\%0 0<0X%0 ȉ0؉0W%0 00W%(01@0~e P0M} `0 p0 0 0/ Ȋ0( Њ0e%0`00 00e0@0` 0 (0 W%000@0 X0`0`0 x000 0@]20 0`00 ȋ0 Ћ0& ؋0- 0J 0R 0n 0v 0 0 0 0 0 (0"00 80 @0 H0"P0 X0 `0# h0- 0 0 0 0|%0 Ȍ0 ،0@|%0 0 6 0{%0H 0 0{% 0 (06 80 {%@0Y H0=X0z%`0 h0{ x0@z%0] 0 0y%0j 00@y%0 ȍ0@؍0w%0 00v%0 04 0u% 0 (080t%@0p H0X0s%`0# h0px0o%0 05 0 l%0w 0P0i%0 Ȏ0؎0i%0} 0= 0 i%0 0@T0h% 0 (0I 80@h%@0+ H09 X0g%`0 h0r x0`g%0 0y0 g%0 0 : 0f%0 ȏ07 ؏0`f%(0 00@}%@00H00p0 0 0H"0000 Ȑ0@ؐ0@%0 0u 0%0 0@ 0% 0 (0@80 %@0 H0 X0%`0 h0x0`%0 0 0 %0 0 0%0 ȑ0 ؑ0%0% 0 0@%0- 03 0% 05 (0y3 80%@0< H0 X0@%0E 0%00Ȓ000K 0T 0b 0j 0v (0"00 80 @0 H0"P0 X0 `0 h0 0F0| 0 0%0 ȓ0Zn ؓ0%0G 0 0`%0 0Z 0% 0{ (0y 80%@0 H0 X0 %`0 h0m x0@%0 0Zm 0%0 0?0%0 Ȕ0> ؔ0%0 0[ 0%0" 02 0 % 0L (0Z80%@0 H0 X0@%`0 h03 x0%0 0x 0%0( 0 0%0 ȕ0 ؕ0 %04 0 0`% 0B (0`%000h0, p0%000000`00 0X 0= 00%0 0@ 0 % 0 (0C 80%@0l H0X0%`0{ h0[@ x0%ȗ0 З0%00 0 (0r80`%@0 H0rX0 %0 0`r0`%0 Ș0|ؘ0`%0 00% 0 (0{80`%@0 H0}X0 %0 0p0`%0 0p0 %0 0q0`%0 0q0 %@0 H0qX0`%`0 h0qx0 %0 0s0`%0 Ț0Ptؚ0 %0 0`{0`%@0 H0zX0`%`0 h00yx0 %0 00%0 ț0f؛0`%0 0`g0 %0 000%@0 H0fX0`%`0 h0@kx0 %0 0@0%0 Ȝ0v؜0`%0 0w0 %0 0`0%@0 H0aX0`%`0 h0cx0 %0 0 n0`%0 00n0`% 0 (0o80`%`0 h0zx0@%0 00{0`%0 Ȟ0}؞0`%0 00~0 %(0p@0M H0X0%0 0%0@0ȟ0 00 0 0!(00/00 h0/p0 0/0J 0 0/0 @0J H0" h0/p0n 0`/0 0/0 (0 %80VH0X0@ h00N0 0pI0%0 Ȣ0Oآ0%0 0|0%0 0w|0@% 0 (0}80@%@0 H0\X0%`0 h0p>x0%04 0Pa0`%0!0 %000000 000v @0 P0 `0 p0 0 0 0} 0@0 0* 0 00w 0! 0`"`0h0Op0 x00| 0 0H 0h 00 0R@ 0%0 0# 0%@0 `0"00 0 (0h00 0]0%0 0 %000`000 @0L0!P0 `01'!0 0ت0Щ80@0h0 0p000 00P 0 (080%`0 h0x0%0 0@0%0 0 0`0% 0: (0P80@%@0 H0`X0%`0} h0x0%0 00`%0 0`0 %0 ȭ0`ح0%0 0PI0%0 0 0`% 0 (0`a80 %@0 H0X0%`0 h0px0%0 0P0`%0 00 %0 Ȯ0 خ0%0 000%0!0`0`% 0 (0 80 %@0 H0PX0%`0 h0Цx0%0 0@0`%0# 0W 0 %09 ȯ0د0%0 00%05 00`% 0 (0s 80 %@0 H0r X0%`0 h0`x0%0 0 0`%0 0 0 %0 Ȱ0 ذ0%0 0S 0%0 0 0`% 0 (0: 80 %@0 H0 X0%`0 h0 x0%0 0 0`%0 000%0 ȱ0 ر0%0 0@0`%0 00 % 0 (0080%@0 H0X0%`0 h0 x0`%0e 00 %0 00%0] Ȳ0дز0%0 000`%02 00 % 0ִ (0@80%@0 H0>X0 %`0 h0p~x0%ȳ0( г0%00000@00ж0 02 802@0H X0@2`0\ x020. 0"0 ȴ0 "д0 0P"0w 0w H0w 0p 0"0@ 0w H0w 0t 0A0 ȶ00 0B0 0A 0 (0Ah0@x0`0%0000ȷ0 0ط0`200 03 (0G80 %@0߰ H0wX0%000 000 ظ020 0`00 02 0 (0f 00 80 0 0%0 0000@00й0p 0$ 0< 0* (0t= 80%@0 H00 X0%`0: h0C x0%05!080%0 0"0 000@0= H0:X0%`0 h0\x0 %0} 060%0U 00%0 Ȼ0_ػ0 %0 00%0 0`0% 0* (0D80`%@0 H0@)X0 %`0 h0Cx0%0۾ 0P?0%0 0B0`%0 ȼ0Pؼ0 %0g 0P0%0 0<0% 0 (080@%@0ʾ H0>X0%`0U h0Ox0%0Կ 0PT0@%0x 000%0 Ƚ0ؽ0%0 00%0 0W0 % 0 (0PY80%@0 H0VX0`%`0 h00Bx0 %0 00;0%0 0pA0%0 Ⱦ09ؾ0 %0) 0`0%0 0p80% 0 (0@80`%@0 H0X0 %`0 h00x0%0 0P70%0 0`0@%0 ȿ0 ؿ0%0 00%0 080%h0F 0@00i30/0U 0/0 @0N H06X0"0\ 0"0 0Y 0 0H"0w 00$ 0 60&0`02000@00`!00@0 H0@& X0x"h0 p0`& 0"0 0 0.| 0"0 (0"00 P00"X0 x0"0 0P) 0&0`2000@0(080` H0@) `0\ 0w 0* 0&0 0 0&(0800H0`0X0h0@@ 0!0`0@&0 0^5 0&0 00&0 0j0&0 00`& 0 (0@k80 &h0 }0/ 000`00d00P0/0w H0/P0s 0/0 0`/0 0@/0C !H0/P0 0/0} 0 /0 0/0 H0/P0 0/0 0 /0!0/0G @0 X0 0`0 x000 000 0 0 0 0 0 0 0 0 0 0 0 0) 02 0@ (0 80 &@0y H06X0 &`0I h0u x0 &0> 0!0 &0 00000pL 0 @0R H0&P00h0`0y 0` &0 i30`00 0d 0t 0{ 0 (0 00 80 @0 H0 P0 X0 `0 h0 x0 0"0 03 0 0< 0E 0_ 0 0h 0"0t 0"0 0H"0 0 0 0 0 (0 @0 P0 `0 p0 0! 0* 02 0: 0C 0J 0T 0 0 0K 00 @0b `0[ h0c p0y x0p"0 0 0 0 0 0 0 0 0 0 0u 0 0 0 01 0A 0Y (0"@0a H0"P0)!X0"0 0@"01,!0"00 (02800`0 h00 0P0+!0U 0r0F 0P0@& 0 (0n 80&@0 H0 X0@&`0' h0x0 &0 00<0@&0 00&0q 00`&0 00&0 0 0& 0Q (0[/80&@0 H0OX0@&`0 h0Ox0&0 0b 0&0 0b 0&0 00 &0 00@&0h 0y0& 0 (0: 80&@0 H0 X0&`0 h0g x0@&0 0%0&0 00&0e 0%40`&0 0M 0&0 0\ 0@& 0 (0?80`&@0!H0X0`&`0 h0P8x0&0 0<0`&0u 00&0 0 0&0 0P0~&0 0P0`}& 0 (080|&@0 H0X0v&`0" h0 x0u&0 0d 0`u&0 00t&0 0e0s&09 00 s&0!0p0p& 0!(0 80p&@0)!H0c X0 p&`0| h0 x0@o&0K 0 0n&0` 0B 0m&0k 0 0m&0U 0 0 l&0@!0 0k& 0y (0 80 k&@0 H0H X0`j&`0L!h0 x0i&0\ 0@0h&0T!00@h&0\!00g&0d!00g&05 0'0f& 0k!(0Q 80f&@0u!H0X0@f&`0!h0w5 x0f&0|!0h5 0 e&0!00d&0!00d&0 0u0`d&0 00d& 0!(0h 80c&@0!H0 X0`c&`0 h0 x0c&0!0 0b&0!0 0`b&0 0 0b&0!0 0a&0n 0O60`& 0!(0 80@`&@0 H0 X0_&`0 h0 x0@_&0!00^&0!0T0]&0 0 0 \&0} 0p0@[&0!0= 0Z& 0 (0 80 Z&@0!H0 X0Y&`0 h0 x0Y&0!0l 0Y&0 0 0X&0\x 00V&0+!0n0V&0 0o 0 V& 0!(0 80@U&@0!H0 X0T&`0!h0 x0T&0! 0|0`S&0 0 0R&0!0po0 R&0 0 0P&0 0 0`O& 0 (0e 80L&@0!H0pyX0@L&`0 h0 x0`K&0 0k 0@J&0 0 0@G&0!0f 0F&0!050 F&0S} 0eo 0`E& 0!(0l80D&@0!H0 X0C&`0^ h0g2x0`B&0X 0e00`?&0!04 0?&0 !03 0>&0 0n 0 >&03 00=& 0* (080<&@0 H0h X0;&`0- h0U x09&00 00 9&0 0@08&0U,!0s 08&0!0z07&0!0 07& 0 (0 80`7&@0!H0= X07&`0)!h0n x06&03!0 05&0@!00p0@5&0K!0a 04&0W!0 0@4&0a!0h 03& 0m!(0 80`3&@0v!H0u X02&`0!h0% x0`2&0!0P 0@1&0!0P00&0!0} 00&0 00/&0 0-0.& 0!(0: 80-&@0!H0X0,&`0d h0 x0`,&0; 0h 0+&0E 0 0`+&0!0 0*&0!0V 0`*&0z 0m0(& 0 (080@'&@0 H0X0%&`0 h04x0$&0 00!&0!0c 0 &0!0 0` &0 0 0&0!0 0@& 0 (0E 80&@0˵ H0X0@&`0!h0x0 &0!0 0&0!0,0&0!0 0&0 !0 0&0!0L 0& 0%!(080`&0!0&00000p000/0!(0 000 h00p0 000q 000 (0`000 h00p0F 000 0/0!(0/00i h0/p0p 0/0F 0`/0! 0!(0&00`0@0 H0&P00`0!x000!020!0&0@00 0&000؃ 0&0@00Ƀ 0`&00 0 (0 &000H0@0P0 000 0 00 000h H0/P0 0/0!0p/0 0/0 H0/P0 0/0 000e 0@/0 H0/P0\x 0/0^ 0/0X 0/0z H0@/P0 0 /0 0/0 0000' H00P0 0P00Q 000 000 H0`0P0 0 00 00/0u 0/0 H0/P0 0@/0!00/0)!0!0 /H0/P0!0!0/0!0/0/0!H0`/P0!0 /0!0p/0* 0/0!H0/P0 000 0/0+!0/0˵ H0`/P0!0 0/0!0P/0!(0@/00!h0/p0!0p/0!0`/0 !(0@/00!h00/p03!0 /0@!0/0K!(0/00W!h0/p0a!0/0m!0/0v!(00/00%!`0!p0!0!0!0+!09!0G!0V!0b!0k!0x!0! 0!00!@0!P0!`0!p0!0!0!0!0%!0;!0G!0S!0_!0l!0w! 0!00!@0!P0!`0!p0!0!0!0!0!0"!0.!0@!0L!0\!0j! 0u!00!@0!P0!`0!p0!0!0!0!0!0!0!0)!0=!0Q!0Z! 0f!00r!@0!P0!`0!p0!0!0!0!0!0!0 !0 !0# !1. !16 ! 1H !01_ !@1s !P1 !`1 !p1 !1 !1 !1 !1 !1 !1 !1 !1 !1 !10 ! 1= !01K !@1^ !P1i !`1 !p1"1 !1 !1 !1 !1 !1 !1, !1@ !1V !1` ! 1m !01} !@1 !P1 !`1 !p1 !1 !1 !1 !1 !1 !1 !1 !1, !1A !1P ! 1b !01r !@1 !P1 !`1 !p1 !1 !1 !1 !1 !1 !1 !17 !1G !1X !1f ! 1y !01 !@1 !P1 !`1 !p1 !1 !1 !1 !1)!1E!1b!1"1|!1!1! 1!01!@1!P1!`1 "19!1E!1Y!1i!1u!1!1!1!1!1! 1!01!@1!P1!`1!p1!1!1-!1B!1T!1 /1 1V 1 (1 81&@1 H1ı X1`&`1c!h1 x1&1m!1Lp 1&1w!16 1&1!15% 1 &1 1J?1&1!1% 1 & 1!(181&@1D H1X1&`1!h1EP x1@&1!1k1&1!1> 1 &1 11&1 1c1`& 1! 1=  1 & 1!( 1= 8 1&@ 1!H 1%= X 1 & 1ʢ 1& 1 1 11 10 1!H 10P 1D 11,! 1v3 1# 1 1 1` 1 ( 1 P 1 1! 1 $ 1+! 1i 1\x  11,!( 1@00 1v ` 1 h 1h"p 1ʉ x 1" 1 1" 1 ! 1& 1` 1 1! 1" 1%! 1" 1/! 1 " 15! 1P" 1 ( 1"0 1 8 1"@ 1=!H 1"P 1h!X 18"` 1B!h 1x"p 1L!x 1V! 1r! 1" 1( 1y! 1 1|! 1 1|! 1! 1! 1{{ 1! 1! 1!1!1!1!1! 12 (1!01 81!@1: H1!P1!X1!`1 h1!p1+ x1!1 1!1!1!1!1!1!1&!1 !1;!1P!1V!1k!1"1x!1! 1e (1% 81@&@1!H1X1&`1 h1x1&1!1vM 1 &11 11`&1 11&1 p 11 &1!1`1@& 1 (181&@1 H1X1`&`1!h1 x1&1!19 1@&1!1= 1&1!1@1`&1!1p1&1!1 1& 1'!(1%81&@1 H1p7X1&`1 h1PVx1&1& 101&19!1 1&1G!1@1&1Y!1@1`&1k!1p 1`& 1 (1i 81&@1z!H1> X1 &`1!h1x1 &1 11&1!11&1 1Y 1&1!1 1 &1"1 1& 1 "(1V6 81`&@1!H1|@X1&`1!h1Q x1@&1Ҧ 1' 1&1!1x7 1&1!1P1&1!1p1& 11,!h1T!p1@&1 11J 1 1 101e 1*!@1!H1&P1 1`17!h1&p1 11A!1&111R!1&1 11~e 1 1"!1)!1 1E 1!H10P1"1!1%!1p01!1q{ 1{ 1 (1 P1!x1T1!1P 1 !1%!1,!p1 1!!10!1;!1u 1)!1 1-!1,!1E!1t 1$ 01,!@1 P1y,!`1,!p1P!1T!1E 1 1=f 1 1M} 1~e 1X!1`!1Z! 1M} 01 @1g!P1U!`1~e p1 1 1 1i 1S} 1 1R 1\x 1@1q!(1r@1 H1X1 '`1tn h1W-x1 '1a 1\1'1fn 11'1!1 ' 1@1(1 1P1!`1!p1v} 1!1&1{!1p14'1!1_D 1`3'1g 1[1`2' 1t (1^811'@1| H1cX11'`1| h1bx1 1'1!1110'1 1,10'1ew 1010'1[w 1@01/'1 171@/' 1!(1N81.'@1!H1p1X1.'`19 h10&x1-'1 1 1-'1Sh 14'111101!@1!P1 `1z p1 1!1!1!1!101 1! 1Rn 1A 0 1ó @ 1'!P 10!` 1 2p 1z 16 1y 1 1L0! 1. 1<! 1 !11'!!1 !1&'!(!1 @!1='!H!1 !16 !1# !1 "1 "1 "1 "1 "1 ("1 0"1}!8"1!@"1J H"1!`"1-!p"1,!"1,!"1y,!"1E!"1t "1$ "1,!"1Ҧ #1!#16'#1"1 #1~e 0#1M} @#1)!P#1 `#1L0!h#1T x#1@9'#11'!#10 #18'#1&'!#1$ #1@8'#1='!#1G #17'#1K #1 #17'$1!$1 @$1> H$1  $1 $1 %1!(%15 H%1!P%1x. %1 %1 %1 %1} %1#!%1-!&1>! &1Yb (&1P!0&1@&1H"H&1ِ P&1^!X&1[h&1"p&1!x&1!&1Z&1"&1 &1l!&1&1`"&1t &1!&1-&1"&1!&1!&1'1h"'1n '1n '1p8'1Q @'1Q H'13`'1 p'1 '1!'1!'1z '1!'1F+!'1 p '1 '1L0!(1'!(1A (1 0(1o @(1 `(1 h(1qx(1A'(1 (1t(1A'(1 (1p{(1A')1 )1E )1@A'@)1!H)1X)1 o'`)1 h)1ix)1k')1!)1`)1@k')1̎ )1&)1j')1 )10)1j')1 )15)1h'*1!*1P*1 h' *1' (*18*1`g'@*1 H*10X*1f'`*1!h*10x*1 f'*1!*1*1b'*16 *1 |*1@b'*1l *1*1_'*1 *1*1`_'+1 +10+1]' +1 (+1@e8+1@\'@+1 H+1X+1`['`+1t h+10nx+1`Z'+1{ +1+1Y'+1}t +1m+1X'+1 +1+1X'+1 +1+1W',1 ,1@y,1V' ,1Ց (,1 8,1`U'@,1u H,1X,1 T'`,1| h,1@*x,1S',1!,1,1R',1!,1x ,1Q',1z ,10-,1@Q',1i)!,1@,1 P'-1 -1u-1N' -1 (-18-1M'@-1 H-1p[X-1L'`-1U h-1 x-1`L'-1!-1Љ-1K'-1 -1`-1K'-1 -13-1J'-1O!-1(-1H'.1 .1P.1@H' .1!(.18.1@G'@.1t H.1@X.1F'`.1 h.1x.1E'.1!.1.1`D'.1 .1Z.1C'/1)!/1o' /1@)1P/1Uj h/1@0p/1!/1 /1#!/1/!/19!/1# /1 01 01{ 01i)!01! 013 H010P01!01z 01!01E 01F} 01~e 01 01001 11M} 011 @11I!H11`011 011!11 11Yb 11 11]9 21w 21\21!2121 31U!831`2H31<`31M h31вx31`p'31 31NA31 p'31]!31P41ز 41q' 41`31(41@31P41!h41"0p41M 41",!41n!41y,!41,!41wx 41 41!41!41w 51w 51 51!051z @51!P51!`51~e p51w 51x 514f 51A 51!51ِ 51 51!@61!H61`61c h6161@;61lG61 61@;61 710 (71 0712 871 @71 H71T P71.f X71f `71Hg h71+ p71f x71- 71I 71ߨ 71y 71G 71)B71*71 71ί 71ܜ 711 71N 71ץ 713 71 71z 81۬ 81 815 81$ 81ݪ (81g 081 881 @81!P81c `81A 81?!8181"81N!@91u H91BP`91v h91 91a8:1P:1 :1J ;1N!;1 ;1 (;18 8;1@"`;1U h;1px;1 ));1!;1Pe;1');1C !;1;1`%);1g!;1|;1@#);1 ;14;1@")<1n!<1`s<1!) <1y!(<18<1@!)@<1!H<1X<1` )`<1 h<1? x<1)<1J <1<1)<1!<1`P<1 )<1 <1 <1 )<1 <1<1)=1 =10=1) =1S (=1G 8=1)@=1 H=1 X=1`)`=1 h=1Ox=1)=1 =1y=1)=1s =1A =1)=1z =1`H =1)=1 =10=1)>1 >1,>1`) >1!(>1}8>1)@>1 H>1'X>1)`>1!h>10D x>1@)>1: >1>1)>1!>1І>1 )>1J >1P@>1)>1; >1>1 )?1Y ?1`?1 ) ?1f (?1pJ 8?1 )@?1!H?1=X?1@ )`?1!h?1Qx?1` )?1!?1s?1)?1!?10I ?1)?1!?1?1)?1!?1PE ?1)@1!@1@1) @1!(@1F 8@1)@@1!H@1) X@1 )`@1!h@1P<x@1@)@1!@1 @1`)@1 !@1F @1)@1 !@1K @1)@1 @1P@1@(A1 !A1 GA1( A1 (A108A1 (@A1C HA1XA1(`A1 hA1< xA1`(A1 !A1 A1`A1 kA1oC1 C1C1`-) C1 (C1e8C1 -)@C1 HC1`fXC1,)C1. !C1P: C1p"C1I !C1; C1"D1!D1k ! D1C1hD1@"0pD17 D1`"0D1!D1"0D1U (E1p"00E1!hE1"0pE1C !E1"0E1g!E1!F1 !F1 ;1G1A G1 JG1$G1J G1PJG1@G1 G1pUH1@ H1 H1@I(H1`[@H1 HH1UPH1UhH1 pH1SH1 H1[H1H1 !H1H1z H1H1$^ @I1 !hI1 !I1 !I1 !I1!!J1w 0J1!!J1!!J1@OJ11)J1G J1`gJ1`1)J1#!J10J1"J1u J1PJ11)K1v K10yK10) K1!(K1Pu8K1@0)@K1 HK1; XK1/)K1PL1 L10L1L1!!M1 M1 *M1@5) M1 (M1p 8M15)@M1 HM1PgXM13)`M1/!!hM1@xM1 3)M1 M1 $M12)M1 M1@M12)M1!M1M1`2)N1A!! N1O!!(N1j!!HN1"PN1s!!pN1@"N19!N1 N1!!N1!!N1 !N1!!O1!!O1!! O1!!0O1 @O1!!PO1!!`O1!!pO1!!O1!!O1!!O1"!O1"!O1"!O1""!O1+"!O14"!P1@"!P1I"! P1R"!0P1^"!@P1j"!PP1s"!`P1|"!pP1"!P1"!P1"!P1"!P1It P1 P1 P1"!P1"!Q1"!Q1ǒ Q1) 0Q1"!@Q1"!PQ1"!`Q1"!pQ1"!Q1"!Q1#!Q1#!Q1#!Q1&#!Q1/#!Q1:#!Q1!!R1F#!R1O#! R1Z#!0R1f#!@R1q#!PR1}#!`R1#!pR1#!R1#!R1#!R1#!R1#!R1#!R1#!R1#!R1#!S1!!S1#! S1#!0S1$!@S1 $!PS1$!`S1$!pS1$!S1%$!S1,$!S1!!S13$!S1<$!S1D$!S1N$!S1X$!T1b$!T1z T1o 0T1 @T1 `T1 hT1xT1x"T1j$!T1u$!T1!T11'!T1 T1)!U1 U1/!! U1A 0U1 @U1W PU1J `U1q pU1 U1 U1$!U1 U1 U1$!U1$!U1"!V1 V1It 8V1 PV1 pV1 V1 V1 V1#!V1GV15V1"V1$!W1W1W1"0W1ǒ @W1HW1, PW1H"hW1"!xW1GW15W1"W1"!W10W1@vW1"W1It W10W1 X1 X1(X10X1"HX1 XX1`X1hX1P"X1 $!X1{X1X1"X1$!X1{X10X1"X1$!Y1{Y1Y1"(Y1$!8Y1{@Y1@LHY1 "`Y1%$!pY1{xY1 Y1P"Y1,$!Y1{Y1`Y1"Y13$!Y1Y15Y1"Z1"!Z1 Z1(Z1"@Z1b$!PZ1 XZ1`Z1"xZ1"!Z1Z1$ Z1x"Z1"!Z1Z1~ Z1"Z1) Z1[10j[1" [1 0[1|@[1x"X[1<$!h[1Pjp[1 x[1 [1D$![1! [15[1"[1N$![1P! [15[18"\1X$!\1 \15 \1"8\1"!H\15P\1X\1"p\1"!\15\1\1"\1"!\104\1\1@"\1"!\104\1]1p"]1"!(]10]18]1"P]1"!`]1h]1p]1"]1#!]1]1]1"]1&#!]1]1]1@"]1/#!^1p^1^1x"0^1:#!@^1pH^1P^1"h^1!!x^10^1X ^1"^1F#!^10^1` ^1@"^1!!^1v^15^1$!_1!! _1н(_150_1$!H_1!!X_1 `_15h_1"_1$!_1_1 _1"_1!!_1& _15_1"_1O#!`1{H`1`1"(`1Z#!8`1{H@`1H`10"``1f#!p`1Ix`1`1h"`1q#!`1I`1`1"`1}#!`1P`1`1"a1#!a1P a1(a1"@a1#!Pa1 Xa1`a1@"xa1#!a1 a1a1p"a1#!a1@a1a1"a1#!a1@b1b1" b1"!0b18b15@b1"Xb1"!hb1pb15xb1("b1"!b1 b1@vb1P"b1""!b1b1@vb1"c1+"!c1@c1@v c1"8c1@"!Hc1Pc1@vXc1"pc1I"!c1c1X c10"c1R"!c1c1@vc1h"c1^"!c1c1@vd1"d1j"!(d1P0d1@v8d1"Pd1s"!`d1@hd1@vpd1"d1|"!d1d1@vd1H"d1#!d1d1d1"d1#!e1e1e1"0e1#!@e1`He1Pe1"he1#!xe1`e1e1("e1"!e1e1@ve1`"e1"!e1 e1@ve1"f1!! f14(f150f1"Hf1#!Xf1P`f1hf1H"f1#!f1Pf1f1"f14"!f1f1@vf1"f1#!g1g1g1"(g1!!8g1@g1@vHg1"`g1 pg1xg1g1P"g1!!g1g1Єg1"g1#!g1g1g1"h1"! h1@v(h1"@h1"!Xh1p'`h1"xh1"!h1p'h1"h1!!h1@h1j h1"h1 h1 ; i1i i1P" i1!!0i1 ; 8i1Jj @i1"Xi1#!hi1pi1= xi1"i1"!i1@vi1#i1+"!i1p'i18#@j1 Hj1ZPj10GXj1p#j1q j1o j1#k1 k1Zk10Gk1p#(k1q 0k1o @k1#k1ik1k1ik1Џk1k1k1@l1 l1pl1<) l1 (l1`d8l1@<)@l1 Hl1dXl1<)l1!l1 l1 l1#0l1e m1$!0m1$!@m1%!`m1 hm1 m1F-!m1 m15 @n1 %!Hn1ڞ Xn1=)`n1 hn14$ xn1@=)n1 n1yn1 ?)n1 n1p/ n1D)o1Vho1lpo1xo1`o1p. o1, o1. o1 p1 Xp10p1Vp1lp1p1`q1q1q1 q1!q1`2q1F-!r1 0r15 r1c r1`r1G)r1 r1cr1J r18 r1@G)r1 r1 r1F) s10(s1@s10Xs1Pxs1s1E t1 t1t1J)t1 t1bt1I)u1 u1cu1I)@u1 Hu1+ Xu1J)`u1 hu1 xu1I)u1 u1] u1I)u1!u1R u1` u1J)v1 v1C v1@J)@v1 Hv1, xv1%!v1P w1@v1w1#w1, w1C Hw1u1w1 x1w1x1w1x1x1x1x1 x1x1(x1x10x1 x18x1 x1@x10x1Hx10x1Px1@x1Xx1@x1`x1Px1hx1Px1px1`x1xx1`x1x1px1x1px1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1y1x1y1x1y1y1y1y1 y1y1(y1y10y1 y18y1 y1@y10y1Hy10y1Py1@y1Xy1@y1`y1Py1hy1Py1py1`y1xy1`y1y1py1y1py1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1z1z10T(z1`0z1@8z1`@z10hz1`pz1@xz1`z10z1xz1pyz1yz10yz1`z1@z1`z10{1`{1@ {1`({10H{1xP{1pyX{1y`{10y{1`R |1 |1` (}1J~1%!~1)! ~1 0~1J @~1%!P~1p `~1 p~1!~1!~1 1 1{* 1L)@1z H1@ P1}1 1!11#@1It P1'&!`1l p1!1z 1 1P#01wx 1'!1z 10!1 1A @1 H1 h1A p1 1J 1 1j!!11 !1i@1 1 131t 1J 1p 10 1@Q)(1i&!01 @1P)P1&!X10h1P)x1p&!1`q1`P)1 11P)ȃ1y&!Ѓ11O)1~&!1 1@O)1&! 101N)@1&!H1X1N)h1&!p1 1@N)1&!1Y 1N)1&!1 Є1M) 1 (1P81`V)@1Ƹ H1X1T)`1 h1x1R)1&!1q1@R)1 1l1Q)1&!ȅ1؅1Q)1 11 1 @1H10%P1qX1``11q1p1#01Ƹ (1#001 h1p#0p1g 1#01 1" 1p1 [)1 11[) 1 (1P81Z)@1 H1X1 Z)`1Ǐ h1x1@Y)1&!11X)1&'!11rX)1='!Ȉ1d؈1qX)11'!11pX)1nj 1'1oX) 1 (1081@X)@1K H1X1X)`1c h1`x1W)1&!11 W)Љ1*X11`1 1в1[)@1c H1p1c 11c ȋ11 $01 @1&'!P1!h1@$0p1" 11'!1 Ȍ1$0Ќ1Ǐ 1#01&!H1#0P1&!111g111 Ȏ1T؎1d)1 1/ 1`d) 1:%!(1 81`e)@1c H1* X1d)11`1:%!1 1`e)1c 1* 1 e)@1x11` 1 1@#1c 1* 1e)@11&'!1n%!11'!1x Б1x%!1%!1!1@1'!H1%X1h#h1=!p1 1#1'!1%1#1'!1%В1# 1'!(1%81(#@1'!H1 X1o)`1(!h1x1n)1 11k)1A 1V1h)1(!ȓ1ؓ1`g)1(!1%1X#1)(!1%1# 13(!(1%81#@1 H1X1f)`1 !h1 x1f)1 1 1`f)1 1]A 1 f)11$11p1в1B1@1` 10(1018104@1PIH1P1MX1 `1`p10ȕ1@>Е11`1<(!1K(!1c(!1# 1p(!(1#01(!818#`1(!h1`r)p111`$01t Ȗ1$0Ж1 1$01A @1 P1 g `1h11p1j1111@31]1S1ȗ1,C 1 1`1z)1 1Pn1`z) 1 (1n81 z)`1 h1 x1z)1 1e\ 1`z)1 1 1 z)1h 1!1$01Uj @1 H1X1 {)`1 h1] x1`{)1 1E 1z)1 ș1\ ؙ1`{)1F+!1>91`|) 1n+!(1/981{)@1+!H1#9X1{)1! 19 19 1 ț1)!1*)!1 016)!X1 1z 1B)!1K)!`1B)!1K)!1$01ם 1A 01z @1 P1J `1A p1 1g)!13 1p)!1>1r О1y)!؞1+ 1? 1)!1L`1)!1)!1)!؟1)!1)!(1)!1 1@1)1 1: 1)1z 1 1h#1)!1# 1)!(1#01 81(#@1)!H1X#P1)!X1#`1)!h1#p1)!x1P#1)!1p#1*!1#1*!1#1'!ȡ1ء1h#1=!11#@1'!H1`U X1@)`1(!h14 x1)1)(!11)13(!11`)1 Ȣ1 آ1)1(!1 1@)1 1p1) 1 (181)@1*!H1@X1`)`1 !h1@ x10)18 1P1)1B 101)1 ȣ10أ1`)11]11 1(101081p@1H101н1p11  1*!(1)011@1 H1@R X1^ h1E p1S 1(*!1 1< 1 1+!11 1M} 11 1F} (1@81 @1S} H1R X1 `1!h19x1 1F} 1!1 Ц1\x 1A 1K1L1K*!1J 1K1PL 1#01a*!81LH18#X1n*!`1L1y*!1*!@1F+!H1X1)`1n+!h1{x1`)1+!1 1 )ب131A 1K1L1*!1J 1K1PL 1h#01*!81 R H1#X1*!`1rD 1*!1*!1*!`1F+!h1x1)1n+!1{1)1+!1 1@)1$ 131F+!1 1) 1n+!(181)@1+!H1X1@)1A 1K1L1*!1J 1K1PL1#Ы1*!ث1 R 1# 1*!H1*!p1+!1F+!Ȭ1 ج1)1n+!1T1`)1+!1* 1 )@1F+!H1X1)`1n+!h1yx1`)1+!1> 1 )1n+!Э1+!1?!1ք1#@1 h1N!19!Ȯ1%+ 1u 1 1v 1ż 1 (1R$ @1!H1-11P1?!а1 1J 1N!1 1?! 1+!1 1 1 1 1+!ȱ1ر1)1 1,!`1u 1<,!1,!1,!1 1{ 11,!01*,!`1 h11 1|: 1k 1y 16,!(1U,!H1K,!P1y,!p1o,!x1^,!1h,!1 15+ 1 @1 1 1,!1p ȵ1J 1,! 1,!(1y,!H1o,!P1,!p1,!x1$ 1,!1,!1,!ȶ1t 1,!1E!1,!1-!81,!1E 1-!1J ȷ1+-!з1F-!1<-!1V-!1L-! 1d-!@1Z-!p111En 1`01k-!810Q @11@21@1 1812n P1`к1|-!غ10Q 1 1@2H1@11ػ1"n 1`p1-!x10Q 11@21@X1`1x1n 1`1-!10Q 1`1@21@111m 01`18#10Q 11@2(1@111m 1`P1`#X10Q `11@21@81@1X1m p1`1-!10Q 1@1@2h1@111m 1`1-!10Q 11@21@x111m 1`01-!810Q @11@11@1 181m P1`1-!10Q 1 1@1H1@111m 1`p1 .!x10Q 11@11@X1`1x1um 1`1.!10Q 1`1@21@111em 01`12.!10Q 11@1(1@1Um 1`P1?.!X10Q `11@21@81@1X1Em p1`1Z.!10Q 1@1@2h1@1115m 1`1#11`1111x111(m 1`01#81@1`11111 181m P1`18#11` 11H1X1111 m 1`p1#x11`1111X1`1x1l 1`1#1 1``1111111l 01`18 #11`11(181111l 1`P1p #X1`1`111181@1X1l p1`1 #11`@11h1x1111l 1`1 #11`1111x111l 1`01( #81@1`11111 181l P1`1X #11` 11H1X1111=m 1`p1 #x11`1211X1`1x1l 1`1l.!1 1``12111l 011z.!11`12(181P111l 1`P1 #X1`1`121181@1X1wl p1`1 #11`@12h1x1111el 1`1 #11`1111x111Wl 1`01 #81@1`11111 181Dl P1`1 #11` 11H1X11114l 1`p1 #x11`1211X1`1x1%l 1`1.!1 1``12111l 01@131.!11`1111(1m:811k 1@(1 <P1.!X1`1`11111`1X1k p1@1n 1.!11`011@11h1`x1111k 1`1.!11`11111k 1`01H #81@1`12111 181k P1`11.!11` 1`1H1111k 1`p1/!x11`1`111X1`1x19n 1`11/!1 1``1211122k 02`w2x #2@k2Px22(2M222k 2`wP2O/!X2@k`2Px2@22M82@2X2k p2`w2`2e/!2@k2Px021@22h2M2+v 2h2P~2u/!2@22321222x222k 2`;02 #82R @2<2 222 282˷ P2`;2P~2/!2R 2< 23 2 1 22H 2 2 2 2qk 2`p 2 #x 2 2` 2 2 2 2X 2` 2x 2bk 2` 2/! 2 2`` 2 2 2 2 2 2 2Uk 0 2` 2/! 2 2`22(282222Lk 2`P2/!X2`2`2222X23k p2`23 2 #20Q 2(21021821@22h2@x2222k 202/!22P222@x222 20202( #82@2Ph2`1p21222@2 282 k P2`20!22` 213H2X2222k 2P;p2` #x2Q 2<2`12132 4X2`2x2j 2`2 #2 2``21322222j 02\2 #2L2\2122(2\222j 2`P2 #X2`2`2222X2j p2`2!0!22`@22h2x2222j 2`2#22`213 2 2x 213 21 21 2@1 2@2 21 21 22 21 21,! 2 2 21,!!2 !2 !2p (!2@2@!2 H!2 #X!2@)`!2 h!26x!2)!2 !27!2)!2c !2p%0!2g "2 ("2`H"2J P"2p"2 !x"2"2 "2e "2J "2@#2 H#2H h#2J p#2#2 #2P#2J #2$2 !$2M9`$2>0!$2A $2 $2 %2>0!(%2* H%2A P%2p%2J x%28~%2 %2 %2 !%2 &2j!!&2 &2 &2&2pM'2'2 (2` `(2%!h(2(2K0!(2!)2P0!8)2 )2 )2^ )2))2U0!)2p)2))2\0!)2S)2 )*2!!*2*2)H*2%0P*20!*2%0*2 h *2 *2L0!*2&'!*2='!+21'!+2K +2c 0+2t @+2J `+2'!+2h#+2=!+2#+2'!+2 +2),2 !,2,2) ,2 (,28,2)`,2h,2p,2,2,2,2Q ,2P,2P-2-2%0-2g -20!-20!-2R @.20!h.20!.21!.21!.2 1!/2-1!0/261!X/2>1!/2H1!/2Q1!/2]1!/2i1! 02> H02u1!p02}1!021!12 12: 121!(12[" @12!H12@%X12@)12&012!12 12y 22B)!@22#H22j!!h22#22 22 22 22!@32B)!`32#32J 32t 32A 321!32 32>? 42 !(42@42n!H42X42)`42 h42@x42 )42J 4242)42 42p42 )42; 42S42)42!42 42`)52 5252) 52 (52852)@52 H52{X52)`52 h52x52)52!5252@)52!52 52)52!52052)52!52@52`)62!62P62) 62!(62`862)@62!H62pX62 )`62!h62x62)62 6262)62S 6262)62 6262 )62 62 62`)72C 72072@) 72 (72872)@72!H72>X72`)`72Y h72x72`)72f 7272`)72 720!72)72s 7272)72z 7272)82 82082) 82g!(82`882 )@82 H82XX82)`82C !h82x82)82!82q82)82J 8282)82 8282@)82!82c 82)92!92`92) 92: (92Z892)@92!H92pSX92)`92 !h92x92@)92U9209292092N92W92K:2`X:2`;2 h;2x;2 );2 ;2@;2);2 ;2;2);2&0;2 (<2&00<2: h<2&0p<2C !<2'0<2g!<2&0<2!(=2P'00=2!`=2!p=2!=2`'0=2 =20'0=2 >21!>2>2) >2 (>2Y& 8>2)@>2 H>2X>2`)`>2 h>2x>2)>29 >2 z>2)>2n!>2`>2)>2 >2>2)>2 >2@>2)?2K ?2?2`) ?2J (?28?2)@?2 H?2РX?2@)`?2; h?2x?2)?2!?2?2)?2 ?2X?2)?2 ?20?2)?2 ?2p?2)@2 @20@2) @2 (@28@2)@@2 H@2X@2 )`@2!h@2x@2@)@2!@2p@2)@2!@2@2)@2!@2p@2`)@2!@2@2)A2!A2pA2) A2!(A28A2 )@A2!HA2XA2)`A2 hA2xA2@)A2S A20A2)A2 A2@A2 )A2 A2PA2)A2C A2A2)B2 B2 B2 ) B2Ǐ (B2@8B2 )@B2 HB2XB2)`B2!hB2`xB2`)B2Y B2B2`)B2f B2`B2@)B2p B2 B2)B2 B20B2)C2s C20C2) C2z (C28C2@)@C2 HC2`XC2`)`C2g!hC2@xC2`)C2 C2ZC2)C2C !C2C2 )C2!C2C2@)C2J C2@C2)D2 D2 D2) D2!(D2cG 8D2)@D2!HD2`XD2)`D2: hD2xD2 )D2!D2WD2)D2 !D2 D2)D2}D2~D2pD2E28E2@F2 HF2XF2)`F2 hF2xF2)F2 F2PF2@)F2'0F2e G2'0G2: HG2'0PG2C !G2'0G2g!G2'0G2!H20(0H2!@H2!PH2 hH2@(0pH2 H2(0H2 HI2( PI2/ XI2J2F+!J2&'! J21'!0J2='!@J2 PJ2 `J2(!pJ2 J2u J2v J2 J2 J2 J2\x J21!J21! K22!@K2!PK22!`K22!pK2 K22!K2 K2#2!K2F!K2)2!K2S L2g L2h @L2n PL2 `L2/2!pL2 L2? L2 L2g L2Q0!L2!L242!L2:!M2 M2 @M212!PM2 `M2+!pM2 M2 M2"!M2' M2w M2PB0M2@B0M2@M2M2L2M2@L2M2K2M2@K2M2 K2N2J28N2e PN2xN2N2$N2 N2ХO2O2`\0O2`[0O2`Z0HO2yO2` O2pP2$P2Y0P2`Y0P2PxQ2 Q2tR2$R2; R2A HR2j0XR2i0R2vS2 0S2PXS2 S2$S2@S2ZA S2g0S2`g0S2f0(T2T2 T2PT2 PU2`$XU2@`U2ZA U2:U2l0U2 l0U2k0U2RXV2 pV2PV2 V2$V2@W2ZA W2:(W2`d00W2c08W2@c0hW2W2& X2kX2 %X2 X2@ X2Q X2`q0X2q0Y2aY2PaY2S Y2@Y2p 0Z2 %8Z2 @Z2@ hZ2 v0pZ2x0xZ2x0Z2`Z2  [2 H[2 P[2p[2 [2 P\2@ %X\2Y; `\2@ x\2\2\2y0\2 [2(]2H]2[X]2> h]2@0]2]20]2]2 ]2Я]2%]2 ]2 d]2`%^2 ^2d^2 % ^2 8^2 x^2( ^2`_2%_2 _2H_20_2`|`2B 0`2 `2%`2P`2@`2` `208a2{a2Q a2Xb2Ѐb2b20b2@sXc2d pc2@Xc2 %c2P d2p(d2 0xd2`Wd2v e2P8e2ze2%e2ie2e2`0f2f2 f20g2 %8g2pl`g2hg2@0g2к8h2 Ph20h2%h2Ii2i20Xi2i2 i2vpj2%xj2vj2uj2uxk2 k2`{l2%l2@l2PHl20l2ym2 0m2p[Xm2nm2%m2m2m2 08n2n2 n2Po2%Xo2@o2[o20o2@[Xp2 pp2np2%p2S q2pm(q20xq2lq2 r2phr2%r2ir2pr2]2s2hs2" s2p0t2 %8t2`t2ht20t28u24 Pu2[u2%u2tv2v20Xv2Xv2E v2]pw2%xw2w20]w2@0w2P\xx2Y x2_y2%y2@y2p^Hy20y2^z2m 0z2 Wz2@%z2z2Vz208{2U{28"{2P|2%X|2`l|2i|2@0|2@hX}2} p}2p}2%}2j ~2(~20x~2 ~2 2a2%22@`2@02 _29 2`2%2@ 2 2%2 Ȁ2 ؀2`%2 2f 2 %2K 2f 2 % 2J (2b? 82%@2 H2ЂX2`%`2P h2| x2%2 2= 2%2 2 2@%2Ǐ ȁ2p؁2%2[ 22%2 2~ 2% 2 (282%@2c H23 X2@%`2p h2: x2%2P 2k 2%2 2+@ 2`%2 ؂2 2x 2 0 2`% 2K (2\] 82 %@2 H2\] X2 %`2 h2 x2%2 2 ؃2"2x2E; 2 2028>x2 22E; @2 H202>2 02PKX2 `202 %2K2w 222@0(2I2 Ј22p 202`0P2 %X2`2h2F x22220ȉ2؉2 H2%X2h2x22a@ 2 02Ȋ202%20j2К2 (2S 82`0H2 h22%22 2: ȋ2؋2022P 2 2 2`C2 2C2 ،2 2h2@E(2 aX2@%h2 x2h22202 22Y2`y2 x2 (2y82xH20`2 2w Ȏ2؎2@&2s 20^2&2 2p2& 2 (2p82@%@2} H2( X2%`2 h2Jx2%2C !2T2%2 22%2 ȏ2# ؏2%2 2P' 2P%2 2`' 2 % 2 82 `2J h2 Px2&2F-!22&2V-!2pU2 &2= Ȑ2@ؐ2&2 2P2&2 2`2& 2G (2( 82`&@2 H2p' X20&`2 h2' x2&2 2 2i ȑ2P7ؑ2&2p 22`&2x 22& 2F (2 82&@2{ H2b4 X2 &`2 h2: x2&2 2 Ȓ2pؒ222`0 2!02y @2!P2/ `2F p2 2 2( 2 2!2 Г2 2, 2E 2 2( 2c 02 @2x P2 `2G p2 2!2Sh 2!2)!2T!Д2ʢ 2ز 2!82$ P2 Е2&ؕ2p22 12 12 1X2Ӌ ؖ2!2V2)m 21x2C!2Ș2!1И2!120% 2? (2z 82 H2 12Q 21'!02 p2 126 2@ 2 2='!Л2 2 1X26 `2@ 2 X2&'!p2 2 126 2@ 2 2H!2D 25 2\!2 82W5 82l!P2آ2P%2L0!ȣ2أ2 <'2y 22:'2} 2 2 :' 2 82 `2 x2 2!2 X2!p2$225 2$(2`282 %1x2 2!2& 82 X2"24 2& Ȩ22Ш2$12 2!20 2`$12@$182%@2 H2 X2* h2`#12H 82ך P2HЫ2A'ث22 S2(1X2Fج2 !2P[p2@'x22V2(12k P2`Ux2g 20w2?'2@2YH2`(12 2v2 h2202S 2 21Ȱ211ذ2229@2 X2 2!2<ر2 2 712612612Z 20 2:282@2KH20 X2 `2 82!P2<x2 2 7126126120 2:2س22K20 2 2 2@61ش2)!2!28 82@29x22K2A2@22512^2]x2W!22291ж291ض2P 22"2(2 H2@91P281X2812`2\2Rx2 !2; @2 ; H232 !02= 2P< 232 !л2X2j2<2C1X27 p222A1222A12`Ƚ202 +)2 (2`;1x22s 2`V82* p20T2@6)2Pп2N12|] 20O2%!22I2K12(2p2P022)82@2Ph2J1p2@I1x2G12P2@22&82J P2x2225)202M12L1H2XX202 !2P 2:)2 2#2 :)2J 2 29) 2 82 x2$!2U20@2MH2l12 02VX2h2k1p2k1x2g2:)22`,2pL2282D232 2 2`m12 X2? p2p2w 2>)22) (2@n102m1x22 2 2B) 2 (2B82A)@2#!H20X2F)`2K h2x2E)2%!22`A)2c%!22`E)2x%!2@2 A)2%!2{2E)2&%!20 2@) 2:%!(2`+ 82D)@2E%!H2X2D)`2N%!h2@x2@D)2Ǐ 2pz2@)2 2 2D)2 2P2@)2 2: 2C)2Y%!22@C) 2n%!(2и82?)@2%!H2cX2B)`2nj h2pQx2`?)2 2 2#!202F)2K 2P/ 2E)2c%!22`E) 2%!(2{82E)@2:%!H2`+ X2D)`2E%!h2x2D)2N%!2@2@D)2 2 2D)2 2: 2C)2Y%!22@C)2%!2c2B) 2 82 x2%!21 2$ 2%!02d2`|2 2n12y 22 2o12 p1P2`B)X2`2Ph2x2@d222202УX2h p22 2p12 p122 F)22P22@d(22x2 2`D2%!22p2@u12%!`2h2t182 P23x2 # 2s12@s12 s12& 2G)2 212r12q1X2? 2*2%!2E 20 2|12|12 x2%!2Y 2P2{12 82&!P2P%x2`! 2M)22S 2 212~1H2 ! X22wx 22 P2Єp2@M)x22@21212@12cx25&!2?&!2N&!2"2S2 2PgX2h2K212@12@1X2&!p22c+ 2p2g 282H21P2P1X22@12V)2@:2^ 222 1212 2&!2'82 :@2C 2 2'!22212102[)82,@2H2X2`h21x2 22&82 '!2P2@12+'!2p21x27'!82 dH212D'!02h22e212#!2 2b)2!!22Pb)2 202 b)2L0!202a) 2 (2 l82`)@2Ǐ H29X2`)`2&!h2x2@_)2&'!2`2_)21'!22^)2='!22^)2nj 22`])2" 22\) 2 (2P82\)@2K H2X2\)`2c h2+ x2 \)2 2 (2˓2z2 X28'!p2202@12pj2(218212S'!2@2`2 212,'!2202 22@182pjH2pX2 h21x2182!'!P2x202 2212pj2p22 1212f'!2@x2`221x2w'!2@3`@3H313'!03@3`3' 313'!3@X3`3' 31X3'!p3@3` 3' (313{ 3_83@31H32P313b)303033323j3p3 3t 3313p03p)H3`h3 1x3@13 3!!( 318 3(!@ 3c H 3`X 3y)` 3 h 3: x 3x) 3 3Й 3`x) 3K 3$ 3 x) 39 30 3w) 3 3@ 3w) 3  30c 3 w) 3Ǐ ( 3X8 3v)@ 3 H 3`X 3v)` 3 h 3x 3`u) 3J 3! 3u) 3p 3 3t) 3Uj 3 3 s) 3 3 8 3(!P 3  3P 3` 31 3 3p 3V( 310 3`1p 3`y)x 3 3 3P 3 3 3 30P3 x3(!303@3PyH3`183(!P3 T p333PR 3` 313)!3jx33i31x3%!33PP@3H3@13)!03SX3 `31x39 3 3|)3y 83S3̈́ 33'3C 3%3`3P 3@&353z 3(3@3 h3A p3x3 3J 33`3%!3@3 `3%!h3P3 3h 383 `3[ 3`)333`13`3333g 3@3 03~)83@@3p31x333383ם P3PYx3y3@})33Z313303PX3 3 3$3 x3`<3 313`131x3e 3P3 313PI 3)( 3H 3@1X 31 3 3!3=*!X!3 !31!3@1"3E+!"3S "3)"3m+!"3 "3)"3+!"3 "3`)#3 #3 P#3} X#33#3*!#3-#31#3 X$3$3($3@1$31$31X%3+!p%3B %3R &35+!'3vB 0'3`#3'3j* '3 '31(3K+!(3B 0)3#8)3* `)3 h)318*3]+!P*3A p*3#3*3* +3m+3@1+3t+!+3-,3@#3,3' x,31* ,3"3,3 1,31x-3*!-3--31-3< .3H.3`1P.31X.31/3+!0/3ЩX/3p`/31p/31x/3r /3[ /3/3@)/3p/3 /31/3@1/31803D 03 03 0303 03+!031313+! 13@(13y 013+!@13+!H13pP13 X13+!13j 13`13Q (23P~P238#X23`23`23123 123032323@33 H33l$ X33)`33 x33 33g 33@P43`)X43Z43p43@3343PX53h p53`#53)53j 63`"(63@!2x63f 6363L0!63v63`#73&'!73`73# 73='!(73c873#@731'!H73PTX73#`73K h73x73X#73 73 73c 73U73x#73d0!83883 `83`83`83$283`$283#28393w0!9393 8:3`p:3`$2x:3@#2:3j:38;30!P;3x;3 ;3`<3$2<3`$2<3"20<3^8<3n<30!<3=3 @=3` x=3`=3`$2=3 "2=3@x>30!>3>3 ?3`H?3$2P?3`$2X?3 "2p?3`@3 h 0@3`@3@)@3@3|@3)2@3(2@3`(2A3PA3,(A3A30!A3VA3B3@'2B3&2B3&2(B3XB3jhB3 xB3iB363B3XC30!pC30C3`O C3? C3pC30D3) (D3&20D3 &28D3 %2D3g 8E3 @E3`,2XE3@E3)E3E3+2E3`+2F3F3u F3pF3 F30^0G3)HG3hG312pG3@.2xG3-2G38H31!PH3c? I38 I3G&!I3J3 8J3 PJ3ZpJ3)xJ3 J3, J322J3 22J312J3\) J3xK3c K3PT K3 K3[ K3ZL3@)L3Q (L3 PL3@32XL322pL3 L3y M3s 0M3FXM34 M3)M3`M3PM3 M3328N3 N31!N3@4N3d PO3)XP31!pP3P3p Q3(Q3`;2Q3 8R3@R3@:2HR392PR392XR3%hR3@R392R3)R3pR3R3 42S3S3pS3S3S39` S3S3pkS3S31!T30T3pT3@KT3@F2U3e U3U3U3 E2U3S3U3D2V3p V3D20V3 )HV3TXV30hV3>2V3`xW3g W3pJW3H2X3)X3Z X3*0*0]*0~080a 2a880|@80H80DP80.X80`80h80p80x8080}80p80E8080808080(W3HW3808080l80808080#80o90909090w 90(90090-890@90EH90P903X90`90h90p90x90G90#90N909090}90Z2_2@a2b2d2 f2g2`i2k2l2@n2o2q2 s2t2`v2x2y2@{2|2~2 2@22ȍ2 22`22 2`222222 22@222`22 33 33@034363@A390G9090P90E90G9090^9090U90:0M:0 :0n:0 :0(:0k0:0q2q8:0@:0zH:02P:0X:0`:00h:0p:0(x:0V:0:0:0s:0:0:0:0~:09:0i`2i:0?:0k:0X:0:0@2R3:0:0 ;0;0M;0;0 ;0WH2W2W2W2WX2WX3W823WXJ3WK3W(;00;0x2x8;0|@;0TH;0nP;0X;0`;0h;0p;0lx;0;0;0?;0J;0;0;0;0;0y;0K;0;0;0;0;0;0R;0<0<0)<0<0  <0(<00<0_8<0@<0_H<0?P<0X<0`<05h<0p<0x<0<0<0<0<0U<02<0<0<0<0<0#<0Z2^20b2c2pe2g2h2Pj2k2m20o2p2pr2t2u2Pw2x2z20|2}2p2P222022X228222P22202Н2p22202Ц2p222P22x22202н22220222022p2222022p2222p222P22p33 3P 333P33P33!30$3%3p'3)3*3P,3-302304353p83:3;3P=3>3@30B3C3pE3G3M3P3pR3pT3V3<0<0<0<0<0=00=0i2(2Ȗ2h222(22H222(2Ȭ2h22(2ȴ2h2h222H222(2h222H2h222H222(22h2(22h222H2222(22h22H222(22h233H333( 3 3h3(33h3333(33h3!3#3H%3&3(3(*3+3h-3/333H537393(;3<3h>3@3A3HC3D3F3(H3I3hK3M3N3HP3Q3S3U3hW3=0$=0 =0(=0!0=0&8=0@=0WH=0P=0X=0z`=0h=0<p=0x=0=0C=0=0=0=0=0[=02ؘ2X2222222X38 3=0v=0`X3=0[=0.=0=0=0=0e=0>0>0_>0>0  >0(>0t0>08>0@>0\H>0P>0X>0J`>0h>0p>0x>0t>02`223@"3 F3`I3 S3V3>0*>0>0>0>0T2T>0>0>0>0>0b>0>0>0+>0>0c?0?0?0j?0 ?0a(?0.0?08?0@?07H?0pP?0tX?0n`?0h?0gp?0x?0?0W?0Z2x]2j202Љ2P2222222P22p2P2223 3330"300343p630A3F3V3?0?02?0?0?0!?0X?0>?0?0?0b?0?0XO2P2R28T2U2xW2\2222 3338A3V3X2`2xb2d2e2Xg2h2j28l2m2xo2q2r2Xt2u2w28y2z2x|2~222822ؚ2x22228282غ2x28222X22222833x33 38333383H#3`#3#3x$3'3X)3*3x4363H3Q3T3([24(24h2424(24H343434034(^2vȂ2v2vȌ2v(2v2v2v(2vh2vH2v(2v2v(2v2v 3v#3vh33v73v02p2202P33303(282H2X2h2x222~22ȓ2Qؓ2L22j2d2(282H2X2Yh2cx2222ؔ29222822#22'23!>3!@J3!(%3H-3.3S3,0,0,0w,0,0,0-0-0-0-0 -0 (-0 0-0 8-0 @-0H-0P-0X-0`-0h-0p-0x-0-0-0-0-0-0-0-0-0-0-0-0 -0!-0"-0$-0%-0&.0'.0(.0).0* .0+(.0,0.0-8.0.@.0/H.00P.01X.02`.0h.04p.05x.06.07.08.09.0:.0;.0<.0=.0>.0?.0@.0A.0B.0C.0D.0E.0/0F/0G/0H/0I /0J(/0K0/0L8/0M@/0NH/0OP/0PX/0Q`/0Rh/0Sp/0Tx/0U/0V/0W/0X/0Y/0Z/0[/0\/0]/0^/0_/0`/0a/0b/0c/0d/0e00f00g00h00j 00l(00m000n800o@00pH00qP00rX00s`00th00up00vx00w00x00y0000z00{00|00}00~000000000000000010101010 10(10010810@10H10P10X10`10h10p10x10101010O1010101010101010101010101020202020 20(20020820@20H20P20X20`20h20p20x202020202020202020202020202020202030303030 30(30030830@30H30P30X30`30h30p30x303030303030303030303030303030303040404040 40(40040840@40H40P40X40`40h40p40x404040404040404040404040404040404050:505050 50 (50 050 850 @50 H50P50X50`50h50p50x5050505050505050505050505050 50!50"50#60$60%60&60' 60((60)060*860,@60-H60.P60/X600`601h602p603x60460560660760860960:60;60<60=60>60?60@60A60B60C60D70E70F70G70H 70I(70J070K870L@70MH70NP70OX70P`70Qh70Rp70Sx70T70U70V70W70X70Y70Z70[70\70]70^70_70`70a70c70d70e80f80g80h80i 80j(80kHHA*HtH5*%*@%*h%*h%*h%*h%z*h%r*h%j*h%b*hp%Z*h`%R*h P%J*h @%B*h 0%:*h %2*h %**h%"*h%*h%*h% *h%*h%*h%*h%*h%*hp%ڛ*h`%қ*hP%ʛ*h@%›*h0%*h %*h%*h%*h%*h %*h!%*h"%*h#%z*h$%r*h%%j*h&%b*h'p%Z*h(`%R*h)P%J*h*@%B*h+0%:*h, %2*h-%**h.%"*h/%*h0%*h1% *h2%*h3%*h4%*h5%*h6%*h7p%ښ*h8`%Қ*h9P%ʚ*h:@%š*h;0%*h< %*h=%*h>%*h?%*h@%*hA%*hB%*hC%z*hD%r*hE%j*hF%b*hGp%Z*hH`%R*hIP%J*hJ@%B*hK0%:*hL %2*hM%**hN%"*hO%*hP%*hQ% *hR%*hS%*hT%*hU%*hV%*hWp%ڙ*hX`%ҙ*hYP%ʙ*hZ@%™*h[0%*h\ %*h]%*h^%*h_%*h`%*ha%*hb%*hc%z*hd%r*he%j*hf%b*hgp%Z*hh`%R*hiP%J*hj@%B*hk0%:*hl %2*hm%**hn%"*ho%*hp%*hq% *hr%*hs%*ht%*hu%*hv%*hwp%ژ*hx`%Ҙ*hyP%ʘ*hz@%˜*h{0%*h| %*h}%*h~%*h%*h%*h%*h%*h%z*h%r*h%j*h%b*hp%Z*h`%R*hP%J*h@%B*h0%:*h %2*h%**h%"*h%*h%*h% *h%*h%*h%*h%*h%*hp%ڗ*h`%җ*hP%ʗ*h@%—*h0%*h %*h%*h%*h%*h%*h%*h%*h%z*h%r*h%j*h%b*hp%Z*h`%R*hP%J*h@%B*h0%:*h %2*h%**h%"*h%*h%*h% *h%*h%*h%*h%*h%*hp%ږ*h`%Җ*hP%ʖ*h@%–*h0%*h %*h%*h%*h%*h%*h%*h%*h%z*h%r*h%j*h%b*hp%Z*h`%R*hP%J*h@%B*h0%:*h %2*h%**h%"*h%*h%*h% *h%*h%*h%*h%*h%*hp%ڕ*h`%ҕ*hP%ʕ*h@%•*h0%*h %*h%*h%*h%*h%*h%*h%*h%z*h%r*h%j*h%b*hp%Z*h`%R*hP%J*h@%B*h0%:*h %2*h%**h%"*h%*h%*h% *h%*h%*h%*h%*h%*hp%ڔ*h`%Ҕ*hP%ʔ*h@%”*h0%*h %*h%*h%*h%*h%*h%*h%*h%z*h%r*h%j*h%b*hp%Z*h`%R*h P%J*h @%B*h 0%:*h  %2*h %**h%"*h%*h%*h% *h%*h%*h%*h%*h%*hp%ړ*h`%ғ*hP%ʓ*h@%“*h0%*h %*h%*h%*h%*h %*h!%*h"%*h#%z*h$%r*h%%j*h&%b*h'p%Z*h(`%R*h)P%J*h*@%B*h+0%:*h, %2*h-%**h.%"*h/%*h0%*h1% *h2%*h3%*h4%*h5%*h6%*h7p%ڒ*h8`%Ғ*h9P%ʒ*h:@%’*h;0%*h< %*h=%*h>%*h?%*h@%*hA%*hB%*hC%z*hD%r*hE%j*hF%b*hGp%Z*hH`%R*hIP%J*hJ@%B*hK0%:*hL %2*hM%**hN%"*hO%*hP%*hQ% *hR%*hS%*hT%*hU%*hV%*hWp%ڑ*hX`%ґ*hYP%ʑ*hZ@%‘*h[0%*h\ %*h]%*h^%*h_%*h`%*ha%*hb%*hc%z*hd%r*he%j*hf%b*hgp%Z*hh`%R*hiP%J*hj@%B*hk0H@DA\foD$H foL$ D$ $" HKHLH$xH¸L-+T!AUzA {H5+ HH5+ HH=LE1 K|1_|[ H|$ 1H5jH\!HH|$@1H5CL=\!Ll$\$`L|$hfDot$`Ht$pfDo|$pEuE}MH5C=HD$(H|$(H5;yBH5*1LH2\!DŽ$H$H$fo$fo$)$)$dHǾ=CHHtQHH5DgH|$(VH|$(t3H52gA~H5>SH|$1TDŽ$v~HT$foL$`foT$p R'H5:L$LHD$(hH|$(L$LuT}c}HDŽ$r}H5CL$(-L$(u $xQ}}:}|DŽ$|Ht$\H詜xDD$\D$}DŽ$L1L5Z!L>DŽ$fInLHZ!fI:"$9H|$@1H5L=Z!w$$Lǎ*EETzD$GzHQ!LL$1H|$LfHnùfI:"AAAz~fDo$fDo$D)d$`D)l$pDŽ$4 ~H|$@L%(Y!LfMnL\$fM:"D$`DL$hfDoT$`fDo\$pEE[}H e*$H5p*>AED$HVH|$ Ht$ LHT$(Ufo$1LA$AT$H|$ 评H|$LL LۈMD1A$Mt$ML$MHI$E1/%HDD$HL$HT$H4$DD$H4$HHT$HL$At~AAAHH9H<HL$HT$H4$ HHtuLHH4$HD$HHT$DMQEtYxEYHIE1EuaHT$H$ H<$HL$HtH)HHuFAH D[]A\AAAHt MI)ILH>E1A{LYALLh HPLxHI9J< IHHD$8LHHHL$8IyLLD$(LL$ HL$Ht$H|$L\$Ht$HHLL$ LD$(HHL$wTEQA(vLACHI)MIMuHtLL)HH}M$1陁鑁HtHtEuHt]HAHU*McII̓=Տ*RH`*H=AH =*L*L#*1A_H5wKTI;ނL5`A|$L5Y+tQHE*H9~OMlHkEd$ H-+*L--雂L=*AV鉂L=*AhwEd$ m=*H }*ITH51A_H998fo$1LA$AT$霃LH|0HH $H)HH $`LD fo$1LA$A\$L1LA$AD$-1陃1À8ك鳃1韄H*LH5I!H81ghH*H=/1H 3P1DxIʃ8H11&HD$L%L L|$HIB8p1HdDbED$A?wGAwH=tRHtVJ@Ӄ(1 =u1ׇ͇Ç鹇鯇ZDCA?w:w<1=}Af\R1=A111m11m11m1醉H+H+H+ ++++++t_1/'H+H+HP+ q+z+ ++ 5+>+up1ˈfo$foL$A$AL$fo $foT$A $AT$QttoHl$@H&n Hl$@HmDKPs{DC AtDL$Dtt$Ht|$LAtDD$`EtOMt\LHLn։Hl$@HmH 9$D$@D$PHL$HHD$\v1HL@n鍉LShL[pfHHT$ LD$(LT$ L\$8n]HtE!H51fHnA$fH:"AD$麉foL$foT$ A $AT$鞉I$8HHL$HrHHL|$@Ht$LHLۻ\$@HL$HHt$PH|$fDot$@fDo|$PD)t$ D)|$0pعLfot$D$`H5~H @!t$hfoD$`foT$p)D$@)T$PfHn\$@fH:"D$HfoT$@fo\$P)T$ )\$0عLH5rH F!ԊعLH5jH fF!鰊LH|$HLL\$@HL$HHt$PLD$hA(ug1L1^fo\$`fol$p)\$@)l$PfLn\$@fL:"Dl$HH|$@H5ݩH }E!H5,*H|$`L跶fo|$`fod$pDL$`HL$hHt$p)|$@)d$PEW)|$ D)d$0鶉fDoD$`fDoL$pD)D$@D)L$POL$Mt1LL*1EiCHAÞ&DBTHuaH=*Lfod$`fot$p)d$@)t$PH|$@H5|H D!عLL-@!HuD$`fMnHH @!fL:"DT$hfDo\$`fDod$pD)\$@D)d$PYfoL$`fo|$p)L$@)|$P^H|$@H5H C!fo4$fo|$AuA}郌H-@X!Hɥ1fHnLfH:"AEAmKfo $foT$A $AT$鉎H5]X!Hv1fHnLfH:"A$AD$PHu֎ΎH5W[HD$ HT$ H$H|$ LpH$9uH9 1LX!HfMnMøH{DŽ$fL:"ID$fDo$fDo$D)$D)$$L$L$$fDo$M܉fo$D)$)$AE0ADžAE4HL%V!H|$1L$H$LD$(Ht$ HADžaHT$hH5\THD$hHT$ EHHHt$(H$Hw$fDo$L$L$D)$$fDo$D)$uHT$ H5S1HH|$`t$PLD$  HT$ L$Pfo$L$fo$L\$ )$)$HADž*H|$`躻 H|$1L$L$L\$(HmLD$ L%U!AE,韐H RdH RXILzLH跤$fo$L$fo$L$$)$)$$L$L$$`ILyLH3$bIٓI֓H|$عHPL%IT!H$L$L$ Ht$(LL$ 鳎HH5QHL$(;HL$(tHH5T#HL$(kILL脉D$L$H$$Efo$DMfDo$L$H$LT$(HD$ )$D)$H @QLLH$=H5IHbHQHPI~uIEHH:LS!L1fMnۉ$fM:"$D$x=HHt+HxHfvu$Lu1LwS!H PIuhHs$fDo$fo$L$L$$D)$)$ӏLL%R!oH|$1H$L$fo$L$fDo$$)$D)$$L$L$$/GL%W}*H=uH\$ I $I$HT$ 1H5k!E1HHٺ&H=uZH|$11ҹL$H$L\$(Ht$ z\~*鲌I(LHy$L$L$fDo$$fDo$D)$D)$$L$L$$HH{ux$xmAu$=H*Ht+HxHsu($xD$EU$闋DŽ$Ls1LP!LsHbgIHn:HH*A>trMMu.ILLHL'uD$EuJMuL=Iu'LILHLtӞ$u`L@ 駎LDL$. $D$L$L$fDo$fDo$D)$D)$Lt$ܴ $D$L$L$fDo$fDo$D)$D)$xLxA>IH|$1L5LM!Sfo$L$fo$L$$)$)$_pIHцH|$1LL%UM!󫉜$L$fo$L$$fo$)$)$eIΌIAEIE&HHXD$EtLpADxz*鶈AE(|H|$ LL节$L\$ tLfo$L$L$$fDo$)$D)$%L pHE1AH=ALLLH KHNHX$KLi$fDo$L$H$D)$$fDo$D)$|AEPH陌L$L$LT$(L\$ GAE |$ H5H=1E1^1H J1LHl$uD$L$fo$H$fo$DD$ )$)$Hofo$L$fo$L$$)$)$'LI!Ht$1H|$fMnHfL:"D^H|$@DL$@Ll$8LgL%J!PIH JLH$.fo$L$fo$L$$)$)$@ADž麇L$H$L\$(H|$ SI$Ht$ Hj$Md$ fDo$LD$fDo$E Eh҇fo$L$fo$L$$)$)$)$)$A}lA}sA~AAAAAAAAAAA|Hr*;@@A^I$LHiD$Eu>Md$1H$H$MH|$(Ht$ )$)$~fo$L$Dfo$L$$)$)$饅Hp*AUH s*9AutH-p*DEEkL n*EEcLp*E#E[L5 n*E>ESH=o*ALHp* AEHq*3A>H-'p*}AEE-Lq*A:AEEL5l*A>AAA Hr*8Afo$H$@fDo$Hl$8)$D)$3MEpH5DI8TA}靄fo$L$H$$fDo$)$D)$kE1钐fo$foL$A$AL$鿐HHt$x1H|$t:Hp诫 HD$LHp11LӐHF!H5S1fHnLfH:"A$AD$隐I<$I\$: LI/ 鹐8IHLHL荔E1酒t$ |$ 1H5j@HH5ŕHH5HI LLD$HT$Ht$舔|$ Ht$HT$LD$u H鰓foD$ foL$0A$AL$驓Ht$ H\ D$ xD$ 9鰓D$ foD$foL$ A$AL$1LH|$tL-֐HO^!A$IT$Ml$麓1LH506!H1fHnLfH:"A$AD$wfo $foT$A $AT$\HCHt$Ht L$$Lգ H=6 )`H$HE1H H= "証LpHvLvLvA?t L$L\ H= _H$H H}(1 HH}(HE(H H5/!oHEH ʉH5/!OPUi*i*ZH5=!H1fHnLfH:"A$AD$@1驛H=Z:H^1ݛH鲛L;!H571fInLfH:"A$AD$魝H=e*1 H8Lh* 1I8H=e*1 H?ּL h*1 I9軼L|g* 1I:蠼鹜A&t:t5 MEbLD$詺 R邝h*E=h*1H=Ɍ Aƅ =Yh*5D;D5Dh*H4$LDUHH]I)H$M1fL`*H541I; МT$ D k1H=*AŅ H4$LD»HD8tD臹xڛ =g*Ht$ IL蝜 [g*w$HHuLe*H5`I:FHt$ DufoD$ D5g*g*DܸEI)H$MD輸1鮛L Nc*LH5t`1I9ʺ H5f*H9t$ 1H=f*H9|$(D5}f*E0EH ^*H98LD$I1HLGI1LHCHHHfH_ !H5_1fHnLfH:"A$AD$91ldE1Hu+LE1v H{荥 םHu(L[ ŝH b*H_HH1-HbI.6 I.D 1  H|$  L  H|$ D$| D$ HSLLSxbHHuHHl$fE̟ L-!-鿟 LM`LUhfHEhL}XMXLL$LT$ Hߢ  1馡 I.Hl$` ! Hu0E,Ht*ޠ IT$HL$(E1A) DT$g#L=b_H+g#L=w_Hg#L=_Hg#L=_Hf#L=_Hf#L=_Hf#L=_Hf#qL=`Hf#^L="`Hf#KL=7`Hf#8L=T`Hmf#%L=i`HZf#L=`HGf#L=`H4f#L=`H!f#L=`Hf#L=`He#L=`He#L= aHe#L=!aHe#zL=6aHe#gL=KaHe#TL=`aHe#AL=}aHve#.L=aHce#L=aHPe#L=aH=e#L=aH*e#L=aHe#L=bHe#L=8bHd#L=MbHd#L=bbHd#L=wbHd#pL=bHd#]L=bHd#JL=bHd#7L=bHld#$L=bHYd#L=cHFd#L=cH3d#L=/cH d#L=DcH d#L=YcHc#L=ncHc#L=cHc#L=cHc#yL=cHc#fL=:wHSO#SLXHLXH LwH5D#LwH5S#LL$0fDoD$AAAEALvH5{S#jE1L=|HH!鲲L=,cHb#KT1 HHD$DHD$ L ^T*H5~I9 1闚 H5/U*H>ʹ H=3+L5+L֣-E1Ḥ-Hɣ-L[ 酝 H-u 8 1鮲 DD$ HuA1 1IKDD$ I-AJ<0DD$ 蟎HtOO-DD$ KHH|$H|$HHHH|$H|$HHH5 bHyHEN*H5fbH;n 1d H[]A\A]RHN*H5bH8B 18 HHD${HD$  H=0bp1K HHD$LHD$- HHH [L]A\ RID$L []A\QLI$n H=aE1鵤 HHD$HD$鄥 Q?  IWHH|$L HD$HD$HI9 ŧ =9 鬰  Ҩ Ȩ wrMM)I1I Aw~?trIEWA€A@փX N D IWH} s 1@  LT$0ڮ ? 5 E1鷦 1ڧ HLXI LIH AwAEODvA?wVtXu G?EYA? IA7E ; w)     7  צ ͦ æ 鹦 1鲦 HuX[] H=t-H2 鏷 HH$R H$, HH$)D$H$foD$H LH4$ L$H=-I9tL 1酸 HH$)D$H$foD$H< L5-KIHEHD$ILuL5-ImME ( H 髹 M9|$Hǯr1 H|$H" Ht/LIIn ˾ H=^1鰸 HJxHCxHtLIHH|$H9]IH}Lt$t+L -LE(LMQM4L-HELU7 Lt5H5K*I9t$tH' Lt$L4JIu I|$uH|$έLt$tH=K*I9~uI~uhH H] HK H9Mķ HhH] 髷 HD$鋷 H] HL$LLHSHHJ gHt YH[]HxHCxHt^H[]ZH[]߹ C @Hs  H{H HZ I~`I9eAOL)-fo$$M21IAbHCL[Aohf-#L-AhQ I MfAqMIOtKE1T AL9&H H9@DN,v H H1E1 HH L` N$ HuHs IKM|M!X HM M O M 1 J M,o I o Lk AL9L I L I4I H9 H H H56- HHcHvHJ1bX1H=ZP{ LE0_ L ;#AH Z1HtI$HLI;K~HtLP`I;IH| I$*IShH;B@:M[hI;KHU鐶LD*H5ZI; HI$L H H=&E*IT$H5Z1H?訟 gHtLP`I;IHtHP`H;I߸HtH@`L;iM]HtHp`H;׷I˷Mt M; wM$ jLC*H5&Y1I: HtHH`H;_ISHtLP`I;#IL RHtLP`I;BI6H #H=C*HJH5X1IT$H?> H=C*IVH5Y1H? LU Mu*L@ L aC*H5r1I9 L L=C*HP1H5YI8 L苢L$ $L 1HLL)H, LE1 HB*IRH5X1H;P IHu8E15bF[FE1L HgB*IVH8t!LH5%q1ޜ LE1 yH5q 1R H1H=+%+1 I H=UE1 H y EH g P H=U1ZþEH= X1 HHD$qHD$H HJELmMtLL%D*E1s H=8!LD*M8MQMc)AO%L%@*L9eu+ASA)K8' H@HZ[]A\A] PH=!L HDžE1H;5A*A` HD*H$ ]HuHy Aj H[xHuHpHH HHO$, IO$Ol"I!& Hm(H\I O$q H9JHKL II!Oc$IU [ IO$IO|"I!H| HKL II!O$1} L5>*IUH5n1I> 1Z HHD$YHD$ L >*H5LVI9 1& H>*H5UH8 1 Z]A\þEH=DS  LE1 LH1 ^[]A\A]Be( L H I9NDI NLM] I I9 I I H =*H5jm1H9 1MZLIIM\8L9 IrIRHHT$HIt8H9 I MZIII;HI;L\HH9uI;N\ f  HA L HA A1 MMHL; B*t L; >* L$ E1 Lj=*HR1E1H5TI: LI HEu HOH; ]>*t H; |B*H:PL A1H PHdTN$! 1I H9(LLHIMI!3 1I Lw AWL k1L=AVE1AUATUHH5SHH=kHAPIH k AZA[IHt H@L;r|%XL[]A\A]A^A_ Z1[]A\A]A^A_NoHJLH1N,LIEL^@ HHt LI L oI$8Hi'  L9 HgHt$e IFI~LLM6 Ht$L1 LnT IwLspd ` I$8L&  LH9 IwL7pa |$lt$H|$!9 HHmM 1H=>jo t$hH=YR1E1E1H$L-M$LLH;1H9H?HL$H5iL-iI9t"IFINLHP1M6H5oi IuA$x uMUIxtI$8% x7Mm H+D$0H 9HLH=QQc H|$7d H}1HMHWLvA$xH5hI$8H8%  L7 HsLn! dHT$1LL)J|=AH HT$HIA IcM$HM$H1M9t MHHH=P1跘x HD$0 H9 HK HB H{H HN H9E HHH[]A\H{H 1 \<H=P`L H+ L H|$ L H zL jAID$0  ID$(  ID$  ID$y { IL C ILN H=MZ ID$8'  ID$@  ID$H  KD  HtL H HI 1 fod$1LAEAe fot$ 1LAEAum f _ X Q J C < 5 . '   w m cfo<$1LAEA}Ifo,$1LAEAm& H  L E1 LMHM@]AHH[b9HHD$bHD$ E1T>9LE13 5H{(Hp!IIL4*L1E1H5MI8謏 L L E1E1WHIHAH5*VHMH81迅HLE1w D$ a D$ AJ17. Ht1&H 3*H5cHD$H9 HD$1 H=JH1 H=2H1 H3*H5HMH8 H ]LA\A]AGLt$I}HLtTHHLHAUHLD$ D$ Lo3*HRH5L1I8   MH )H5bHEI}@u It7H= 3*IUM1H5MH?蠍  L`  L 2*IUM1H5LI9i b L;3*  A H-2*HP1AH5&LH}% } IMLHL AL ( AM9>N4; H襘HEHHM IH! A  H=+4*H5|LE1H? X LLD$Ƿ C LD$IH  A HL6 ACA E1A  H=Eq HUAE1Hr tAE1c H託y AEHXH 1 A AZ]A\þH=K1 1P H E1Y L 0*HV1E1H5KI99 5 H]A\HU+ E1 HLH]A\՟HuHÖy1 H[xHuHGHH4 HHf H4*Hv 1o PH=]/*H5_H? HZLINAH+ $}HL蝼 LE1蒼  Aغ}HLINH+ $LE1g ` A/v>HEH=.*H5JE1H? 7 AL}HLe AD]L.*H5__E1I8 AL}HL'  IHE1 Ht$Aغ}HLINH+ $L蟻 H|$蕻 B9wL-iDOctMAvH=-*H5_JE1H? M DmA/v=HuHVHU>H([]A\A]A^A_T H--*H5IH}  DAHuDmMIMn (r. DuA/L}IGHEI4$M/>#MM|LHH(L[]A\A]A^A_V HI$Det,A/vYHuLFLEH6MHF 6 A/v#HEH,*H5HE1H;  ADeDAHuDe뢾] IH!HE1 IHtfM9t|HL HIMJIDeA/v"LEMHLMI8H([]A\A]A^A_ EALEDeAL]HLZ M $A9]u IM $C LE1: L+*H5k\I:  INAغ]HL)LGLE1  LE1 H=k+*H5\H?  EAL}Du]/v=HEL`LeH(EMH([]A\A]A^A_WL-/*IEt ؃HE]  HDEI4$t9A/vgLMMQLUI1MtHL-T/*IE A/v$HEH-**H5FE1H} ADEEALMDEE1IL$LHL)ELE1讷 a ELLHH E1@ LE1} H)*H5ZH:'  AAAuH)*H5aFH: 1]H~,*H5zFH8j LE1 E1 [H]A\ HH)*HKLH5|FH81z H==1 H=qFH Hz-HH$D$uH$D$H@ LE1B V PH=9=A= - H==MtL*(*H5[YI8 E1|$TtH|$(; + H+ HY H) H|$8tE1/$ H* ,M~I^H|$(HL$`Ht$hI~INIv ME1 HL@HzHIXrHEPH#AH"LE9$ HHI[H9$ L@MpMEPHRMHD9$ HI[H9w$ MLIxHIsEHHAKH HA9/$ H=e @L-y+*" I H *L Ht9HH>L1> H=g *H?1H7H= H>L1e= H= 蔳LE1虭 |LE1艭 L| Lt K@  H=4x2@ ~>EunLD L< A L/ @ ~/LEu" IB L L ? BL L ? LfBLά LƬ ? H"*H5JPH;h ? w? I9AEN,@ I95NC H9+Hl(HMi Hu$C#1D NUC AD Hs |D H=$ H9 H:G H1G 31o H#*HHHD$« HD$HHD$諫 HD$H&AXL]A\]otH5Ht_H5HшtVH5H辈tMH5KH諈tDH5pH蘈 H **H5NE1H9 9ttf!E1"LL$t$LIH=*H5qN1IQRH?HCSIXZML˒LE1` H*H5.NE1H8 I@0SH H@HJH HHHG HH0uG H=1%E1oH HHHSG UHHG@Ht0HuHW(*v8H|$H|$xHH]贩  HH衩 1蘩 H]\f HwHH HD$y HD$HaH A-ID$ T H1;LHc ( H=:/H=:15 H(I I LH=6jI EH=0H H H*H:H0 []A\HtHs H=w/nHtHM H>*H5o:H: CL藮 Y[]A\A]LE1  H=J/E1E1HtLHuI I HLD$H$CWI H $LD$HAxHtLfo\$1LA$A\$h j^ 'fo$$1LA$Ad$^H=y.A;HmTI jI E1GI Ae1%LLKIHt"H 1Hp IHufL H蹦 H=*LH@91H7LCЃL"*LL1H8I0HHH5MLG L? qH}HH t] @H 1H 薡 XL[H]A\A]}_ H *)H=8HJ1  Ht41H}t11H=LMH H}uH*H5o8HD$H:* HD$H*H58H: S L= H~*H58H8 S LIދ\$ S LE1 H B*H5c8H9 `S HH~Ht{ANQAVH ANL5*H5VLE1I>R I L f.# \ HE1J H?suH*H5`7E1H; H 1E1E1|M LIHtH6 IDžlJ LLIYJ LIHIAII H ItqH=*H58E1H?L J 1E1E1E1HD$L  IDžI LHII L-*H5KI}  H|1E1E1E1jL 1E1E1E1HD$HD$ HL L Lߢ HD$hP 1J HD$hHDžu)E1I H|$1E1E1褢 LL E11OL LE1HD$h|I H *H5Z7H9* H LE1Z H H*H56H8 H L2 H  HLE1 H LP*H5A7E1I; qH LE1 aH H=*HD$hHHauL|$h6H LHI#H LHD$h H#{P l HP L*H55I: 4LL|$D O 1] IO E1O  H0M HD$hHDžLl$hMLD HHLvD IHLHH H 謠 L褠 Ht&L萠 HD$hN LE1w N H=*H5|5H? LHD$hHL f.H#fI~zu HL{ f.!#f(zu HfInIDžfF LH ISF L[O H IHTHvL*H504I:X F Hh HD$hHDžu0L|$hM1H9t[LC HtIWHHLwHD$h+ HuHW*H53H8 L HD$hL|$hE LF*H5_4E1I;謿 gE H5*L>ITE H̞ HtL躞 HD$hL|$h'E 袞 L蚞 1G 1E1G 11nc H L*H5s2I;# D H|$h4} H H*H5I2H: D LLHHH HY*H5B2H8¾ }D L-*H5EE1I}裾 ^D LLPHHdMH L *H5EE1I9e D H=A*H50E1H?G D HD$Ph LT$PH=F E1 I Ht"HHtL L H?XK}Hl*H52H8ս HH|Ht4H%HH L L*H5DI8菽 HL HL 8PH[*H5~DH8d 1ZH !*H5J2H9J 1L AVAUATISHHXH~(HuL1 HC(Hu#S1 L;f0~L辌 HtHC(Lc0H{H{(uH LsIzIE1H1A LL* LHHH{HO1IH5q*IHtH *LH0" LI藛 M9tJ} HHuCM9} H= *LL1H5Z1H?"i H*H5_CH: H[(1HXH[A\A]A^H[]&LW*H5ACI8л 1L HHD$ HD$L Hs *H5&CH:蜻 1ZH  *H5BH9肻 HHHN LE1謚 L 1aR 1UR LH$ H$@R H_SQ H$AeP 1R H=~0^1R Lk*H5{BI: 1Q H^ *H5zBH8Ǻ 1Q H$ P L j *H5bBI9蓺 S HÙ U A$U H覙 LMHLUMM9XU T HctE @RU S HpHV H= *HJH5/HP1H?g HHt$Ht$LLyjH1 E H *LIH1% u"I}XuCM{LĘ iL H5*HLAE1H6 kE1cLE1脘 SLHiH}XH *LH.HH01, HHCHt LH(qHSLpaDL$L\$ L\$DL$_ ` DL$L\$ڗ I|$XL\$DL$HY e^ H{Xu I` L c HL$8DL$(L\$HD$0芗 L\$DL$(LD$0HL$8_ L% *H\$0H(@1IOI4$Hb B ^ HL$@LD$8HD$0DL$(L\$ HD$0L\$DL$(LD$8HHL$@L9X AD$$X HL$8LD$0DL$(L\$֖ IL\$DL$(LD$0HL$8W HL$8LD$0DL$(L\$蝖 IL\$DL$(LD$0HL$8W HL$8LD$0DL$(L\$d IL\$DL$(LD$0HL$8cW HHL$8LD$0DL$(L\$( L\$DL$(LD$0HL$8W 1HT$ 3_ IHaa LL$ D$(E1Hl$LL$8H\$ DD$(E;D$fIL$HHc\$(Ld$@1Hl1ILT$IlI9HL] HcH9|$ƒD$(Ld$@H5#yLILHH=,IEIIE1=L=IH-` L {` E1xW L **IOI1H\$0H5,I1HG` HE1Ҕ H_ 4W LNMHLLHV` HL$8LD$0DL$(L\$莔 IL\$DL$(LD$0HL$8U rIa Hl$HD$8H\$ EtgH=/=2 IHtFHL LI$ Mt+L@*HM1HL$0H*I3L L Q_ LHD$ړ HT$a LL tHl$H\$ HLz uA!L袵H] I$6b L艵0c L E1b D$0i Lt$I蹙 D$0i HT$ McNdL HtOELML+$HIIMFH'-AfA$0EDdd 龵 IWd L=\*HI7! HH{(Lu HzI7H L5 *LH3<HI6Й LLd$Ic H$Hz HDŽ$6 z kHT$0Ht$@L\$XxRHHt$@L\$XHT$0R LD$0Ht$@HLT$XP  Lf*H-HI0 / L近 IE HHt$0LL$@H|$@薑 Ht$0 HHt$0L\$XLD$@u Ht$0H|$@HLL$XLT$`HC IA H|$XLH$Ht$@LL$0PLL$0Ht$@H|$XLT$`H Mb LT$AB$ L L5*IEHH/I6# 6 HuPL$HHI M.b L=Mb H H艐 Ib Mܗ H=M*[ IHė H{8H HH? 闬 L*H,H1I3Ͼ邗 Ia D$0f LM0Lk L$0HDŽ$ELl$L$8D$0L]0H]E, ` LL I,$Hix IcLd$ M|H{0L uVAL_$-MMNL+$IfA3$0D` f` DS`LcH)JMH *HH1Xx L*LH8HI0tW L  Lt$I~H L *H'HHI18 H,*1L0L+H H9H *Iw@HHX< H H HLG H^ H5o7H=!HDžH}LwG\HW@IX_DHLpL o H5 7H=y!詊LܦL LrL=X*HH1H)I7iL豍  L%*H*HLD$I4$ݯ H|$胍 L{ ޔ L*Hh*HLD$I2訯 H|$N LF 驔 L)LH1H7I0ӻ醔 H|$`  H= A@ Lm!HHD$t+Lی L|$ H=)H&H7H L谌 L訌 M L藌 L芌 H*HH2Lc Ɠ M}MgM\$PMIKHLLI+ MMT$MBPMIxA>LH+$MeH5 -HM~@f$0DDN] fED] LcL)S`KM{M}Hl*HL҄IH H>*LH贄H IEL^ LLIK M A6LML+$L9IIIVH= -@f$0DD\ fE{\ LcL M)DC`IKI}LgL;%F*IT$PHHBHIHHwIHL胊 A>ML+ $MIIM"IVLJ-@f$0DA0[ f[ LcL=)DK`KIID$PPIHur L=+)IL$H1H$I7蚸M L-*AVHLAAUHLA_Z' MOL5)H1H|&III6H(H)IEHHr#IL$H01Lc Ɛ LV 鹐 IE鬐 He)IEHHk#IJH01ͷL x HPH9JHIkHII;s* b H52H=jF#zH߉L$蹊 L5*L$H521I>fL%)H2HI4$Ѫ H}Xf E1邞 fMnLS8HfL:"[0D)$MtXfMnLL$@fL:"d$0L$D)$ Ht$@E1H$Hǹ0 H|$@I  L)HT$HHzH L)H HHI08 HH M_H )H5k"1H9IS]Lu ؎ LL` Î g IHttLH xjLM/ Ll$@ H}8Hн L$HMHuHAQt$8AHLD$hAZA[HL$Xt;E1~ Ll$@8 LȆ Ll$@HLIudL謆  H|$0LLHL$X被 H}8IH& HLD$XHMHD$XHuH&AQHAt$8sAZA[LT$X L: E1։ IW HLD$XLL$@Ht$0j Ht$0LL$@HLD$XLT$`HH$ID$tQAT$AT$_ HL$AD$LG C H$HIEI/_  HLT$XLD$@Ht$0Ht$AD$LT$XH|$@LG$C K Ht$0騦 PHAt$8^XZLT$Xƈ I@ LLT$`H$Ht$@LD$0LL$XPLD$0Ht$@H|$XLT$`x MC H)IKHY#HH\$pH01g It$H|$0HVHD$XH$0H}8HL$HMHuHRPAMHL\$xmYE1^H|$XLT$`1 LT$`ˇ M}I}ILH|$0bH|$0I L MeMT EH=-MMVL+ $IAfA7$0E9U f0U L5)HcDK`IMfMU MU HL$`Ht$XMHIT$ HD IHt$DH鯊 LM< 韊  HA} L5)HI6Ww L)LH,HI2sV IOASH9!1L)t$HL fHAI3lXZH|$0 陿 HuHY HuHP tVtsH}H@tH}0?_AE4 Y HE HD$XHl$0H\$@F D\$X tLMH@tLM0fA9_ALMHH}HL6)H H1I0誰 LHl$0H\$@IH5.* IHH )H@H1MT$|$XHЂL *LEL*H *RArIEH1HKLD$@Y^LD$0LZ LR A雿 H=)HH7H耣 鐿 Aq L A` HHH1LD$0H褯LD$0닃M Hf)HHH0 LĀ ' L跀  HL$`Ht$XHMIT$ Ht H}8IHDHHMHuHHD$`HT$h:PIAHt$`sZYLT$`L< E1H5)MUM}H6LLT$0l LL$0Y HM H|$0I E]LH+C@ASH9E IIHt E]LK H$D\$`L$XLHD$@LL$0iH|$@H$W 9CdLT$0L$XD\$`u E9(Q Q sdIzhL$@D\$Xt$0gHS LY^HIHzpMDIH ?^L-HHDDL$0L$@D\$XP ~ M[ H}XHH\$XuH=%)H1HH7HvH|$0~ H|$@~ MtL~ M L~ E1H|$0~ H )H'HH1負 Ņ H5'H=;#zL=s)Lȱ L=d)H$Lā H$H$HI6L$IMVIVH} LH+ $E1H~EVEFMwI~PDHtCH?t=L} &} L} L)HyHI3ޟ IE f4t6A1tAuAuINHL |)H1I1INHZLp4 HpH|$0IHt/IL$HH?LAHH)H01藫L| L| : L%S)HtHI4$  L{ IhIpIHI~ HL$H`LcSPLcK`L[@HT$Hy@HcALi8H|$ Hy0H4Cln)DLG Ll$(O,Ht$8NtO"L$CPA9ȧ xM L5)HHI6N H{ H}@Hq ClHuPHHL$Q H)HHH0  L)LH1HI3=L{ L%)H HI4$趝 H|$@LLD$XLT$0_ L\$0H|$@HHv HG L$HT$@LLPL\$0HT$@HLD$XV > HLD)HItLz < L M)M8IT$`1`1HL.Lx> MwLIE H${z L+k@ClIL$DkPb Lc I|$hpI|$pIcHI8| Hsm HH H$Hu1 P H=&)D IH]H$y HDŽ$? H=h)LH#H7H; LL%4)H1H@#I4$G HuHPHH$AL$蝶ZYt+H$HtHDŽ$Iy D$0O D$0O APAIHt$`HAYAZLT$`Hc HU L|)HI3!A H! Ht$DHl L)HH!I2 Lx  H}Xt:Lx  H}X HC L)HHI3a  HC H=)HH7H` L)x L$靓 LE1x 鍓 Hx L!H=Q"HD$0p IHHD$X HHt$@L1H=Xs Ht$X1IH"M Lw 鬾 LE1w AD$D!B"Θ I~ H|$0ú H|$0Hw Ē IH H}X~ L)H HI3g z~ H=*VB HHb~ H{( HH L5q)HI66~ L%_)HF HI4$ ~ IOIWLHIE ~ LIOI;MCI MWMkMSIwIsHtLD$0[v LD$0MtLIv MtL)D{`JML}XMPLZ)HHI3 鼋 LM騚 IG I G IG ML+<$MEIMIH+K@zHHCI<$E1Ґ ~IV|$ HJHtHSL )H51E1I9= ~O IJE1HLE1H)H5E1H;R HtGH=)HL$H51LD$H?&= Ht$HYo E1qD$ LqLD$LHT$1L[)H5I8< Ht$E1SLHT$o LL$:H1H )H5NH:薏 E1ëI$Z]A\L)HP1H5bI8b< H I|$@t)H裼HHt'HAT$@HH H1 H H=f)HPH51E1H?; Z GxLL] HH 0 HLNz ISMIMBHtLZAAIDH)H LH5YH81_; 1ZLJISMBHtHzHDL)H LH51I;; HWMBHtHBHDH=_)H MLH5I1H?: {H(1[]A\A]A^A_HUE1MLg- H_ H](HuL%_) H= rL%G)1Hͭ 1l n H= rLm@H`E1I9vO l HH=TtI$HBH{ 1t LOl  E11 I,$I . L-L)HWH511I}9 \ H;*) Mt%I}tH )H5E1H:蒌 H}LgI$ $t$/Lk HE1k ˮL )HWH5h1I969 Ld$ Lik LE1^k 钮Lz)HSH51I:8 H$H x9H$H *L 2)H5kI9軋 H$j E1):L-)H51I}8 H)H.H)HE1ӭL)HV1H5tI848 H$L )H5LEHHI91HQH$L3j L5o)H5I>؊ qH5*H4 H5u*H ԲL5&)HH5l1I>7 H|$0i EL)H5I8e *苶 HzHD$e HD$銫t4t$L=)H5 I? |$ˮoհH-])H5F H} H=)H5H?ʉ 1y  H5)H= eH H kMt;LH59H)1H;v6 H|$PAM E~ H VLL=?L=)LH51I?+6 H|$PA H5H=C dH )kMt8LH58dL%)H5MI<$Ԉ H|$P:A H KL= ?H|$PAUn AE H5 H= tdHHt$HD$AQMIt$8耓^_H HL$HqH3 L;) 2 Et?D#A/vQL{IWHSIMFL H|$HLLLfI H=)H5H?؇ EAL{D#HHT$HLHL$LT$LL$T/Ht$L\$HL$x*HcAL MFDPHHDQH0LHJ H|$HLLLI# LLH=LHX[]A\A]A^A_HLH=LLLH=DLrI LHT$HLLL$%.Ht$HH 3/7HKHyH{LM?AVs=tDA/HCHpHsHMFHI}HIEIuMHt$Iu A~# HLT$8LL$0HL$(L\$ LD$Ht$6H;D$LL$Lt$L|$ H\$(LT$8NL#e HL$0LLH= DA/vFH{LOLKHLLD$7LD$HIDp HK3DAH{DLg /LCIPHSIMFHIEH=%LLLLLH=W LL5)H5I> IH H-R)H5H}躄 LLH=LdLLL$LD$讟] LD$LL$ MmH5 LLH=9 LL;-)I} H= /L{IOHKIAzu L;-z)MELT$LL$ALHt$H H|$HHHD$HL$HH|$E1LAH LT$McZL MFAsIMArIMK[ AǃL{ME1 E1A111HLT$s LT$HT$HHL*HT$LT$xH|$HHLLwI LHH=,LZI D;A/HCHPHSLLD$L0ILD$HIfE. D3A/L{MWLSIEIt&LLL$LD$sLD$LL$H^I}H5$)LD$ tI}LD$BLLH=% LDAHCD;5) H VH|$HHLLHI EAL{D38AȃLC b׭ Hu LLH= LHH5])HL$LD$HT$9 LD$HL$<HD$H=? 1LLLT$ LL$HL$LD$_LD$HL$HLL$LT$ It0HxHp H|$A} @; Mm(EeD# LLH=D LLLH=iLmH-j)H5{H}蒀 d /HsLVLSLLD$H葬 LD$H* ffK( D A/HsLVLSLLD$H謌LD$HID+ ΃Hs |HHt$ HL$LLH= H O)H5 H9 DAHCD$;/v]L[IKHKI}H5b)LD$IE tuL+LD$G DAHsD %LLH=& LAL[;Y H I}IEH|$Ht!Iu(MLLH=TLH5)ML;-A)t=I]r H= L;-)IE} Ii H-)H5 H}o~ A LLD$}+ LD$ H|$Y HL$LLH= E;D;A/ILCIPHSIMvH@Ll$H9M}QL9;H9LL\$Lt$F? uE1 N E1 H-)HPH51E1H} |$tH)LD$H:n? tN LD$E H=OLD$yLD$ E1 E1 H;) { A8A\p A8A\p I8A\ؔ LA\i L%)I$ L )H5E1I:/s I8HtA\KK I8A\途 L%y)I$ LfA\AZJ I8A\I8A\V HJIT$HtHrIDL)H51E1I; H;) w E1 1Ѓm 9 I|$HGHL H-)銢HLC(ML)鱢LeQ L-)e1HQ H;-l)1H.Q L!Q 6BHKMQJHyH{H1K4I9 L[IIMkLkMMDH9 HsMYH~H{LMTI9 LkIMELCIMILI9 HCHpHsH8K E14H=Ig1sHN)gL%B)I$ҜH蠚IHH鵜LLH=1 LE1@ LE1@ LHy LE1@ ќLE1@ L)LH51I8, H1b@ hHupHV~H{8H{PH{XH{`EH)LH59H81 H1? L? L i)LH51I9 \LHIHtK裌 HRH+)LH5Q1H;O L)LH5\1I:2 X HH=)LH51H? H )LH51H9 YH]A\1: Ht[ŞLy)LH51I8 颞LV)LH51I:z 譵rL &)LH51I9J O1]ÃҞHn> žH )H5H9_ .H H5HH)H81  IMH)H5[D$ H:^ D$ ̞ A9A0H͈I誊 H H;LH51] 胊 H[ H= HEH5)LHHHH61 l[1]A\A]A^1L;m) HҔIH L G)H1IL$H5I9 L< 1 LE(IhH LH r zH= bE1 H=ѯ)HH1HVH5H?P E1 #H}(t1HH;)It$  @ L]^ LM Iq LE16< LZ)H5H$I;\ H$ AHp AL9@@L R I9 I I HֹH=  H3H )HSH8H;V Lt;  H{X HHL[]A\A]A^3 LJ I.A , HI HmAi  I|$X  H=a H)q IHt!L5)E1 L; )  ) HƯ)3   Ht$rvHt$u1 |1 ~   L~  pLI H|$"LHPGfD$ 0x D$!x LE1: CH, C, L%H Ld$0H|$pxc( A9H H=dIANLMH>AHDA9LNH|$0H 4L=)ASH5\1WHT$@I? H$ZY' E1ۋT$ Ht$D\$PH|$H D\$PH& H= )HL$XH1H5RH?? H|$p襔' L%Ld$0cH=)H5H? R H|$poZ' L)T$D1H5I8 H|$pA,' 1 ' H )H51H9 H|$p& H)H5H:Q H|$p& AH|$pϓ& H|$0MDKH p3uH5H =Ht$0L)HT$0H51I; H|$pze& HUH HD$01U/ 1H;-E)r. HHL[]A\A]A^7L/ K. H{XuHHL[]A\A]A^P,H=UHLLA1 L b/ A1LH hHN;LQV0 HHt$Ht$>;~t92 2 HWH;W sKSOHHBȉGrHWusww{9;u H腓[1Ã靓,H=E1TH )H5H9O 2 Hۡ)H5H:dO v2 H )H5H9FO 2 H)H5H:(O 2 LeMuHФ)B3 H=Ta /4H)E13 EH=tLH5W1 1G= H= _ 1HUE1AU H= H54LL$L HD$= LLs> c= MD$(M`M\> = L;)= = LIH1> L )H1IMH5I9 LF+ > LE16+ >LE1&+ .Hu,H])H5E1H;K LSHLT$k, IHu/E1E1I|$HH|$!LE1* 鼑HT$H|$HLIApHx\Ld$HHD$L LLIGHI_ H\$HH)H IG(8w HLLE14* <: H0IGHH0IG I$Mg(eLHE1E1HHL$ H\$HD$@4$4$B:4(t}BL(HHuMIL9}ME= = LD$H8LH[L]LA\A]A^A_A$CtMJDH@8= @ HD$(4$1JL-A8u HI9@4$HD$(L9tgBL(HH@umMHL$H\H\$H9\$7L9l$ ,LJ|-L)EtILLMH< I< EuIL9t$tMM< Ll$< LD$LLM) N,0< 1B 1B H )HRH5#1H9 1B hsLE12( D HHH5$H=71HHt$cH|$PH )H50H9H 1ZoG Hp2F HHD$IHD$F fH=M1G HHD$IHD$xG HUL HH HUL HeI L`1H HUE1A HI HcHHH5H=6Z1[]A\A]h H{H/K mK HH)H5HD$H:~G HD$HH5ՙ)HJL1H}E1H6BU`M H=)HJ1E1HVH7LU9M Qs H1ZÃpLD& `! 鶗H*& LE1& 鮕InlH:)H5H;F IDŽ$H-g)H5H}F L)1HHI:9vLUAt HE H )H5vH;2F CL-)HP1H5I} HH% A+Z]A\L;S)UM M LL^M qL ME(MhMM L HH=) [1]A\1I9AEN<HGHiE1aH)HÃHH )H5HD$H9E HD$HHG$ ʚH7$ 麚H'$ 骚1N LY LZ1fInA$fI:"A\$鸚fo $foT$A $AT$靚1L-L .[ H51fInLfH:"A$AD$RL )%H=I HM¢HH=#nHHB%# ͢LH|$1H5Y D$`Ht$hL\$pfDoT$`fDo\$pEE^鏢LLvLLLLLL{<LL= " HX D$HT$ oL-X L%fMnfM:"Dd$hfDot$pD$`fDol$`EvE.ܡH|$XyLL=;"fInD$`fI:"D$xd$hfol$`fot$pA.Av鉡H-)H5 H}yB H]XfL}`1EXH=JL%H\$H]hHEhLm1H=< IL11H=(IL11H=IL1AH=1AH=1ApH=1mAHH=1L-QL辴LL-HD$L1Ht$HtH=1gH=1L1MH=gH5LHD$1+LD$MtLH=1H=1L1H=H5tLHD$1HL$HtHH=81H=+1ZL1H=:蹳H5.LHD$1}LT$MtLH=1bH=1L1HH=bH5LHD$1&Ht$HtH=1H=1L1H=H5|LHD$1LD$MtLH=61H=)1XL1H=,跲LH5HD$1{Ll$MtLH=1`H=1L1FH=ƃ`IHtL`A$u}Ht$HLH6 LH|$1L2H-fInfH:"D$`|$hfDoD$`fDoL$pEEN邝HH=L1L%SBIME1HL$L9T$IELLT$J41cLT$IH5)HHH6? `HLR fMnD$`fL:"D$xDT$hfDo\$`fDod$pEEf齜H=1H=S1~H=b7IHtSHH55u*蠩 LI MtOL1LsLA E:H=1ڔHčH=1鿔H詍H=1餔H7HLR D$fDol$ LAEn龛fDot$`fDo|$pE6E~颛H;\$LKAA zӊhH5LH=,1NL=EL Q D$`fMnD$xfM:"D|$hfo\$`foL$pAAN foT$@1LAAVLHQ D$L=LD$ L L Q HfMnfL:"H|$1HUQ LfHnfI:"D$`|$hfDoD$`fDoL$pEENPL LL=0{ Ln fot$01LAAvH|$L=L|L;L="]HA\A]鲈I|HIHuE1hLLMLu|$ /LuEHiHEHtVAfo$$LDA$Ad$靚LH聙IHtH}Lufo\$1LA$A\$Q`A鮚HtAHt$LD~HHt7L9d$s@LHL H1Dt$dTDH,fo $foT$A $AT$銚H H51fHnLfH:"A$AD$QH鍚1铚LHMfo $1LAEAMfo\$fod$ A]AeHLLx鿚fo$AEAU騚D$[ HD$%|$H|$uE H|$ HtL7LD$(Mt0L M鶛Mt!AII빸鐛IʚE1=HE1[-DL$DD$HL$HT$H4$Y|H4$HT$HL$DD$D)DL$,AAAHDD$HL$HT$H4$DD$H4$HT$HL$HHxE$H4$L\$HT$DD$HHLOE1L9BDAAIIE1nEHT$L$EU H|$H $HtL)Hu}H([]A\A]DD$HT$H4$HL$w DD$HT$L\$H4$HNAA1H>D#AOiH $H|$vLLtH5 H1fHnLfH:"A$AD$tLE1j0E1H ':HHtHS(H|$0H艚|$0IL|$8Lt$@t$HfMnfM:"D)$fDo $A<$At$EL$foT$1LA$AT$ڜLl$0HSPLHL|$,視|$0uHHS(LHI|$0ALLHZ|$07|$,?BDPHr|$PuHsHߞy1L5L= HS(LHb|$0LLH؞|$0L$,tK0鷛{8ueHs(H{T鱛o\$8t$H)$11mol$8t$H),$od$8t$H)$$L)7H=IHAELL)Hfo$LعA$AT$:LEHHpL HS(Hl$ LH贖Dt$ LD$(LL$0E\$8fInE4$fI:"A\$AT${8t L):H=I H{HH5?`肐IHDL H1fInLfH:"A$AD$tLLB"1L L A7H_LH轕Dt$ LD$(LL$0E C4HSPHl$ LL=~_HDt$ LD$(LL$0ELHS(LHHD$JDt$ LD$(LL$0ELLH$Dt$ LD$(LL$0EpLWHt$LDŽp贔$ppHsLHS(LH賔Dt$ LD$(LL$0ELLH荔Dt$ LD$(LL$0EL+C4驛HcT$HT$H|$H|$ 1AL L foL$PLD$HLL$P)L$0f]<H{H&LHChZH{h:LA<D$H|$ L L H|$ 1AL Lg ug%|$|$DA tAtA uTچ)1|$|$L7)I;_ƚL )I:H鯚L )I91阚ƒϚ1|$|$=HHD$H)H H|$HHD$H LT$I麟MtLL\$ L\$MtLm Le :H褨 IHt&HHH5 LA/ EoHT$0Ht$(HT$0Ht$(͞LE1 H=1HG7 ILImLI< L2)HHI0- ~< H}Xs< LH5d*!O HHtsH;<$txH5d*7 IH>< HP\: L5[~)HHI6q- L < H=5~)H1H7HK- ; H}X; H })H5H9谾; H5!d*LiN IHHpH$H5c*L `9 A xLLFCIO1A.L-e HHH1L< IHLM 29 L})H5I;ս9 H}X: H f})HHH1, : : 1; H}XIGI8 L%|)HǾHI4$+ SH|)HHH0+ 5Lz)HHI3+ ExD%6 H5h{)HHH6^+ 9 L=*|)HܽHI7@+ 9 9 1O h6 IE1LL)H IHt,HH LH H9 H]XH19 LH+D$-,HD$VH|$HD$ H|$H+=,HD$H=_)D,L HPHL$(H5H?E1QHL$(LD$8LD$Lu,ZY8 LVE1MAÐ8 LU?8 =),,H$,HD$7 L y)H[HI1) o8 A1Ҿ.LIb HH;HtA6 1Lx)HHI2}) H=I)7HH=ƀ)>H5z)LH1H H6558 LQH9 19 AUIATUHHH艍 IHu$H}XuLHHH})H0- L]A\A]H=}9 X S H=,H蟾H 陛,鞛X]A\HGHHx`tH}HH]H|9 E19 Aw9 LE1 H|)H5YH:& E1H$fH-x)HRH5 1H}_ E1HH=YX`a遝H{)H5H8"& 1鄝1ӝɝ1麝Hd{)H5غH8% 1Z1L [w)H5\AI9% 馞HH|$t HGHHZ H= )1f> HHD$$HD$= HH}@ RC AHxH}@ HZ ? k  C @ HAYL[]A\A]A^A_j 5@B E1@ H=a5 <E1@ H8[]A\A]A^A_q, D H8H=[]A\A]A^A_%(HC HL$c\H\$H+H4C dC HHJH5E1H=ͷ]L%Iw)I$H=E1ǝH 's)LH5M1H93 駝LrMPHALL3*HL$Q1jj H HHL=tLm鴝Lu鸝LHxH5H=ĝHHSH5H=i1A\H ]r)LH531H9i H<H=-r)LH5S1H?9 뮃ٝHt@HHHD -D L ^D  H=G&TD HDD H[xHtHHHD LH}D L s)IPH51I: LHPD L HuL q)H51I9Z H%D H5 v)L8H=r)H7LpgLpC PJHZL yu)H5I9 HC F =G F IIH LVHF II6G IIG LsMLshMLLAԅdI 6 Z L=n)1M9IZ H5\ H;] gB] HGXHC"^ HCX_ HCXHH{H^ ^ L "|"AH ͪ1HԾHu~`)a H==d*IHC E1HLj)LE01HH ̾I2 yH軜FC H` H襜` d` HT$Ht$H|$ LHYHHto HT$Ht$H|$H ]A\A]] HHrYLIMtAYAZH9HD$HA|$HLڳID{A|$L H LDMD$Mt9I$H ZHtAL X)H5<1I9 NLKLKH HH HL KLLHH/\)H5HD$H: HD$HH>I$HX)H5H:q H1k1dH{ H X)H5H1H9Y[]A\A]0 [ H{IO H=X)LH5ƲH1H? LE16#,\H==|,HW)H&|,H8.H&] uhH=\)LD$PLt$H>~H51H?MHZYIHu^E1!HV)H5E1H:I Ht r[E1HV)H5=E1H8 HE1L9/[E10"9E1# H=kE1#  LE1fH=7V)H5H? LWH3LW0*HH>LZ)H5E1I;g DEOMt I$"|IHu Y[]A\A]hZID$H5Y)LID$DMI$fEL$ DUOwIHLOE1,IL5Lv MH"U)HYH5,H81肰 PHT)HH5;H81a ZPHT)HH5@H81> ZH5zH=Z H5ҢH=[ LLҿuHHKH9uH}\^HL}u6L H5WH=Z H5gWH=Z H5H=Z H5WH=Z rH5H=oZ _LoXL. H5VH=HZ 8H5yH=Y %LIE1HDH=13 IH=p/HNҬ "I|$H;ttH|$#HI9$8H5H98}ID$HH|$HtLE1Ld$MtLE1ILKXgLLL$L$ L$LL$HW)1H5R)LH6 HC`HR- HDs_H5H98HHtHxH:taH|$HL$HT$ Ht$(LD$Hu)LL$LD$Ht$HHL$ HT$(8VH|$F>LnLR)I8LOAt @uBE1逐 L=H5MtL(MtLLE1F H$H501E1趬 , HD$ H|$AH/ 雏 L5Q)H$1E1H5I>q H=0hI= HP)H$H5i1H;6 馏 HHT$HL$Ht$:Ht$HL$HT$x>} w HHT$HL$Ht$‘ Ht$HL$HT$C 驑 I̒ IÒ HsHHt$ I鬒 Hߒ HHT$ILA蕴IH M鱒 L]H鼕 Ht.HHT$ILAYIH} Mu Mm M@H IpHHLHҗ L1R)H59I8 E1鴗 HT$Ht$H|$LD$Ht$HT$tSIxHH9HNH! H9 HR)I9X Ax  LLD$LD$uE11 IpHFI IPHHHL IPHHEXftLE1VHx H@jHuMu pH$L[HMuIHL[]A\A]A^A_HE1- LIL LLH|$XHtH|$PHtH|$HHtH|$@HuoE1ƞ LLD$xMuLD$# LD$0Ht$(HD$ H|$LL$8LL$H|$HD$ Ht$(LD$0 LE1_ E1R H8LD$(LL$ Ht$HD$H|$8Ht$LD$(H HQ)Ht$hLL$hL9IHLL$ K H|$HD$$ L5Q)H58|E1I>G Н }QƝ I9 遝 H|$E1]馝 7 DQA L-pQ)H5{E1I} " L%Mnئ L%8Q)HL=Q)H=K)DH5~1H?蔧 L,HHuH{HY[]rHCH5,1H8蕲IUH=L)H5C1HMLBH?L& Z1[]A\A]LTH1[]A\A]A^A_>PL6L.H-]P)H5zH} HL$H$H$L$ +D$ D$ 1L!DA# H鮲 HtDA/HCDJH=EQA+ HHT$ Hf p@LDHv HH 镲 H) H=fEDZ D#A/vhHCOHHT$HtKDA/vSHCHCHT$۱ HT$ѱ H=s AD"H= [ 騱 AD#EkD+A/wAD郱 L-(HHT$L# HHT$HH?H u Lm1LA$0HH q # H f*f(X HK)9 1Է LHE1̷ ILHE1鶷 PE111LD$ APLV*jj] H HHHt$ Ht$E1O6 IL "HiD$HfHD$PLL$0H)D$ T$8T$XRE1L*1LT$ ARjj H HHtAHaH|$ H|$lHG)Ht$XH8肶I赃 ILD$ LD$;LHG)Ht$XH:BIOHQLuLE1j*LE1ZH&|$ED$Aƃ DI4LH Ht1=IHAZH F)Ht$XH9蒵Iʂ |$H^H薃 H= HtHHHr 7 H] H[xHtHH1ҹHH=w u[1]A\PH hG)Hc1HT0)HH9H5 1ZCt +C g HC M LCH<m 鉻 O ?E1MM9AHIHI E1҃|$t{CtI 1ALHLT$L. LT$H^ IM9uP LCHl1ALHLT$. LT$H! IM9tCtUIr  E AMIIM L9u+ LmH# H(1[]A\A]A^A_E1RAL)HHT$R1jja H HI9}ƾ ׾ I9} Ⱦ 1+ HG)H HD$ H|$H/  LME)HWH51I8П 1IH1Z I H=]LH5`HtE1! H= D)H5}H?v L  1 It$H HH=H5E1Hƾ HH[]A\A] .赥H$H $I9L$H HH=[]A\A]H W He H5'D)HJL1HH6H1m  H 9  I M 1 H=\H) H= LE1- H=3H) LC)H5(1I8 LE1S tHX[]A\A]j7 L_ H5LtHHHT$H5S+% H|$H LIH|$D$D$e 1u V L;%C) ? WAH1L )HD$Pjja H HH1"HR HאH5!H=*1H gB)HPH51E1H9 FHYA\A]HI HuvD$8XL-.A)H5I} )L A)H5zI9{ E1HL$(HOzE1H55H=21MLt$xHT$pHt$hH|$`@ LLl$xHH=)BHT$pHt$hH|$`H{HtH.L&H}HE16L-N@)H5zI} E1H/@)H5H8 +H@)H5eH;} HH%H5H=<;HwLL%?)1H5܏Lt$xI<$0 HIL5?)H5šI> L-IA)H55I} |  Lt$xHH M?)H5ELt$xH9 hH=-?)H5H? )H?)H5ӠH8{ DT$D T$ D T$LA)H5I;fxڃ\$8uL$@L$HL$ HxE1H5ӍH=}g) HPE1QLA)D$@D$H=(?)LH51H?謙 ?L(>)LH51I8茙 D$8~H==)H5wH?d E1H|$0L_AtfHt$x?C HD$0Ht*H轜H;D$xYL%=)H5iwI<$ E1lH=)H5Lt$xH: HL$0HvE1H5H=|%1  Hu;L5,=)UH51I>萘 HL==)H5aI?p EAHT$8Ht$0H|$(\ HHT$8Ht$0H|$( H-<)H5cvH} AHHH5H=L%HE@u E{HGkA)H'<)H5OAH8 8 H;)H:{EVL ;)H5I9F 輡LHl;)H8LzMI_PLA1L{)LHD$HPjj H IHA\LZ;)LH51I;辖 IH=:;)H5ÞH? .D$ 1L?)D$ L%LD$ H|H5?)Ht$H~:)H8z]z P?2 1Z(x Hnz Hv:)H5H8 Z1[]LbMPALq)LHL$Q1jj H HH1{ HuI2HE1H=%PH9)H5bH8A 1ZL 9)H5I9' WH==)H5GH? 9r*2>"  HH 9)LH5I1IH9賔 aPH.9)H5H8 1Z8E1Z1[]A\A]A^A_ HH=H=)H0 & MtHSH5L1HR$ IHHC LIE1H5ٜ H|$H->=)HEVL %9)H5TI9 L|$ME1M1IHIHt$Ht$Lv$ xyH|$HtHD$LSH=],1LHt$LT$Kp HD$IHtCH;<)LXAL`8)H5I8 Ld$MdL`ME1M1H?7)H5țE1H8 H;L- 7){I}tH5E1k H5OE1W 1'1ҹLH=g 6a{ tHSPHt H;S@gH6)H5E1H; jE1H`HuHL$ME1&E1CLHI0H|$H:)HE1E11j1cHpHu.Hu HL$H=I[,LHL$IIH{0HHHHs0 yL5)H5I: 1p8 uh趾 HH|$H<:)HHvOHHHH~YLD$I9X0HL xLD$H|$1T1MH H9HBH.L 9)H5I9< H|$r1   9IuH5>4)IH>bt|$ ;WE1Hϼ 1HAs LHH;E鮼 HL H='A酼 HL"8Ah HHD$H3H|$E1HHnD. HF3 H E1H3){H:tH5}E1 E1H5E1 H_=H$Ht$GMLE1yy HHt$H|$袮 H3)Lt!H5LAj AH5ELAI  H2)H5uHD$H: HD$Ht$HL }u3HHT$Ht$E1H<$[uLE1 eHHHHtw H/M1Mu1H6)HL谿1L*2)HH1HI0;H|$L LqW1蠗HI#n HL1)A$H8pqC ]HDž1Ϻ 1& Ed$A LkAu HUt#H4)H5ϖH8ruCLkAuH]N H-4)H5H}`r* 1铻 HuH$(H$Hu1ɺH)HuH*HuH$)H @0)H51H9 /fo"DLl$hDŽ$ $)$A$菽u Ho1IHH~H5E1H=lIH5 L2EAuIEHW/)H51H8 FL-:/)H5i1I} 0L/)ELbH5ID1I;u L=.)H5r1I?X A11D$h t$HL/)H5I8 L1LH}( L Y/)HܠH5 H1I9Չ IH脁 t?IHT$pH xH\$pHH{HkLHAnHD$HLl$E1Dd$ILH9Ml$H=CMlIEIH$LLLD$ IL=D\$ EaI;l$H$Ht$HDHyHELL5(1)H5I> H|$pߺ H5.HH-)H81z I@H) PtQIHT$pH 0Hl$pHH=ÖHH|$pHlIpH IHT$pHHT$ H\$pHH{H{LH|$jlHD$HnDd$ E1Hl$0HLH9\$LUH=M$I$H/H$LLLwD$8GLfD\$8EHD$H;EH$HL$HtHuL%O,)HH51I<$҆ H ),)H5"H1H9譆 L ,)H5ʒI9 }H+)H5H:w b L+)H5/H1I8R LmH=MlIEFHD$xL;-/)IL} \IHT$L! Ld$xM(H=oFBH|$xMLl$Ht;FLӷLl$FH=.)賷1L\$L;]iHD$0H|HL *)H5I99 $H$LHL^EHD$pH>H$L.HHwL))DH5̔1I8„ LLl$Dd$HD$pL= HHyLt$Lp Ht$8LhD$HDt$HHD$xL肶IHT$Ln MLl$yH ,)H5;Ll$H9 PLb,)H5KLl$I8 0H=:))H5H? L))H5H1I8螃 {L ()L1MH5Ll$I9v HHl$0Dd$ HD$p薵IHT$H *Hl$pHtrH=aCLH$LHFACEHD$pH$H$H|$LC HHXL ()H5PI9 L()H5=MLl$I: H*)H5ґH:j GLd$xMH=(BLH$Lj0D$HBT$HdHD$xLJH$|$\L H6HD$HBLH|$H`H-2')H5ÎMLl$H} HL$LcNdHLH| HLt$EMH IVHL&)MH5͑1I:K HDŽ$鹴 LH餸 H NHL|&)H5j1I8 HDŽ$q H$M[ $ȉD$M  H=JiHDŽ$# Ht$LL4Hi H H̉UHtHDŽ$Գ H UHHL0 LL$HL\$ HL$(D|$0T$D9IDt$ LD$L3H#)H5"i1H;~ 1H=r#)H5gH? 1L̰1qHF#)H5gH:o 1TH)#)H5ZgH;R 17H #)H5+`H95 1ID$(LE1ZrH}HH$HE10tCH{HIMt#It$I|$ <LHHfE1HKHQEt4L$%)H1HI8stHE1褯hH=")H51H?G} HCHHH>A`IEL !)H5Z[E1I9 H2H=n!)H5OE1H? E1LE1b>1HcH9}LHO@LHà HuHH|$H$蓍Hl$H$E H=#)H5AH?F H~HuHHH$DHl$H$.AHH$HD$HHtH$H tqH~ujI|$`tYHHE1.H=%)H5 xE1H? LE1ǭH%)H5dE1H;i H;-$)u I$H- )H5 E1H}7 IT$8At$(I|$[]A\A]A^vYH1Dq1IL1.:~7H=!)HH5GH ՐHEH51AH?z AHq)H5AH: "IH5g )IOtMIqHMa(Ht$HL)H5I:J H;HtLHE1s)Hl$1LH9 u*Ht$ H|$\ HH; HHu:E1H=O)LL1H5PE1H?y L%#)RHJLb HL$E1pLHhXE1H5|H=mSbKIIHHuHPLOIHIHLLcNIpRIHHuHWLCOIHtgIHLitHL HuLPWIHt4IHL6tL٪E1LĪLE1蹪E1I@IHtHuLVIHtIHLtLePL)H5I: AoH)H5å1H:w ANA H)H5H8 A%A Ln)H5ϤI; AALE)H5ޤI8n AH_ HHuLY[A\ I<$1 HHHt'L 1IEs H*HuE1LE1腲HH IHh HHLtHH<LE1DLHF IHtHX HHֹH=sK 1dLHiH5sH=r1@L@tLcImhLLHEHH3H)LH5rH=rHR護1HHD$iHD$lAF@1]QHY%H}H2 HӉ=tHAHAԸHӉ=t&HAHAHAԸH Ht赭HH=HHH iL%5)I$阭 t$ LH5qtt$  H5qLHvqt$ HLt$ H5YqLt$ H5ZqLOtt$ H5*q L/tt$ H5q Ltt$  HHAՅ$ HD$ L )H5p1HI9s H^t$ t$ H~u3H=e ` [ V Q L HH-;)H5xp1HH}>s Ht$ H7IJ -L)HP1H5KI:r  H=' @J 1Àà 2  9  It$H>BI|$8L0H[]A\A]A^A_H襤 ' H=+E1 H9AEN H]{@DGAv  ۟ HNoH )[H1]A\H1\jH=)HhoH71HE1>j H=)H3oL]A{@  At]HE1$ <#u6BH < u HH=M)BH A@H?HnC`n{`uKDcJHC`R 1B G`"G` HLUIHE1LSpMHIKt L $xHHtgHCpH $L[ <L@HtKAKDMcM9H{ :C`%1m DHH 1C`G H9C`DEHDAp<{`CHDcf HDEZDAp{`HDk?HH H HH HHhv IH H H#H HH(v IHHLH1HHLH1IH'{`Dc1H G`1 C`{`DkH>IH{`DkHv>IH{`DkH H{`DkuwH H{`DkuW#Hv H Ht HHH{  IHE1HC` H HH HHlt HHLYH Hh3H HRH$t IH>H-H-1H} HHS LL HHHC` H+ HQ#H H;Hs HH"Hks HH2 H H#H HH+s IHH{ HS HHC`Hr HH{`Dk(H;IHDkH7C`Hs@Ht bH} C` C`H/1PsH{ HfnHfAnH{ Hf:"H fA:"fl)$# fo$HHt^X8H{ ) HHH C`h Z L C`룋5 G`kH5g1j 1鰣 wH财AG`7EA9 1 AG`EA E1 AE1 G`i HuEAB EAG`A* AG`A` EA A fH EAG`A H轡AG`@EAB 1 1} E1 AG` A`u EoEA LcEELLJ AE$ Hc}EALLLH H}P H([]A\A]A^A_A鬼 閽 H)HfLH01`Hf LHPHHA頨 AG`!A`~ A! H5 )AM L1HȗH6`HHuH AAG`ռ H AAG`鰼 LAG`A _Hu5AE関 AG`c AEu AEAG`Y AE除 AG`A Ar AG`J HXAEAG` AG` HuA| Ao AAG`Z MLD4$<Hu%A$ AMLD4$ AAG` AMLD4$ޱ AG`H AGAG`A-A AG`霭 A銢 AMLD4$^ ]Hu(AE鎢 AEz AEAG`^ L, xrIGHcAEO`HȋZDjuA` AE EuJLDHH2 AoAE AEAG`ġ AE鰡 AG`i ٮ Ll xPMoLcAAG`ODEPAxDT$P|$@u:A`y A A AAG` EAqAApLEgK HHt; L6 Ht)L$ Ht1L LA`EguJL Ht8 L޻ Ht&LAfHt1LH5 %3AAA_AE AG` A`AD$` A|$`Et$鶴 L#AG` AAMLD4$AG`d A锶 LDHH Lغ A` L H L誺 Hܴ L efHnfH:")t$H AwI« HhfDn $fDn@HfD:"@ I fD:"fElD) $f HHt%fDoT$fDo$H@DPDX8H^L5IHHˡ DHl AAG`_ A$鈳 L茧A|$`i L蓹 HS L} H= 1LE & H^)AN HSLH01XHHtA$P H A$AD$`ղ A鍴 A~ Ao AR HH AAG`; HxAAG` Aߜ AMLD4$鳫 LD4$+AG`AD4$\$ H,$DMDd$A AD$`mW LХA|$`t L׷ H^ L )H\L1I1SWHHqHb A$AD$`T H )H"L1H1WHHHAAG`AG`A鸲 AG`E鳛 AG`骚 AG`# AG`& AG`E AG`El L)ML1HI3>VHH4AMLD4$Щ u-L/IH A_邦 A$ AMLD4$醩 HuAAA`AEwI Dw1 PHu,A8 AAG`EKAAG` A# AG`A`utMcoE9o Mc' Es1錚 G`A`A Dp1c AG`A`u%McoE9ot Mc郜 A靰 EA Lj M_LcAA`KˋrDj4$uA`0 AEP L<HHf A_LVAOA`^ZApZ LEo7 HtBLb HHt2 L Ht L訣HtLA`VA`Eo) LԳ Ht LGb HtLEA`A`EoN L蓳 HVL} H@H)HXLH01RIH(A逤 AEܕ EA& AEAG`鰕 MLD4$J AG`QA`AMALD4$ AMALD4$ L荲 HHcM$HcU ASLL)LAI1ASII2[]IHMLD4$H8AAn L HPH )HWL1H1QIHMLD4$)HtAAAG` AED Hu!A AG`香 AAG`߭ AMALD4$鍤 MLD4$MLD4$vHAAAG`J AAAG`. E1Eq EA齧 AG`A`McgE9g Mc AG`A`MIc_A9_J LcY Eq1t AG`A`EgE9gL螰 MWIcA`IʋXhIcwA;w Ld AG`ϔ AG`EA AG`AA`AEwۓ E1Es饔 AAG` A Aի MWIcw1  Dw1S EudL0HH 鞪 hH EAG`A BHj AAG`] AN AG` D4$\$ H,$DMDd$HM AAG`@ H AAG` Aѩ A© D4$\$ H,$DMDd$ޣ AG`# Ls xNM_IcAAo`M,EMA]D $u@A`ޘ AK A< AAG`% uL0HHT EgA AEo`EgEL6HH vAG` L苭 M_IcAAo`M EQAYD$uA` L1HH EgEA馣 AE8 MLD4$Dd$TAG`AZ HAAG`AG`Ø AG`酐 AG`AG`l| AE铎 HHFH5JVE1H= QӔHo(H551E1H:ե +XE1G`1 L}L%(A_@M,$ wL5IcLHe ILPIc1MPASIILIIH1sZY) MGM+LIL|$ L+|$(I"IHEHt$(LH_C<H]HExDH;HLHHHHHUpLbD:LHӳ A$9t:}<(  鳰 Edΰ AGTD鸰 L|$ L+|$(IQIHtxHt$(LH^C<H]HExDH93HH}pHHsHt.H]xH]HEp  ILNW餫 PH= Iڂ邫 C@A<' Dm_ C@A< H.(ILL*H 4(ILL)L(H+H1I2~H 1H H-(H} Ъ AtH鶪 HMLH1"H險 1<H (,HT$Ht$H|$製H|$Ht$HT$I 1v LՅuHH0 2 ; t]tv@M\$HtM\$0E, LA<NAF@; H=j(H?m t7AF@A< t3@MD$HtMD$0E,@酿 M\$HAF@A<޲ MD$HIF8A# ۲ H5LH="h}H5LH="U}DL Iv8DLA+ H 1HA+ HH []A\A]A^A_AAHA (: Mf8L#MFLE H/HcD]t&H5XHH L1[]A\A]A^A_ډLG H5LHH L1[]A\A]A^A_DH5#YL H0DLOuA<z Dl$E9u.D,$ DLA IN8H IVHUB Dl$D,$逸 IV8I L1EH5A<HI IVAE LL$ADžML$AG HDH5KL1鋽 Il$0$ Il$H 1L7 LI~Mt*LwiLIl~MtID$IF8IF AF@& MF8I EAII MFEAH5~L1A<AF@ A 0 ϯ HD$ cLHD$HHT$HD$HHt$H莭 u,H|$XLL$(I)IuH55XlA\ A $E1鶲 M^AF@A<M^$ Adž A L| .Lo ܳ H5s}L1A<AF@Ю EDE;t"HH LH5|1[]A\A]A^A_HH LH5|1[]A\A]A^A_ILcBD`:H5{`L H5)I|L H5Ih|$AD|$LBD$$EF DAvP$AADI^AF@A<I^ѭ InAF@A<In鶭 L$ H5#HE1 -H5HA  A A  E~TE9 ٫ Idž Adž 龫 L H5GLInAF@A<In EVTA8Adž E ڬ MF8IF#LFL9E@ A8 IAsI@uDLM`L$ M~L $M9LϺH5DL $UL $unM9tMQEx_H(BuQL#INA9HME L Adž ت @ PIA8@ uL I^A:H]̫ HJTHtoLHHD$hH|$hHD$`yf T$L-(DbI}A]w7H5z1:G - L(HI:L[y4 k T$H5z1F H I/t7Hy LE1 y H޴K 1Y 1 H Lc$ HDLc Lc H HHǃ Ht$HI IHHD$HHp,HT$H{LWHT$HSHS{tLH/tOH%x Lcp ǃ 7 _HHaHpLc? H_HwLc&  H5(H6{eIH1HHLH}HH Ht }yfHnՃ{) $#HHtHH}AH{8H;PL I)HaHHL@ILL$货H$LH{HVHD}L#LkL {@ @HH=1;FLc {@  LMHL{8HMuL3E1DHCEMDI9 LhMHHMuL3AHCDI9ɿ HH$*ML$HH@MuL3HCL I9 C@M" 1@Lc AAAABGAÀA?IEu HMFHH9 H{8HC HH&H{Lch IL$HKA$ Hs HgHIR{MIT$Ml$ HzwHHLH_NLt4AvEAvJL%7(A1H H5%vI<$DE(B HLc鰾 AALMEII9{ C@ \C@Lca LtC@LcI HXzC@ Lc, 7zfo$H HEHHCHHC0H;zHHyLcս LcHkMپ LL$DL$LI9gLc陽 1LQHLT$Lt$E46\ EuVE|$HQHLAHD\ACJI9uLW LnHLbLgE| E|$HQHLXHD\ACI9uLW. HFHT AEMMDA<] - |$Lt-HD\DASI9uLW I9HD\qFD؃{fuHwݾ |$LHD\,ASI9uLWl I9t(HD\rD؃{fuHw釾 Hw~ LW6 EtzMMDfALW0A@t:EAd AF`AJ A= AF`A~` EA EA EA LT: H LcK,LcC(1H=2HcK$HcS ARH(WLH3A[[IHHp EAF`Ac T$DMMIv LMH\$8AVDd$ N HL$0LcM9DO HpN EA L H McG(McO,L1IcO$IcW VH5iL(VI2!_AXIH H EAF`A L1L\IHΰHU EAF`AH 訰H/ EAF`A" LiAF`A HLH4SHI AF` L| x 3 C` C`{`  ADV C`u DA Hu Lc$Hs{`JHt$`4I˹1H|$LH$裭L $oL?Ht$`Ht$`H=FeHt$`ҺH|$L (HF1G`I2|Ht$`餺H4$9?H4$頺Ht$`鈺HHt$z HHSHt$ Hz HSH3LBA L LHT$HL$Ht$zI Ht$HL$HT$ L-oHHLH5 N H3HN! H(H5f H;_ |$4t H<$D|$|$(E1 I}HH|$8 |$L$4H4$LDL\$ LT$H$HtL$4Ht$DLùL|$Ll$ HHD$t$8LLl$XL|$ IH~T$4D$(D$LT$ T$0L\$XD$4 Ht$H|$4DLLT$XL\$ <HD$HH|$D$(H|$CH|$HE1oC Ht$DLDLT$ L\$ݸHt$ HHD$HD$HD$ HDIjAVLL$HT$Ht$(Ll HHD$`^_LT$L\$  D$ D$(L\$ LT$X H|$LT$ L\$BE L\$LT$ tHMHHL$@*H}0H|$LMHLL$D$(D$D$D D$(D$D$4 D$(D$D$4 MxH' MxH ILE1LL)LLT$HAfD$ٹLT$HxHL D$@8 D$(D$D$4Z HLE1AH)HH|$HD$蹎L\$HxME:LL D$(D$D$4 D$(D$D$4 IuH$ D$(D$KH|$LT$ L\$@E L\$LT$ tO@t=Hu0Ht$ L(v!I$M HD$PE1H HMHHL$ LmHLl$ LEHLD$ D$(D$D$4 I}H uI}HJ47m V L9fI}H) LhHLl$H Hİ(H5H:=Z 4I}H RH (H5AHP1H9 1YMd$H> Hu LL(HP1H5'AI8 HtxM AD$ AAAAAD9 1 HHIH~tLLLH(HAAM MHE1E1IHL$ LL$T$T$C8tSCLIILʀuMIL9} E$CT<Ht$LT5DHA8 W HD$(T$E1JLC B8 u IL9T$HD$(L9t\CLHHuxMO\L;\$lL9D$ aLJ|LLL)LD$HC LD$I1I/ HmH HU LD$1 G1 L(H5?11I: e H;B( HH "?HH: H=(L@11IL$HSH5?H? L (HS11H5'?I9g H}Ht5HU H9u6HEHEH1$HEгHE<HEHEHH=&hZ1[]1ҹH=%c Q)D$)$fo$foD$H 1 H50LqP H Mf fHnfnCfAnMf:"CfH:"Il$fA:"M HEflHX0H;] PH=[He51 L(IQH5-1I: s H~(H5_>H8U 1 )L$)$H fo$foL$  G` G`H|$ΫH|$`)   G` G`: A L:AG`iA GHHa AG`E1AEH AG`A_ Lx:AG`A= G`A` A AG`軪_ AG` DE1A 聀IH DC`E1A HsZ xKHS{`N "EqEyC;CuOHEZ xUHc{LCI4H> DC`E1AX C`O HcH4E}: C`   DE1A G`虩{`' DE1A C`p7 C`E1 GHuLE1< H8AF`5A H8AF`A AAF`: A AF`רA A| AF`谨/ AF`螨/ LLR IHm h~HuUEA L7AF`NA ,~HAAF`g EAF`A AB La7AF`A }HVEAF`A* EA AY AF`臧A? A2 AF`` EA EA &}HEAF`A LW x I~D AAF`E1 EAO G`ʦA~` AE1{ AF`蠦A~`A^A9^_ LV x3IFLcA~`JDjDbu1L) HHL  EAF`A EA E1 EA~ {HuE1z A AAF` AE1 AE1w {HtAAF`V AG A W{HEAF`A EA AE AF` AF`A~` A AF`E1 H~HKT HYZUG`蓤߬yzIH*C`E1E1 [G-Ҳ1JAG`A_EAI G`A` EA" L`3AG`A8 AG`L$ţL$ AAoH=I)L`)A EAG`A AG`HT$LD$_LD$HT$G 2AG`>A EAM yHu$1 AG`! EA EAG`A AG`H$ʢA`L$ AAo A AG`莢A AG`tA`A A EAG`An EA^ 1xHEAG`A1 AG` EA E1CE1H<$0L4$E11骱E1H<$L *(LH3E1I1L G`|{` E1 HiQ xKHS{`N"EhEpC;CuxH;Q xuHc{LKI4H> C`E17 vIH C`E1  HcH4C`kE1 E1 C`E1 DE1A E`O}` DA M^McM,H3HMcE(IcN$IcV VH5(ASASPH61H IHt# DE`Ak  AE1 DE`E1A E`蚟}` DA H IH 1HH5l+ McM,McE(1H51IcN$IcV WH=ڜ(VH7HAXAYIH DA> DAfAnfA:"fօ HYN H] H HD$ HG H-N H1 H HHD$( uH}R? HT$(HDH@ u PDD$ L$Ht$(H|$0葪IXYMrDH|$L$AfAnfA:"f֕趔L,$uYEHUHH ƒytCHt$McM,H=`01McE(HcN$HcV ARLi(WHI2襔A[A^IHsHt;DE`A DAfAnfA:"f֍` HcM xiHUMcƃ}`J ‹qy4$|$ DAfAnfA:"fֵ fDnfE:"fDօ E`fnfA:"fֽ E`貜 rIH7 DE`E1A E`D}( DA G`V}` DE1A} $rHd DE`AX HL x Hu DE`E1A) DAfAnfA:"f֭ qH DE`AfAnfA:"f֥ kH=)L.) DA* C`HT$(AHT$( L*C`# k C` kf DC`A L/*C`賚A C`蛚{` k 1DC`E1A; G`X{` DE1A C`/  HJ x Hs DC`E1A C`ڙ{` ^ DE1A C`h D}s oIHD DC`E1AH DC`A DA C`HT$(4HT$(t L(C`T k 1DC`E1A_ L@(C`Ę kH=G)L^) C`膘 k DE1A HgH x Hs DC`E1A C`${` X G`{` DE1Al C`ٗ   C`賗{` k mIH DC`E1A C` D} EmH]}` M$ELl$U mHuO]}` M$ELl$ L$O&E`Ӗ& E`E`fE`T E`蚖}`]9] HF HuHc˃}`H  M$ELl$ hHtE`]}` M$ELl$ Hc}LEHI4E`V}`u}9}T # E`3}`H=p E`}`  G`ܑ}`z DE\$E1` M$ELl$ z E`莑}`DUD;U  E`e}` DED;E  3gH } E`}` M$ELl$! E`t E`Ԑ' E` E`觐}`u"}9} {fHtE`]}` M$ELl$ E` DE1E]  E`E1D_ eHu  E` M$ELl$eHuE`H5] L!(H"H1I3PeH^E`RPE` E`Z C`Dc C`E1m G`k;k8 B dHu>D{`As 4 {`p ] C`J C`g{`- ( HY> x7LCIc{`M EQEyDT$ u,H? HH C`  LW09 LWH0 HT$t$H|$Rt1H|$t$LL$G `` k1 1 C`Dc C`E1 G`Rk;kM  W cHu>D{`As I {`p0 r C`_ C`̌{`B = H< x7LCIc{`M EQEyDT$ u,HT HH0 C`  C`Dc C`E1  G`k;k '  aHu>D{`As  {`p  C` C`蓋{`  H; x7LCIc{`M EQEyDT$ u,H HH J C`n b C`DcU C`E1 C`Dc& `Hu {`D^D  C` C`茊{`  G`jk;k 5 D`HtC` {`D]D) m H$: xEH{Ic̃{`LEHExDL$ u:H: HH   C`   C`Dc C`E1 h_Hu@{`D^D s {`D]DX  C`l _HtC`O H 9 xYH{Ic̃{`LEHExDL$ uNH HH X C`贈{`Z  C`  C`Dc  G`Nk;ky  C`DcT C`Dc= ]HuOD{`EYD  C`Dc C`Dc C` DA9 C`Dc DC`E1A Hj7 xzLKMcă{`OEZABD\$D$ ukH HH  C`{`| ' G`k;k J C`  \HC` \HC` {`D]D@  F\HHC`h %\H'C`G DC`E1AY [Hu1E1* G`{` DE1A DC`A DA C`kDE1A C`t{`uqDcD9c1 Hh5 LCIc{`MEzErH[ IH4  C`DkAE1W DA DE1A4 H4 xZHS{`N "EiEqu1C;Cu}H4 xzHc{LCI4H> < DE1A DC`E1A DC`A DA HcH4C`\ DAh YH DC`AC C` YHu DA^ DAN DC`A7 YHDC`A DA ` DYIH C`E17 H83 x}HS{`J "DiDyt8E1 G`{`M E1 C;CuWH2 y`C`kE1 C`E1 C`E1~ HcHDKD9Kr H. xjDKH{Y C`1Ƀj 1ɃZ THH@ C`1Ƀ2 $ C` iE1HGH jz(H5 HPH91 KRH}(H8L53z(I6H@xt3IL$LLy;HsHHIM1HNI6y5LE1.11E1鍕HH-)HRAąt0Hz(H8 HHHuAHNǕH}(AH:vs齕E1, Hjx(H5[H8& 1LE1`|I H Hz(E`H1H4H3H([]A\A]L 3|(E`M8Lw(II9BX& Iz` H|$HT$Ht$B H|$HtcH|$YLl$LcC1H5y(HcSIHH AUQH6HsL^_ LE1 E` E`E1 HWH=x(H51H? 1 H w(HWH51H9r QIHEAG`AurQHEAG`AԗEAėLy/HHPL0A`I:I1L1LuHLHιHHtPHLEAG`A?EA骔PHEAG`A AG`zA`EAEAіE1A:G`@z֓LC* MGHcA`M EiEaԓE1A L~) HAL&IHL-HHD$L+/A`LD$IHL1LH)LHAHHPOHEAG`A鲕EAG`1AГAAG`y%PA=pL%Ht[AHA=pt|A`u4LAob$HHA`AouL&HAEEQD\$A`EDE_AE"AG`HEuZ]A\VH5m(t LY H= ZHRAG`nAQ{1鶝G`n阜A)AG`nAAG`ynA`AHAG`LnAȝA黝AG`%nl隞E1鉞CIHlC`cE1RG`m钝C`E1)H5k(Lt=H]Hk(H9^  HtCHHH P H5jh(Lu H="JU HE H[xHtHHQH5k(LutIAZH5h(L\uH=HZH5j(L2H5g(Lϝ" H=wA E1LE1^L6 E1鐟:JE1郟HpLPH w x,WDH(LD@$n1 ^_ HpL Dp,X(Dh$D` EA؉HPDDAW0"ZYx )$kHf fo$ HpL X(Dp,Dh$D` 螅AEARHDDAW%A[[ HpLw Dx,X(Dh$D`  EA؉HPDDAV#ZY Hpf(H5YH8 1 L/  8QSH$H $H9MH  HwHL1[H=]A\A]}HH=>[]A\A]L l(LaAD6xIDET6<;A|6 + L$ o j HA` H5#l(K $IfAxLfAfA\fA<9fA|  L .K E1 MVHV L X"H4M H k(LAAD6AA\6 \ Li(H5KE1I8P 2 R L H5"I4 H"I L"M K4Lk(fA6UM LT$PfGfET6LT$HfGfET6LT$@fGfET6LT$8fAfA\6fCfA\6 fA fAL6 fAfAD6fA<9fA|6j H5d(HLH6 L-h(xH d(HtLH1 ۜAG`bhuA AG`ChAAHAG`hAלAH1ۜG`g鐜HMAG`gA铜LHMtLL-b(I} tDE1LrLf(HD$L\$HD$ݞHfe(E1DLHng(LHHDHD$H5DD)P1SSSiH IHcI$M˝L%%g(I$cLE1 LH LD IH DE1Az髟<HDC`Ay醟G`df0E1yd1ɟ2<HH]C`TE1CG`f鴟H9IeE1á;HAkH a(H5ҚH9u ALLHJAH5H=9+&q;HgD$ SH`(H5pH; AH-ka(HRH5`1AH} ĤLH™AH5H=鞤:H˦A釤H=@e(H?( tX_ ئL- `(H5,AI}o JAAL5 `(H5I>fI~ uzH-d(韦HǃNHCH<Hǃ'١Hǃ鴡HCx钡HC@sHC8THC05HC(驢HC LA&H{(HHC(AhG`Wck"~D1Ax G`c{` DE1A DA C`E1ɉk 8HuE1 C`m DC`A DE1A{ DC`E1Aa DE1AN U8HtDC`A- DA LE1.鄦1ަ t#H ^](HH5=1H9¸ 鶦SHH~ HHtHfHt[C`1[Lc@ܦHxH(HxHLD$ D$ 鵦H_(ǧHC8s郧DAŨH^ xCLCIc{`M EiEa DE1A鉨DE1AvDC`E1A\G``鑧6IH,DC`A#AG``A`¨A6G`~`tDC1ͩHAG`Y`AAG`?`閨HAG`%`A鼩AG` `A颩A镩A鈩G`_{` D1EC 5HJ C`1DB DG D1EE C`w DC`1EB D1EAs ! H: H! LpL=\(McL$,H5McD$(IcL$$HIcT$ P1VI7UHD$AYAZH! 4H! C` !  H IHJ! 1HH5wT>1! L\(H~McG(HMcO,IcL$$IcT$ VPI31=UHD$_AXHG! '4H9! C`q e G`^{`? E1 L C`]{`  E1g C`LDs H H 1HH50N=t L>oIcL$$IcT$ H=LZ(McL$,McD$(P1WI2H-THD$ZYH8 3H* C`b HC0鵧铧D1A 2IH" DC`A C`! DA DC`1A G`w\{` D1A` C`D Dk1A? HvW(H5H8 1#H YW(H5H9 1[A钨L6W(H5I8 1! HW(H5H8 1! L V(H5eI9e 1! )T$)$[Hr! fo$foT$! bH DAC`N[{`ukgy1ݩG`[LC`[骩颩C`Z鈩C`Z,L*C`ZUHZ(VHHuZ1ZAkAAF`Ef1CAAF`=Z(AEApZLA^ Ht L^ HtLA~`AA~`A^u5L] HHt L^ HtLޒA~`GAAEfA~`-A1ɃpL| MNMcAE~`OEZEjD\$ tAE1 G`Y~.HHAAF`A1Ƀ֪AAF`1Ƀ齪AF`XA~`L' HH /V(H4L1H1裧HHtvAM L HL H1L6 vH5S(ML1H5H6-HHu-HBAAF`5LbMPALۉ(LHL$Q1jjw H HH֪1êbi-HuI{`DEaDApHDkIH H HH HMcN,McF(HIcN$IcV ASLT(PH1I3MIXZM* G`V{`6 DE1A DE1A C`E1 AE1 C`SV{`DADE1k; {`DkuH* IHtsHIHtc H HtQDAGApQ{`gHD{茩HH{`Ly{`DkHHYZ IHtOH IHt:Ht Ht-HGHt McN McFHSIcL$$IcT$ ARM{`DkHIHHHMgMt^M,$I~THHHL5H|(?KtLpR(LcH,Lc@(1HcN$HcV WHAVI2KAXAYIH*HADC`A5{`DkH-Ht^ H HtLHN IHtIcL$$IcT$ LcH,Lc@(VHD{`DkEH豧IH HX HvH臧HeMMMt5ME1AM9}oK|H?EDIC`uSE1Ƀ{`D{t H] HHD$tH+Ht$HHuCD{rH5P(EHH HzHDH61,IH.SH1q)HE1H=%:~(HAG`钪(HuE1酨EAG`AxEE1AeAG`iG`OREEE1A4HAG`"RA騨A雨DCHgAG`QApAG`QHAG`QADA7AG`QA`إAL MWMcA`EOEcEkDd$Dl$ tAE11EE1AE鰧'HlEAG`AAG`PAkKLKLI3H$HHŧEAG`E1A鐦PHK(H5]H8< 1ZG`lP{`B DADE1 C`IDsj G`)P{` 1 %H C`C`1k LC`Mk9 G`O{` E1 E1 1靨HJ({H8tH5/ 1[H5 踊H+骨裊Hp+饨HtJ(H5H8 1" )L$)$OH  fo$foL$T E1隩qptNHR Ht1H- u=DADk1E1;C`uN{`tH=I(1HH7H肝Ht/IߨE1G`#NC $HfDC`AZ11H{H  1[LH]A\HI(H<$H5PH:x H$AG`MA`EA飯r#HuE1EE1AwEAG`A_1L+ DH=H(KH1H7LEIHt3A L HH®LL1o鴮"HݮEAG`AЮA鸮AG`LCEA隫p"HEAG`AtEE1AaG`@LƩEA@L3 xcMWMcAAG`OEcEkD$$Dl$EڬAE1AG`鐪AG` EAG`E1A鶪C`K{`DA|$|1!gA~1N4!H7C`+1 HC` HɮC`齮 HC`隮G`Jo HrC`fC`UJ{`u-Dc C`:J{`Ӭ';H{ ] HtVHI HtcLG(L^Lc@ HLcH$HcHHcPV1ARI3@_AXHtCZHC`鈯郯C`I0fHdDC`AxXAXLHx]H {A\ZLHE1C` IDA G`Iz DE1A DE1A C`E1HDA H"C`HDAe yHtBC`1 G`[H{` C`Dc1V LE10#H-lC(H5H} H C`DE{D1 G`G{` C`G{`  1Dc AC`E1D{  駳~ƳHB(H<$H5_H: H$"HHzz HHt5HKHHt%C$Ku HsDK DCPH;tZY 1 H='@s tH;HC(H5H: 1[ËE1iE1XH޿% .H{ LHIH^Hu8E1G`UF锳;Ht݋C`C`̳ H=X(E1dLkC`E'E1C`E1EE1G`E,LC`}E鵴HC`[Ex{G`AEC`E1-EDA|$JE1z9E1~(HbC`DDAzHu^E1,DE1EK#G`DŵE1DNyHtC`DIDC`EJɵ1HMf :  L ?(H5GyI9 D$  LHH5H=IuI<$1HVH5褚 D$ } H D(Dy0 H xD(H >(H5xH9e D$ > HH5"H=(OL-B>(I}蹸 N  1HMe :  L[ D$  H=C( L-`>(H5I} D$  1Hd  M]A  ]  H0C`B頵HC`B~E1mC`E1dBPE1?G`9B鯴 H=@E1ӵLA;AE`AA!AA LU H:L? HtH G?(1HLH1軐HAIAߵA4AE`OAA}`ȸA 餵A~ApA}`LEu HAL>(LHcMLHcULcM LcEP1ARI37ZYH(HjAAE`]AE`x@cA A}`Eu L IHEEHEApA}`LE} HHt]ALL1vAHuHAAE`郷ACA}`E}u#L HHuAAAE`\?8LAE`B?AjLAE` ?A#Hu.AnLeAE`>AAAE`;ADzAE`>A魲A頲AE`>?AE1AE1ѲAE`M>%3HugA飲G`&>  HuWA|AE1pLaAE`=AAAE`7AAE` 1wֵG`=阵M錸It$xI靶1=H8(H5H8 YNH} HY O 1(E1l1X(H L/9(HWH51I8貓 1 HZ H H  PE1LaD)11HHD$Pjj{ H HH ! HH=fHT$HT$zH1[]ùH=fh aE1鸹HE19HSH=V8(1H5HRH?ْ 鈹HCH 18(H5HPH91贒 cLH#HLE1 LIE Hz5(H5sE1H: ' E1- L E1 LtAV InMl$AljAD$ A|$L$9| L9s  AY I[ A* F HMiLE1^e MnH H9HNH~pIH2E1H\$1LH9l$t^H9\$A|L0:(A<8tpHӀ@MnHtMn0 HL9  H9\$~&IC|wQL 9(A<9tLIL9t$uIl$ tL{L9|$~zC|H59(<>uxIuHT$L9tL)K|Hz=IHH ID$L,{HuL9|$u H 96(I9Nt)LI|H)=HHtQH  I|$H,M\$IHM3HLruHHLcHLE1w -uLH%LuIH;HLHD$0HT$0u H  HMLE1 mIH Lt$(1Lt$0E1Hl$ HL9Ht$ I<.ILHT$AH|$0H)uH|$0HHPILHL$0qHI MD$KH 1(H5oE1H9 B InH" Hn4(I9^ Ml$IMuA MnHuMnH LD$H9HNH}IHH\$E1L|$1Lt$MH9l$XM9GL5EH6(B< nIL0(H5nE1I:' n MVH LINLE1CX HLHl$L\$uLL\$Hl$n LH IFHD$ @MnHtMn0A L9LNIxIH1H\$1HH9l$H9\$cET]fAL 5(C<FHLcMnHM9}/LMA|@MH5g5(<>MHL9uIl$4 tI^L9}1A|@xrH5-5(<>u9HAZMuL9uHD$L2(L9@HK|5L)nIHt|H _MT$I@ItH9\$~1IG|ufAL4(C<;IL9t$uIl$[ HLt-L*LE14 M\$HHILHI6@I9I)I|LmIHtH dMT$ItAeGH|$LL9AL)LHI|5IHH It$H$LHL:H L{L9|$~8GD}fAH 83(B<u2IAyHuL9|$u H0(I9Vt-LLH)K|4HHt[H  I|$H,ID$IHL0BHLRuHvHLe6HXLE1Mb LH Lu1H#A<@]  HHK ?L)I<4HH E1 MD$HLD$ HLu HPMt$E1I> Hqu IH E1 LH2HR A LS LL$ L\$(Mu?H5f.(I9strLI<.H)9kHHI|$J,IWIT$ LI<.H)kHHtZI ~LHHu=貸諸ID$ILLHHD$8SH|$8tuLE1jq `IHl$01woG`6/1E`E1飭E1雭L,(H5IcS1H=McK McCIcKVWI2H%XE1Z]HH5aE鴭G`.kDE1A̭DE1A鹭H H:H HحH H­H HH=+(H1H7HA}IHt>'C`-{`QDAbAE1H=DC`A1H )(H[H5w1H9G  Ha j Ot$E HU @  C|M H1[]A\A]LmH A| HֹH=Ή]Y t"H ,(H3HSH8  1 AG`,A߭H,AG`,A黭q1ȭG`,頬AG`x,A`uA_鲬{AlH蹻AG`<,AHA`uOL)IHͭHEAG`AܬEA̬EA鼬AG`+GEA隬EA銬L H6Ls HD$H L H Lk IHtoL{iHHt_MG H|$LjH݇LHiIHH֫EAG`AɫEA鹫1ЭHH=HT$9HT$tHLH]A\ H1]A\H%(H5H8. HfL^LE1SL F*HtLhIL`Hh Lp(L$LLH E1LH=&(H5'E1H? HHD$HD$b LL$H$} H<$LL$H/,  M9_ y D1A釭nHu#1kC`DAZDC`ACDEEyDApHDs HH HHo HH w&(HHy}1H1wHH霬DC`1A鎬A1郬C`s({`Rk{`Dsu߾H IHtH; Ht H HtH Ht1Hc tH#(AOHHrH01wHHHMC`AG`'HsHc̓H% $HTDC`1EAEH1 HD$蹼 H|$AH/  HڭMu1 HƭL辭L趭L1謭 H|$] H|$A H舭LAF`q$A.A1N-G`G$AF`5$=AAF`$AӬAƬLdAF`#A餬E1ۃ鉮Eu/HPPIHgDc6HuE1LE1ۃDC`/C`E1ۃG`K#鏭C`hHtC`ͭE1ۃ鼭E1ۃ髭L5 "IHtHhLh HX(H@/ * AA1N鿮G`"LLMVD$ M 5AzAG`S"A`L9d$tFNDEwIˮAG` "xH胱AG`"AL\$HLD$LLH4HD$TLD$Hu"H2AG`!A­Ha1ɃP1Ƀ@G`t!鸮ZH71EHMHHk鰯H HH' IHsH{ HHDH D@LDI|$ARDs sA[]HHH{ HHaH;C`G1Ƀ7C`1Ƀ 1ɃC`rC`RC`խǭAXLHX]H +RA\ .u.t6ø41 H-(H5fJH}w H1[]A\A]A^A_HL\$L}L\$ F1?H=(H5 JH? H1[]A\A]A^H|$SH|$L_ 3,E1dE1/xjHu~E1OJ<. E1G`}E`ͰNH_E`骰+H<E`釰HE`dHE`AHE`HE`|HE`دYHjE`鵯駯陯鋯}HE`ZHE`7HE`HE`H|$H t H|$bLZ H|$I}Ht(IE5W" H|$#I}Hu<" L ," IE" H .(H<$H5;H9 H$鄰H (H5DH8t 1gH (H<$H5KH9S H$隱H(H5\H84 1}He1% HH$RLJH$% 1% E@A}HEE@ HEiHRHK(H5tH: 1H.(H5H8 1H (H9!& aH (H5vH9f 1dzH(H5H8I 1骳H(H5dH:, 1鍳HHֳH;(ɳMI³M饳qE1HtD9~ H@AIcHHtepE1L=wHE9~gHM HILApHL$L$Ȥ Ht$H $L1HvhOHt JDHmH藢ID$XLE1胢I\$XH(H4$H5H: H$S1H(HH5kH|$֩H|$ÅH|$~ H|$L1H5v1H5H|$荩H|$H5jH|$sH|$H5 hH|$YH|$H5BH|$?H|$dH|$ ljƃfH|$AsAE A H|$*H|$ H|$L1H5Nu&1=H|$ )H=N(IHtE1# H=(H5e1H:n # H״1FHLE1藠E1HL]1A\A]E1:% H% HtHE1!% HtHE1% E1 % E1% Ht HE1$ E1$ 0t!H ($ 0H y($ XHx߀B$hH U(H<)# H[H>E1$ Ht HE1r$ uH ( # E1U$ u$ f$ T$ H (_# 0H (J# H (># DPLHAAOu4DXH (HB<# Ht/LE1# H" H d(L" H U(" E1# H A(" H 5(H" HLX߀Xu+D@H (HB<" Ht"LE1A# H (Lo" E1*# E1"# d E1Lw(閴11 191S ``tHk@<1Hk,Ho#G`~qp HE IHt7 H0 Ht%H Ht1H uSDEY{`DkA1)DX1C`/{`cH=(AL$1HH7H3cHt ĴHnDC`EXbH_H# H|$H|$# I# LFHA8_h$ Ax_I\$InI@A|_w$ $ HV0% It$J@tIt$2f>_$ I\$InI|$.@L<fB_# ~_ # I\$Ho|_H<0# LFAt9AE# ΃@t"@AAE# # r# LE1趚" LE1覚|" MEH# MEH# AtStmILDC<_# " ~H_5" ~I_uPH^HoHFF|G_K" V" I|$Ft ILDfC* E1n( E1, 1w- H(H5 H;蠯 1( 1=0 E1. 1, 16. I|HtHL' t. 1' E1q, 1( 1 + E1$+ E1* 2 2 Y2 LID2 I|$M5 HU1HI4 EA w6 18 H'H51H;豮 1e6 E1"= 1K< 1; A; 1?6 1< 1> 1I; E1g: I8 1h: DsEV5 M}t@ A@ E19 H|$LT$L\$ LD$edLL$Hl$HT$ H|LLL$qlLT$aC HIHIB hB H$L$xE HQ1HVHHt1HLHL@ HÌC 1Mx@ E B B 1FE1E1,E111g1[]A\øhLIVLIHF H^1} J HHT$Ht$HL$D7K HL$Ht$HT$J K HA6IT$H R'1H5ѨHRH9W K AK HHT$([K HuLLdAnK AeK H- 'H55H}q 1K HHKH5KH=m-L9L PLE1L5*11LHD$Pjj/ H IHEK 1K HHJH5JH= ˘1sK H=e'H5+5H?Ω 1VK 11K 1lH1] H=9L HHL$e Ht$LyL HIL IL$H='1E1H5_HQH?;V K L'H5]E1I8 K E1LE1ezH=`'H59H? LLE1.CHLE1+Hr'DH5 H81U LE1LE1LE1LE1LE1H='HQH51H?U LE1SL'HPH5,1E1I:T H5'H8LwXMMD$L +'H1IHI1螵H1c1\Lˆ1MH輆1>H~N HD$蝆D$V M@HV H胆U BH=O臬U ]U H|$KU Ht'H5'H; U H*dO HU C^ZL w'HD$hLT$hM9QHUO aQ AD$-#U A 1A0CT3IuIaX Lt$ MVH`R A 1A0fCTeIuIIW IN0eW INH\W H\$H3~ @ @@HVHtHV0LD$LL$HD$ MH JHE1A BLL;|$ 1A0THuH$IIHQ fA-T u1 tPH|$ HOH@tHO0LD$MMLV HVHZ t*L|$ M_H@tM_0HT$IRHt$ HNHLd$ M\$HLt$E1A MMIMkI݉1IAA0AUA w|$@jS AE-]S D[HA{W SHzW 1e E1_ {HW L'H5I:腤 D[H1A{W {HxW E1W DcHA|$bW KHyWW H5tRL 'L1I8+Q DMDU&E At$$AD$,AL$(H}VAt$ D@臠mH1yo mHpo mHgo s,DK$HDC HMVC(LPx ZYt!K$S LHDK,DC(EmH뒃mH1 o mHo mHn mHn mHn mHn mHn mHn mHn 1q mHn E1r E1Qr mHn mHn mHn mHn mHvn mHmn mHdn mH[n 1t mHKn mHBn mH9n mH0n mH'n Hm v mHn mHn mHm mHm I~LL='LH531I8AC I~LDK$DC HMD{,AWD[(LHASv AZA[ZK$S LHDK,DC(;C9S,DK$LHDC LR[(Sv ^_Et L%'H5˘1I<$B DK,Dk$K(s H}AUEAmH^mHl AWDS(LHAR/v AXAY?A[L[H]A\A]A^A_陡mH1l K,DK$LDC Q{(LWHu A^A_2HHu L?tEøøDskH5$H}'D{[H:膔 I<$UDCDDE1LsE1EH=褙LsLE1tsmv L'LH51I:A L|$T$D\$xL$pt$I?ECtE1#v H=i1H'L8IXRu wHrjv L'LH5@1I8@ t$xLL$T$L$pDFI9t$1邹PH=衘ZPH'H5ȔH:( 1ZÃmHHmH1L4+D~DDv@DN1鈁 HdLdH|$dHD$ HdH|$dHD$ HdHD$Ԁ HD$ƀ MtOLL1xQLUdE 6u!MtL:dMtL-d1> Lcxނ 1F-IHuLd1Mu LcLcHtH1c L\$LT$LL9| M)LLIM)LM/ g H'H5&1H:G 隄 E1HuH隄 H5'H- /Ht$LH\ IHӃ MFNH|$H;|$H HL$H+L$J9UHL2LMwHbHt} y&E LeE1 Xځ MH蜞urHCx HLOHb 鸄 4 Lwb雄 H}H LOH+ LUby H}H̅ HD$6{^L]H|HHD'HD1H5߈IKH;/ H|$HtaH|$HtaHHaPH=*CH=Q80f_ (!H*YH,۴1{ qoa餵H 'HV1H5ևH9/ LFaµL6a鲵HO'H5EH:؁ La錵鄵E1} HuPHH;u@H賭Hu^HD$}~ H]xH '}H9H5#E1C 鈷1ҹHH= ME1bLE1M`RH'H5#E1H: 4HbȶLE1`H56E1軀 H11[]A\A] 1颷Hӷ長UL ηuIHu'H='LL1H5IH?(- H \'H561H9+θHI7_麸Hs'H5H8 %闹E1鼹酹{qg]SII}ָu)I} ɸ$!I}许魹 L%'H51I<$, 1ʋ HY L:^1΃ ă 1驏 L%'DH5a1I<$+ 1隃 LH5HHP1u2L}颅 H1] E1c 1 LD$]D$9 ~tH5H1 H5H1 LD$`]HX]D$ H5H1Ԃ IUHBH L(IOH5ͅHHP1tSLml H53H1Qw 1 E1U LH56HHP1C 1< L "'H5ӆ1I9I* 15 LLHHL)~6tE̓ Hs8HߋŜ  E1Ȉ E1騈 H5D3H1鰁 M . H5H1f錁 1鯒 H{8 IH-L]I鳑 E1w KW LE1H!H5,H=V;k颷E1 W L%'I$逷H=IlL'H5+E1I8| NLHE1H56,H=j)H=a) LZHmt1锔 HUHR0I?HxHźH'H5=H;}{ 鵸F^EfA vYfGyIIHAtFA :GIܸIuH镺IuH錺fEQfAy $E1ABI wB| RM9|1LJAADA LLE1Y˷HxH鷹AAtAE\Rf 鏹IUH麷IUH鱷FVIfA wB|V8DA mA tA t(M9XM9>AtAtB< tLJB< fB LR1L E1鱥 ML$8H5"*L1E 1 HKH/ H9% 1H5|L QLiH @tt7LIH@tLI0A9*AǮ t LYH@tLY0fA;*A驮 LIHLYHQQLD$QD$H L-'H5{1I}9 1( LjQHxL1[H5m]A\A]A^A_LD$?QD$ HvLZu  ]E1I E1 HxLH5z1[]A\A]A^A_^1V HxLH5{1[]A\A]A^A_8H7~@ NH ^ 1n E1 E1 LiHa E1韰 E1鞤 HxLH5(1[]A\A]A^A_DH5{L1 1 JtLؗ `As L='H5Az1Lt$I? Lt$1I H߉D$OD$鏘 褤H鼤 Dm8[ LO1d H /'Ht'H1q EE1=ôD A7 Z1]A\A]A^E11驸 LLއ LAƅu?O鸶E1鰶-ODt$`顶LO锶HW'H<$H5zH:o H$:AD$@cH$NE1 A~ AEAD AF E A 鲻 L'H5i&I:8o HD$0 eH$HtSNH$HD$0HBH$Hn HD$0w HO'H5*&E1H8n & EAC E1 AIAAA͐fEiIɐfAI H|$pE1M 頸 E1 骺 E1 HD$0 q EAu EAv$ ?H|$pE12M MILM1 LCMt APkAdž HLHD$0 Lf'DD1H5xI: 1V x19}7)ȹ DH1D9MuLPL9UtLUErϋH19MuH@H9EtHEEpD`1D9euHxH9}tH}EsH/LRL"LL5S'H5$I>l /EAv= L`M9 LeE] EA AEA EA A҃ H]EsLSLU靸 HpH9uHuEo% rH @AȀ1 Ha'H5Q#H;k 1 L D'H54#I9k 1޶1׶1 1H=Iv$S1ϷH9·H'H5vH8ik 1驷PH'H:Rk 1Z贕H[HHHt$H<$HxHt$H<$HƷI@pLHtHxuH=Iv4 H=& H='H5FAH?j T E1"L=~'LFPLAt$PML$pH5v1I? ZE1YHm8L5F'L1D $H5uLeHMML$MD$u(u0I>N ^_D$騷Ht*HhII H% H H"xLcxMtHAIIt|LL\$HhHT$II HtH"hIIM |HHt$HT$^"bHL$Ht$HAxHtHILL\$LT$LL$""&H|$LT$L\$HGxHIL\$LHT$IGHtLugHH} HLD$!H[xLD$HtLHHtH$gHH ~Hj!nH[xHtHHHtaLfII 7HtLfIIK H HExHtLIH HExHtLI1Ao@ID$ LIm8H5\1qDd$ Le pE1HD$ FDd$ ۶IE8L# EM8DL$&H裲H81[]A\A]A^A_LjFHbFH5'E1LIFE1N1-1E11{Mu!I@HIF/1nLIEHIEŒHu_E1E1DNؿDE1EKſG`藼g}HtDC`EJ铿C`DI}1uLH $_H<$^1`1I1H5r1AH5-rL[HJrHE1E1c11IZE111IYp L|11PH8LH5r1[]A\A]A^A_IH{ t3H5'H| t L]8HHAL 13 GE1H"'H'H*'HJ'Hҵ'11wG`ֺQH'  H5i'1 kE$HHHLE1c M9~"LEHKL%V'Hf1I4$L$pIMb=MIOL=fU\ H+HSH j B]A\A]H9HHHRLc HkH L[H]A\j1fHC(1SC1uIIH4$L$LS L+SM9FH{<HC 1}G`HAG`6AT$1AWAAG`A1wHZ<AG`ݬAAH1<AG`贬Ay蒂Hu1oD1AhDC`AQG`aD1A.DApApH, Ht:H[ Ht(H HHtHH5{豋u`Dcm谁HDC`AA1yC`艫{`[HH1ݴHHt 5GHqC`eHz'H<$H5eH:T H$LqfHD$@D$XHD$`ID$ I^)D$0T$HT$hPLALZ(HT$R1jj3 H IHLl$01II|$Ht$ DeH1AH5! H= @x7 Ht$PIA1wG`Hg9C`D]C`ЩEXE1C`E1谩D^E1D_G`胩H8C`jDYH 'H<$H5qcH9S H$FHy'H5cH:R 1)H8AG`AT$1AWAA1wG`ȨH+8AG`讨AAG`藨AAAG`v1?]Ã|$X)H$2 D$$HItODd$H=$ǻا D\$,DT$H$HAE9EBE1E1D\$, }HLl$0n HuHr HuHi a tOtvL}H@tL}0E1A?-H$I   H`là Ll$0 t-LEH@tLE0fA8- H$E1 L}HLEHH-u'H5bLl$0H}P L5A'H5Ll$0I>P Ll$01j|Huy|H8uI H 'Ht$hH9;t|H{IIH= wIu* L%y'I$_L'H5 E1I8O ALHE1H5H=ej>PH=|'H5-aH?O Z{ HILifHDŽ$DŽ$HDŽ$IHD$@D$XHD$`D$ D$)$$$)D$0\$H\$hPHA1LD$APLT(jj- H HHL$Ld$0E1:H}HtHt$ tIt H}Ht$I{1H 'HU8Hs8H9Y[]A\A]A^A_RHM Hs DDoAH} aH='LH5_1H?1|EHEHHD$ "-1H\'HT$H5_1H;H|$H|$HH HH,1 E1v I|$tWIL$(H)tVL'HLd$H;wK L ; LE1z,+ HHf, H 'L'HHLd$u H13,b11H2AG` AAL$1AOAAG`բAAAG`财G`裢AG`葢A`A끍{1H1AG`]AMDAgG`4:E1 xHiC`thE1YDAwHDC`ADAAE1DC`耡{`)DAHnQ xRHsIc΃{`HsH'HHH5w[H81}$DE,M(u WH;E@Q1LcE1]L[]A\A]A^dLH=֞'H5gE1H?LH *A1H5<[L1ʭ1H5T[L1読L-Q'IEL'EE1EtH51[L1WL1E1y@AI8IL豏 u1UH5ϝ'L'_ tIw8LH| AA2L` L$K&LC&$L3&1M_8IHH+HNH?H95LAA8'LLJ E1I I~8II I~8H$HI M@HH@udHt_|$K\_MN81Ҿ|LIAPAe t)MV8E11L LMZpMcMbp|u1&I~8H$zϥtIF83L tH5)'L] tM~8HLAՍ tIN8WL躍 zH3LH gLCMT$\$ KLcM;}}0V|$xLWLL$(LLD$ `_AXM;}|$p9|$p1HsLLH I~82L I0E1Ht$ L9|$ HH{1HJtLLĤHsIHt$LG XMn8T$ LAHcc .I~8LHwpHnqHop Mf8H$L6Il$pAl$xA$H]I\$p AA|$p|$pHt$LG IN8DD$ LAIc3c EnHt$LF YHt$LF DMN8DT$ LAAIcb Ht$LnF M^8VLA IF8L 1LD$!D$nHAHCLHHpb##A!A HƓ'H5GH:/B 1H 'H5 H9B 1HT$(Ht$ HD$w3HD$HH!!1HT$(Ht$ H|$ h1H5'H1KL'H5FI8A 1.L 'H5cI9kA 1H='H5H?NA 1]a mHǃk H$AIpH5\zHH|$D$蛴|$BLLH=U1Hfw "8HMLLIH=%U1H|$ D$ "|$  HuGLv聧H|$ D$ ׳D$ H=oT1H|$ D$ 讳D$ LD$xLt7H5'ǃTH|$034tb11H=SxNL'L $J!1HL$ H5iI:LL$ AAE11H=n1H|$ D$ ʲD$ OH5ˌHHEʨIHHH5t11H=iH5Lo0IHtiH=XI!HL$ 1LH|$ H <D LE1LED$H FH|$AD H H=1De1LL@'I8H|$讱A1ݛHtD$H=.H|$ E1LD$ NT$ T$pL貏tJ6H-є'H H5H1H}HtH}HYQH5@1kuDT4H Ƒ'H9&tH=}'HHHHH(L 'ǃTALێHǃTH|$Hf'ţR1H=:腾<L'L-G!1HL$ H5LI:Ll$ ɱAAÉD$H rHd HHLH=O1H|$lHLH <L|$ HВ'9H=PHHLLwH|$ D$ D$ )Hm'H q')H=8PH H(L H|$ D$ 莮D$ H5&'+H=OHeHH|$ D$ KD$ H='HH=WO"H|$ D$ D$ TH|$ D$ D$ 91HDŽ@$@/t{/LH/HHtbL$HL>/LLHHxDž@LtL1LLeHuHێ'H5H8\9 ho1.H<$OH<$LM HL0E1 1ҹHH=SQbeHH5.'E1[]A\1H7 H* Hh[]A\A]A^A_H LUhLEXHHEhLM`fHL$(]XHT$0Ht$8LD$8LL$0LT$( H|$8H|$0$Hk'H:+1H=8Hl$(Ll$0H\$8HLH>1H='LLL>HLH H~ H='H? uv1H=  VH 'MHAVMH1H5p_AXx!H=1LLL= H5'H> t4 Lt'IL\$8H_'HHD$01H=lcHupL'LL) 6 H;HuT18 Hxt4LX(k I}tIE( L1h Hc'LW'4 LW(H1|l R h ^ 1] Hl$ H=ah(I MtM9tLH:{L59'HI6nI>H=@1Hl$ g S ] Q -x0I|$ APHH MTIDA M|$hfIl$XID$hMt$`AD$XH=Jy:LLH&L?I|$= I<$ AH=* H=* H=K* H=7* H=K*HtqH6*H=*:H=*H  1 H H1[]H'H5)JH:94 1 1ZH'Ho 1h H'HX E1 X]A\111Y1HHLHD$C'Ht$H1{HrLL#HSHP)LIl$TvL I-HH5ʼn'q1HAݸq AX[]L%'I$= 1 L7LoM1M]I9MtIMtHE1L@IxIyH5'HD$mUHD$LHHD$xH HnLeHI$XE1PE1MMHLLgLE1\&H5'{H>tH5mE11 H5E11 { tHSPHt H;S@aH F'H5lE1H91 wE1o11b191UH)HHL$H){HHT$HsXH)SHHS`-1E15E1-H9 H H H 'DH51E1H9]Ho{H5Z'{H>taH5/E10 oE1{ HSPHH;S@H{HH{ I|H5QE1Y0 H3tHH=$趲{ t!H{PtH{H1HxHH+S@H)Y1҃{$tH{`uHb'H5E1H;/ }AM9 I I I AM9AAH H߄'H5pH8`/ ; HE1H=aEl-j[HH j'HH51HH9HHAiL,YHH=L#[dHB'H5H:. H1[]A\A]ÉD$ ZT$ HH1?3HHh1'2`1HH. 2L-kHHT$LUHT$u\E11 L-C1ҹHL蔰t1L"IHtI}H3 LHt$ Ht$ HHH?H HX[]A\A]A^A_Hl$ H`,O1H=Ld$ I$h>H=1INDLH1`2L"'@RL VCARH}CH5XLDI;HE111Y^utHD$ xvH8. IHHIHHp H=1}L L #H|$(}11Ip IHIp)H|$(|Ht$HH=^(Ll$HHHH!1許1蜱1萱Ht$(LH~X1L|$lHT$LH1LL$LL$X1?H1k1$H=r1Lz11Ht$@LVAH=f1YLbHHD$H|$ʐHHHLZIHHxH5~'M,|$ tLUA(M1L(HHHH1$HHLHD$|hHD$H 1?1߯1ӯHL$ H8软HT$ H8觯L? H\$ VHt1脯H 1p1dHLHL~y1CLHzHH=111HD$HD$1H1ݺHHH5TH=1HHt$ Dt1Ht$HFH :{'HP1H5rH911Hw0HH=\1LE1LE1$E1B LHL%z'H5?I<$-( 1HD$\HD$LH=艪tIH+Lc11H2z'H5 ?H:' 1jLH5>dLz'H=HDI8' 18c IkL y'H56I9_' 1[H{HWǂXHXHW@贼AO`Iw LL$ DD$HIIcI9MLMT$AM AwI HHtmI_ HDpDh HC HHt]PEESL$T$13ZYHH_RH 1JA1CA4AG`L AG`o|AL A L+ A`AwI  HHIw LLXDh Ht$Hc! Hl$HHttVAؾEUL$T$<2_AXHHiQH AAG`NAAG`7A(AG`L9t$KTEgIvAG`N{(A1AG`+{AjA]APG`zNA1L\$LHT$LLH4HD$=HT$HtI>L AG`zA1wG`mzHS0H $H5H=;HHD1+1蚩E1 E1HcȃH}PHAHLq`Lyh`}MtLAAƅu5YE1[*HE AA$E1_AD$`E1yA$>A$E1+G`dyWLAD$`IyA$LAD$`#yA$H=HH5AhQHDLHLhAE"L$1[]A\ËE1G`xE1A8AH)H5/H H5HE1 ADC`E1ADE1AG`wMHHqDC`AhDAXDE1AEA AL   H x'*H=89AH L_|$tLH5 LIHHLHn&H5ov'LL8dHh#H9LdLdLdLHLeHHH=s'H9xLHHHLkIHtLD$MtDK$AE HC1AD$ !HIw'H=7AH lH w'*H=7H_LAC;KHtL,uLt'H5~I;\ HLt'H5|I:< L|$LL Lp'LH5d71I8 R)!8uLd$;)!HqHT$cLH5N7L1H E1(!E1! HZ$ H H{ LH"IH JHumE1 G`tW  H޿R  H{ LHʹIH 9JHtC`o C`Z I !G`t;!LhAD$`sA$!LBAD$`sA$!A$E1!AD$`E1sA$p!A$E1]!LH t^HwH@tHw01At} A<.@9HHO(1DEtAt3D9u?HHwH1AH;C@5 EAE% A  nA9EA AH;k A.E A 9EA E1=!HC`]r!HC`;r G`!r C`E1 r E1  "L! H\$ Ld$Ll$Ll$H$ H|$ ;l$(L$ D$0 u p~!9l$ DT$ADT$PLT$t- 9l$}#D$LT$tD$P E1E1E1E1E1|$tD1#!} E1E1E1E1fEg LT$ LLd$Ll$L$+ H4$H4$L$D$! ' |$|%=tl t$L$蟿XD$xL$D$x |$|t$L$yDL$ L$D\fD. "!DL$x  A|$DT$xtw k)AE9^D$x|$|E LE1ILME1L#!LT$x LME1LME1MHE1E1IE1E11LE1II E11LL$ H4$jH<$L H4$UH<$Hp H4$@E1 H<$HS H4$#HL$> H4$D5#! AA: MH\$HMIl$ 9l$ |$|t$HT$ AAAA)A~9LD$荽LD$ LT$t5##!YfInLD$\|$x1  l$ F/$1E1D\$HD$x& E1E1E9~?Ek B IEl E1E1E1E11Dl$PD$E1Dl$0E1AFEHHD;d$}Ek AHEl E1'E1aCHu8E1G`Xm>CHt݋C`C`LD$PHT$LMLHĸIBHuE1AD$YH7LE1(7 HLHH_I$ HtADŽ$  LE1`(HC`gl3!HC`El!E1!C`E1l E1 G`kB A!G`kt!A`-ARAApL) HuJEAEE1A_!AG`ik"OAHEt!AHA=pA`B LAo HALh'H L1I0IHAE EAG`A AG`jA`AE1 AG`xjEA`Ao L IHtnA~Apu AG`)jA`u9 LEw HHu[A`Ewu#L HHu;AA@?H2EAG`A%ALL1)AHn?Hu.ELAG`XiAEAG`AdAAG`iAAAG`hAAAG`hAL.AG`hAL Az>Hu9ELT$LMMJ4L\$Ht I EAG`AeLAG`hAEE1A0EE1AEE1A HT$LLD$HHH4HD$4LD$HtIF L AG`gAL1w G`dg IH|!1!E1!E1!E@E1'!fE1 A HAFHMH;Ms!HqHu9  Ha H$@tAttLVH@tLV0A:_!LNL@tLN4A9_!"1A"tGL^H@tL^0fA;_!LFJ@tLF2fA8_!n!LNHA9_`!ILFHfA8_K!IMPH>"L8=HHtLH=f1蝾LD$H&f'"MPH"@t4tPIxH@tIx0?_!"OLD$He'!t"MHH@tMH0fA9_!!IxHMHH1۔ H<HHtDL1Ht$He' ~H_] HFI HFH8_G H Ht$HAe' IHT$Ht$H|$1LɾHRLuHT$Ht$H|$4!Hd'H8tHH@HD$HD$Q"H _'H<$H5&H9, H$#H_'H5&H8  1#H_'H5MH8 E1 LHH5H=H=*`'H5H? L `'IPH541I9蒺LE1 L-_'H5ɘE1I}h HH5-H=c)TL5^'H5I>. K L I H=*åH=܃*ǗH̃*"貗H*"8HuHI^'H5%H8 LE1j H=E1Q H ^'H5%H8s 1#H=$19$LMJ%H*}*%H*h%d'$L?觝L#IPH Hgb'H5x%H; E14 IPH Hǃ *(LB\'X[]A\A]HLLI9t:IxI@Hǃ@(HǃX5(HI9uI8PMHD$(MH~LHz]'HWH5$1H;1EMHD$0LH.M1'ML 9]'IPH5$1I9輷1ML`'H5HD$I; HD$LHǃ7NHhMHa'H=$H 7CMHCX~^MHCPlMHKpH9MH5wa';H={$HkMHCh$MHǃIRLHfbIQH3HnH+ mQLLNLT'HT$0H51I8HVHNLFL>HD$ U@VH=T'HT$0H51H?ɯ멹HH=˿>RHD$ UHUHT$RH|$H5IHD$HLL?HHLSH|$H|$H|$6U\.HtH_HWLOTHT$0Ht$(H=IHtLHH莋LH HHD$ TL wS'HT$0H51I9虮mLLH\TBL3S'HT$01H5mI:U){-HL5S'HT$0H51I>%L Y'HD$8IHpHHM IH31HHHHUUH HE1H5H=4VH"U'H5&E1H; VIpVHKHIE1H5DH=4CVLHLIͼIYDHA H L$L1H»LM#/`LHfo$L5**1LfH:fH~9~H91Ht HcHkA>LOS'LM8MQA8EHHTHHthH5&@IHt]HpIHtTL gIHtSHLLʆLRLJLB1j_1c_H=1S_L1D_L L1-_Hc-~*_LkD]Dg~*KD&^H9yHLLkK|^H<$H=M'H5IH?Y H$e_HM'H5zH8: 1H_HM'H55H: 1+_E1`LCHMaLk@M9}aM)źHLHLkHXaHT$Ht$H|$Ll$MHvO'LH0KHT$H|$L1{ tHCPH{8HsXHS`H+SXH諱LC`oSPHCXoK@LkxfH:LfmH)fM)Hs`IK@L;l$0HT$0Ht$ H{`H{8wLd$0Lc`Lc@S_HSxL9|i`E1C_Ht$ H{8L9LSx{ HCHLS@tL[PIt M9LS`K<E1+^LK'{I:t9H5ќE1\ ^LHE1H5H=^H5E1# ^LkP_LkPp^HT$H|$Ln^Hs8LHHt$ aLk`LLk@*E^LSP3aHL'H5 H; `H`1`SHHuHSHsH;-HO'HHֹH=ҳ{u1[AVIAUIH=+(ATIUAQ>Hu1LHmP'H=HAX]A\A]A^騵H;QO'Ht$HLLLHdZH]A\A]A^X]A\A]A^I1aH=I'LL1H5(IH?脥 aHIt$ A6`ATIUSHHHB@t4HHt,H"N'H9QuLl HHu LU1L HHuHLHCbHtH&H=/*(Ht$H\$HHHu H[]A\H[]A\LH9L衅 ^[]A\A]A^A_M8"u&L9c`HHHiI`LY HHzH'H8Y[]A\A]A^A_闈HH=W(1`1`4#HuI`H=pyd`L5]xHHI)HH)dLLnBL"Hl$ H H|$H5'(bIHHpH5'(H1W LH|$1Y IHLHAeHǺLb;L8ufH;-]L'teHC IH5HHt HKHtLH=nAÅuLL:LLL'LUM9nH=CL'L;!HuHLH=Ӱt>iHpLH=Q>LH7>`LL'>Hg`H$_HH_HtjH\$8H|_H=H'cH[H$1LH= zLI;MtLLF7LL5es,H$<_HH|$ MtLkL5"sHu:^H=G'H%^6H^Hu]H=G'H$HT$(]L$LD$(]H$HHD$(]:HJ]H=eG'0HD$\HH="(^IHu#H|$ H|$ s\H/\L5!rSD$K[LHOÅ[L5q D$ [}8tuD$HmZLHHLHD$ H|$$: $D$HL ZH0IHtLHL L$$t.ULHLYLH=:5;D$77%D$2Z D$eLLLYLH=K:D$?HU;HG0HtHK XH1/^1ҹHH=<dq]1`^H F@'H$LH1< B^H]1z^HffLM EMME A9A3AAA D *D *Ye XYa u蠙^fW` ^X H5oH=x_H5uH=H5PH=HH~^H8H9 _HH5K1H='H5H=7WH=+LE19`HID$ @`LE1i`LE1Y`L|ID$ HH`H_H^_LE1_H<LD$H$L$LD$Ht[HLHH$J J LI LHuHH,$LD$L9]aHH$H$HaB1Hx赺IHtI H~LLMuI1L=qY11DtHu LE1蔷H茷HVMHHdLH5'1hLIVH辽MuRԲHt$PHl$PH=S'HHIMtLE1 菲E1H11;l$ }/Ht۶LyHHuHAL HE1H='Ht$PLl$PH耉HHt胶 LtHBHMu HV(@u @ t@@LUHt LU0LUHLEE1IIcL9}5uA 2uA rA wLHIAuAEt%LHn HHt HH躵CL|$_ Dl$$H5^LE~)A  McBD4_Ht$L!Aƅu&A EuHt$HsAAHBEuHt$H=W!AHhD[]A\A]A^A_Ãl1Sn1 pHLH51[]A\A]A^A_O;H1~@lNHl1,nAApH ''IQH51H9]/ Hs0 HsH׵ H{H雵 H{0钵 HL ) H[HQ LE1JDpHrHEH8-0r贻 I}U H==1 L5''HH51I>蜁1饶 H;5'' 3 HzAIDL%&'H 11H5=I<$L逶 L&'H5VI;1 I9rRH='H5I9 1 1 AWAVAUATUHSHHXHwHD$H~*HEHD$1ҹHH=tMuH=({H=(HD$jH=(H[H 'IH9T$tH|$uH'H5E1H8 sH9tHuLc'H5 I; E1KHtH9uL;'H5E1I: #H|$HET$1H5OH=KxH-((Ht$HLd$HHHHt$ {HHu*蓨HT$Ht$ L=r(LHT$HH[{IHu H1K LIFMxH 'H9rHI9tHtDtHt$ LH\$HHzIHtHJ LIЧMxH= 'H?qHI9nHt|DtMH|$L%d(L5M(LU4H|$LHD$C4H|$IHLD$MHALPAuH|$8LI-HD$(MtHuA1E1E1IHt$ HH\$HHyHHuR軦H|$LH3LHIv3IMHM\$AH@LuLHD$0hHT$0HHT$8kHHD$0]H|$= HHTHT$0Ht$8Ha LHD$0LHHL$0HHQ H 1HH='L%,'H7I<$rIHu0;q IHL K'AI9' HvHuL'E1I8' )HHtHXA| HDHL$(LLh IH|$LHtHLoM1LH5ZH=GE11(A1E1AH|$t)E11E1E1H|$蘤MtL苤MuM1E1E1LkMtL^HtHQEH|$u/Ht$ H=(H\$HH wHHu"螟 H|$H tH|$HX[]A\A]A^A_zHXL[]A\A]A^A_Ãmmmmllllllllllllllllxlplhl`lXlPlHl@l8l0l(l lllllkkkkkkkkkkkkkkkkxkpkhk`kXkPkHk@k8k0k(k kkpHHH L'H1H51PI;AoHyj H=}XSHI% LE1s E1MD|$fAnfInHDŽ$LT$HHcf:"LT$Xf֜$ILHt$PHHt$@HuXH\$`$ٻ a HE1g L 'IVH51I9YnH%  ռ H-'IVH51H}(nMMhMPLA1L'LHD$(Pjj H IHhHItMf E1 IE1λ I遹 s H -'H5vH9 1oH'H5H:y 1o1upqE1xp1y L;] E1 E1 1v HHDD$LT$Lt$0qLT$LL$LcDD$Ex2HHHUItN$I|$n LsIU H{T 13 Iɽ HHDD$LL$pLL$DD$LcExgHI J H|$HHDD$LL$kpLL$DD$LcH|$ExHI J  4 / II鮽 Lc LS8H HHDD$LL$oLL$DD$LcEHI@ J7 HHDD$L\$Lt$oL\$LL$LcDD$ExMHHUN$) HDD$L\$koL\$DD$LcExHN$ C > HHDD$LT$LL$#oLL$LT$LcDD$Ex&LI< K 3 I ۻ E1 L[E1L;${ Aw L=s'AE1A9D$X IIfMnfM:"D[׺ LL$LsE1L;4$$ A>DD$@A9D$DD$ IILL$H fInfI:"sz I DD$E10DD$龺 I HIn LL$LsE1L;4$ A6A|$DD$ DD$bc 1 nH|nmL kA1LH q"H"&W H=Y"E1o HE1Y_ Li# ATIUHHu<H=TH='{(Ht$Ld$HmHHH1L!HH|$Ht5HGHu$ΚH 'H5HD$H:o Ld$M@wIL$tuIt$I|$ Hu)LpH= 'H5|HD$H? =|7 u6HI<$u H|$D ILH"Hl$ @Hl$HHuHUHu,HL 'H5 |HD$I;胺 M ωȃ @u#t@LUGt LU/LUHIA< ulM@u%t@LMFtLM.LMHIfAR HI#Ld$Ld$HL]A\HE H}(H L% 'H5I<$E1蕹 1m'Nl\HDZl mH 'H5H8V 1nzHt1nLHD$qHD$nL-10nH z 'H5H9 1n1ҹHH=tv;nH] 'H5&H8Ƹ H1[]A\H< 'H5nH:襸 I<$JIHt$HLHD$轗Ht$HbnHPnA3HIHA IHIL @8LDHuMND%A:0MoBL%IIAuM)IyoAH8H[]A\A]A^A_s}LHIHBnACH8MHL[L]A\A]A^A_iMMԈT$HD$IH$Lt$ Ld$E1T$B:#t2BL#IILuMIM9}L$$EnnHD$(E1JL%C3B81u IL9T$HD$(I9t[BL#HHueMHL$Nt1Lt$L9t$L9d$ ~L)J|%EtLLs"HTnIPnEuH$H$I9tI@M+nM#nH8HLL[]A\A]A^A_"IG<3G8<0u(IumL$$LLM)MImMtBL%HH M)HHD$H|$H[]HH5H=B1}H5dH=-譑1H=6'H5@H?蟵 1oHHEVH5_VH=[1eoPLE1LF)11HD$(PjjHt$(^ H IHuZ1,oHHUH5UH=>1oH-'H5^@H} 1H-5nHnH\$rnAM9AAL R Le L 'H5GE1I;螴 HCc L 'H5GI:{ k HoH9tHEHZ[]A\A]L- '(oHǃ׹HH=u6Go[1]A\LMLE1BpLE12oLE1"oLE1oLE1oLE1oLE1qLE1ҒqL11~ IHqfqH=uTH H H=t5q|rIL$H>E1H5\H=tXrI $H>E1H5\H=t¡2rL%6'sL|$ Xsfo$L|$ LLL)D$)\$ U L%'L9rLE1ʑfoD$r1r11 HUE1LRH HIVLHH4 H=膷E1sHctLLLHsIsHE10IT$H=L'1H5k!HRH?^Mt蕌LH5(LIHtHLrItID$H 'H5!HPH91r^sH='H5,sH?W H'LLH5H81/^tL-'AtH |'HRH51H9]tIMHt$ HD$IHL$$Lt$E1$B:3tvBL3HH@uMIM9}J H-'IRH541IH}z]k I_ H'HKYLH3 HD$($1K 7D581u HH9$HD$(H9tjBL3HHu^MHL$HtHt$H;t$BL9t$7Ht$ K<7LHL $L)ȅHj L $I MHxHuE1EzLE1Ȏ!zH|$PE1V #zH b'xE1zHN'xH'H5+H8; LE1 yLcY[]A\A]WL 'H5!E1I9 L 'G H='~ H B'HP1H5H9[E1g H' 1[H'H[1[E{H=4YO4{ÃÃÃÃÃÃÃÃÃL%'I$L|LU)$L9S|LgEfo$ta|LКu!L%e'ALt$ |Lt$ 4|L%(LH)L$L)$轅xPfo$foL$tLt$ LL)D$ LT L%&L9{LE1Ɍfo$foL$|1{HJ|1ZMtLM~Ly~cHk~P~`E1MuT~L9H<I92.~H^'H5oH;׬ 1&Lx11 H1L '&H5I9萬 HH=*HT$JHT$u H1[]鈁1ҹH=*.H~V Hq E1H 雂H='鬂AD$AH[]A\A]A^A_*1髅$2tHHD$fE1f/H|$_Uf/ r ] f/ff.Y fH,ȉωH*\Y X4 L,DAt QtD$=11AAAAAAE AD#D H+HH+DH4+H4(@4h150fW AD$LQ&H5lI8z DL$XAAD$=:=|RufAf.AEEE\AH-'H5"H} AU1AEHWH@tHW0.H釈|$$<鍈H|$0E1߈nfInH|$0fH:"u+H|$)$Hl$@Cfo$LT$@HHD$0ψH|$(DH|$8H kLLxHD$(HWHt$(H|$0HHH@1HL$XLHH5"% Ht$8HT$XLFHy LI9H$H$HHL$MtLLlL $vL贇H|$`HH|$(蜇Et&HwH@tHw0餇HWHf{D$HdHD$0H|$`HD$(HayH(H[]A\A]A^A_yM[HYIHPHUHjtLGHHφH|$0H賆H|$@D$LH|$@L$Lp艆H|$`Ht/zE1ISHIH\$(Hl$01Ll$8鋃馆Lt$(H5kiAFPI~`L!HD$(GBVISHxH( LRxHԅH|$(ŅH踅HUH*HMHHL$HH&H5H;F H~魅Hq項L%]&H51I<$SHKzLL $:L$L}H鈁G`…H3DC`A}(C`鬆DA~ DE1AyDE1A{DC`E1Az̅DE1A|$鸅H &H5 H9, Ld驆顆IcA ,LLL$L&L1HAI2ղH\$A ,EHE1L賲E1rE1j 1 1駈11[]A\A]A^1[]A\H{ H { 1ҹHH=&AH1[]A\H&}H8tH5F& H5 Z H&UHs&I驊1%HCpH{h<HTE1ыH LNHHL2IHHk@阋HS@HK8餋{ tNH{PHtDH;{@t>Hs@Ls8IL)龋L1膂tL)ƋL1o]H&H5eE1H; L1B0LE12- LL$0 LL$AI L5<&H5meI>赢 LE1 H-&H5/H}莢 E1V L0 AtEGA^A 鵍AAA<_[C4\f>vf^tA Dvf;vsAD^H5Lq&1I;N1馎L=Y&EMAI?A^ӏDH51N1rAAzE11LgHvAtEC,,H5AdwAt4A -wA(I IAuGA<#AC,DA4Df-wA(I IAu+fAAt(A<0@tAtWA<,trA<.fA@@HBHtHB0L\$MK MMLHJ|$f@0Lp7 LAAAboDDfD`Hf0|$ f@- MYHE111A0M^AmAWL9EDIL ‰E!р ELH)AȉDHI99AEuHH &H5_H9 w t/ tN@LEHtLE0KO H}HL t@HEHtHE0O ?LHEHLEHEUE111DT$(M^A0AWM9}FC|HH |$(D!@ ALH)ωf@Hf8M9~9}I뵃|$SHuAx^H}H8H= Ij CD|$HL< HBH|$qCAME111҈L$(M^A0AWM9}cC|HH L$(D!р ALH)@ωHM9~:9@@uI @-Ax|$EH@HAAxEMLL9 DEAw H=&FE9t+HA]LL9 uuH H H L{ v E1a%SHSHHHӽxH}FG HCHtHCڋAыvAËLU EAAtAAAEJ@H9ýO<:LHLAHHNII)MHH9HOPASHARAULIMO< H LL$HL$HT$Ht$袴Ht$HT$HL$L$tYHMUHL$@M  HL$HL$Ht$HT$MHT$Ht$HL$L$ IJ kH&kHH=bNDD$ DL$pDL$DD$ H9*HkH1HH? HvH6 tEC 9 At-MDL &AA< wqA8鹏fALUَHH&LDFExCfD銏LM E1L9C~LOAtGAt]KTH=&DBIH-&H5ZH}ϗ :酏MLH&E C< A;LM MH5,&MA fAL &H55I8u 鲐HHT$鏐H1v镐H=&H5jZH?= H1svpH=.Z2UHD$H$&H=$IXLZ]A\螒HHtH莐HIvIоH=H釐GHH鍐HHP[]A\uL\ H;HHu LLUH531L&MHIRI;II4CH;H֐H\uŐHOuLE1Du鏑LE14uH'uLE1uguLE1uH|$tLt@Ht3E1+LSfHnL{HMzfI:"A_tLE1tLtLtHtِH<HytLqt1髕RH &H5 L $HHD$8Iu3E1' hHE1hH#&H5̹H;茉 LhH|$@Lt$@HD$8H|$@tD$= L=&H5\I?E19 oh LbhHZhL=s&I MMLE13hc I Ht$@LHD$8HHtLIgHD$8% L|$`HH\$(L$XI/Hl$8H;L& HD$8IHxH{HtgHt$@LkHD$8Ht/1HL >LtgLL$8HD$8LKHI9uLT$Hl$8MZL$I[H2 H|$AL $HD$D4$DAALL% HD$8HMtLHD$ fHD$ HD$8Ht$@H1HHHD$ L|$ mLfL|$8HD$8Hl$xIcIIHH$ I /IY 1HL$8LLX x@L,fLd$8HD$8 E1LD$(KI X1 N]H"FIMH QH5:HEIT$L j&[1]A\I9A]A^*HH lQHSIHEH5ȯHEH=&H?+I" ^Xf 1ҹHH= ѫ1Hǃ\L &H5I99} 1H5&HxH֫1ȬL&H52I:| 1髬I<$Ht$ OpH=2oH=K&H5 H?| 1b[8LHD$[HD$AHH豬HD$ HHVx y{HL$ E1H+iHHH蚮MHt$ H~~L/Ht$ HJ[HH/HD$ Ht3H+h wH|$ E1H [MLZ1hHt$ MtPHL訹x{H=)Ll$ LHD$ MtLZH|$ tLZHt$ H,H|$ Hff1#IH8H|$ H;DH=)L'HD$ UHSHQHHPH)Hx+H9|&HH9~$H.H  HtHZ[]HHH{ H?E1HHS{ ;z@ 4 LL1Ѓk  Hu 1ҹHH=t*HB U WHu [H]A\3[1]A\PH=V1_,HW1ZùHH=Sifu1BHM4$~I|$Ht$袺鞪PH=^H\1Z该Hu;H鶫IPAL ['1HD$Pjj_X H HHu1靫MhIH;5& HH=()$H5+HI$H 2 MMIM)MIGJ.IHMHIXE@@H@3D@@LLP麭M;gLLLD$)LD$LcEMHpMgIOMoHL$I9LD$L9wKE1H;t$Dl$E1E1EMX(MN L)I逫DnLD$(Ht$ DHt$ D$L&LD$(uDL Ht$ LD$(`DHt$ LD$(L?DLfA_@ƅ@ @Ht$ T$ D.LD$ ADfDl$(LD$ LDLne LD$ D LD$ LHDL6-Af|$_AE EHLLD$'LD$LcEx-IH޳LճAD$MdM`饩HLLD$^'LD$LcExIHL٩I;wf> HLLD$'LD$LcExIHL邩}HLLD$&LD$LcEIHL铰E1M9X Z Ip(HHH)IIE1I9wѨHLLD$7&LD$LcExIH3L*鲨MXE1L;\$|A3w H&40E1A9t$ZIMt$fMnfM:"E`LcWLD$f LD$LѧI-MhE1L;l$A}LD$A9D$LD$اIMT$fInfI:"LAH_IPM` A~X0fI:"X(DjIIhM` AM9uAx@MptAudAt M9wpM7A>It$LHMIM`AT$H9 I@ HI@M9wIHE1H;L$ަ1w L5 &A46I|$LD$E1HL$0 LD$H|$Ed$HLbfLnOLfM:"E@#镦MXE1L;\$_E+Aw H&F,*E1E9l$6M'IH Mh8IpHIMI7I-MtRE1MA~`0fI:"`(AIhIh IMPAt$LI+HH9IxD7NMXDHLLD$ #LD$LcExVIHtNMLjLLD$"LD$LcE MHMުHM MMX8MISI3M`MMJHFM'MI@ M)H9IIGcIIx8EX@LIHMLwHH@I DX@Lp E\$E1MM9pIJTJH9@HADIHH9 IHE1H;L$%D Aw L5Q&G 8w L=&A<;E1D9HHIHEoMKfE:Eh(MIG ILIHMHIXE@@H@HXD@@LMHGvIIIH8Ep@LIHMHQHH@H Dp@HP黤IQHLLD$ LD$LcExIHtLMI@ M`8IHHI$IѢMXE1L;\$A;A;|$V髢At$E1HI9IHDL HI9ADmMI9-IHE1H;L$IE)fD9);HIIHMMHI)M)MMIGv8ILIHMHIXH@ H@@HXTHLLD$=LD$LcExIHtL鿡閡H|$(IHE1H;L$9LD$ HL$A}D$9D$LD$ PLt$H|$(IL MNMHI9rMt$Mp͠Ix8JL&HOIMMP MH8IpIMI7MMp8A~h0fI:"h(MXMfMAI@ El$MLL9| M;^IIH)HoIP8MLJN IMMp8LnMM)MMMNIGMILIHHIX8E@@H@H{D@@H HxxMhE1L;l$ߟAuA|$LD$LD$鹟MhE1L;l$AuA|$LD$ LD$遟MPE1L;T$oA2I|$LD$LT$LD$JH|$MhE1L;l$.AuA|$LD$gLD$5LxLcEx=ILlHLSLcExIMLڞ՞鬞E\$E1MM9IJ|N,I9HpM4bHLLD$LD$LcExIHtLkHMOIOI9E1L9v-Ffzw#L-W&ADAf_@A EE1H9s)6fzw L #&DCf_ DE1IGIH9E1H9vTDvAH|$ ALD$Ht$}ELD$H|$ H0BVHt$LSE1H9s?D6AKLD$2AALչLAPLD$E9AA!IN,I+I9NLLLD$/LD$LcE9IHtLIILD$HLO'MLD$ HLLD$LD$LcEx1IHޢLբLD$E1踾LD$0MoIWLl$L9jE1H9wHL$9A٥IHLfMnLfL:"DCJLcĥE1H9K f铥HHOx\HIJ'HH$xHIAJ 8LcTL;U~dLc=z Hs1DZKcLDJE1ML9HJ|JH9HADƤHH9LsE1L;t$DE9IHLsH}L}H|$I9E1L9wCD$H;t$D3t$E1EFHHS֣4HHSģD~HT$ AHt$DĸHt$HT$ LLuDHt$ HT$ HT$Ht$ LZD襸HT$Ht$ L̳L2D譸A_HT$A@A Ht$ ED>HT$DD$HT$LmL8DN HT$LJDHT$L.LDA_HT$AD D$~H}L}L9E1H9vYDNADL$ uGHt$HT$LcT$ LH0F4VHt$fAA_LgA HT$A1L9sED>Au9HT$IcHT$L,LLNAKfA_@ A9AAE1LuMI)IL9E1ס1H9u@H;u{> uqHML}L9tE1H9v,DNAz"H=:&AAA_AE EE1L9s(6z!L= &@AA_A EE1H;u~ KHML}L95E1H9vYD^AD\$ uGHt$HT$TLcT$ LH0F4VHt$fAA_LA HT$AE1L9aD>AQHT$IcHT$LsHLD xfAA_A A> fL}LMM9Y1L9v(Fz H=˶&Aƃ_AE AE1L9s'6z L &DC_@ DD9AA1H9u@LuH}Lt$L9E1H9D$H;t$1D;t$@jLsE1L;t$dzA6HT$ LLT$IL]fMnIfM:"LDC鸞L[E1L;\$ A3HzHT$L\$HD$HL$LLȯxHfLnI4fL:"DcOD~HT$ AHt$DOHt$HT$ LLqDHt$ HT$} HT$Ht$ LtD,HT$Ht$ LSLD4Ht$ A_AD DHT$_D>HT$D衲D$HT$LL?D HT$Lҭ#D芲HT$LLD藲HT$A_AD D$DJE1ML9FLK|O4I9H"MI9H|$(LSE1HT$ L;T$A:LT$A>D$贗9D$ќHT$H|$(ILL֬HHSHT$ LKE1L;L$Ic1w L=&A47E19rtIHfMnfL:"DkL[E1L;\$DIcw H &E19B%IHfMnfL:"Ds餛BE1HH9HLLL4M9@M@@ʛMM9LL$(LSE1HT$ L;T$A:LT$A>D$;D$yHT$LL$(ILYL~HHSHT$ IHHSٚ7HHSǚJHH9fJM4Ls餚H{E1H;|$J9HHfHnfH:"[jLLS8MIBML{LLpIPL}MHS M)H9}kIIGHH{8DS@LHHHUHOL H@H DP@HH͝LL{8M`I:oMZf:c(LIGv4HLHHHUL Lc[@H@L`X@VHH xHItJ Lc鷙HHT xHIJ Lc鄙rE1HH9OLMLIL9M@@)H]L9YLsE1L;t$Ic6w L=&A47Hcw Lk&A E19ҘIHLs뤿 HC8HHSHHLLH@HPHxM)MHHCHEIGHLHHHUL Lc[@H@A4$X@MLX鴛LsE1L;t$zA6HT$虒LD$ILݨfMnIfM:"LDSdIGIHLCLDXLJHLEL)LK M9}LMMHGuHHS8s@LHHLJHUL H@I p@LHٚxII9| AM;GMoHf:k(H~YL4I9dLHLcEYHItJ"HHHLLLL+IHHs8HL^L8LLL{8MrHUM)LIWMIGHLHHL Lc8[@H@IL$X@H HH頙HHxHIpJ gLcLs8J|I~HHHM|L{(M~1JHH)HL{(N L)~s0LS8HCHfI:"L[ IMHEL{8LMGL)MLHGv4HLHHHUL Lc[@H@L`X@鄘HHxHItJ LcHLcExHIJ 鱔H頔HH=xHItJ HULcmLSE1L;T$<Ic2w L&A40HzLT$E1HT$۠  HT$H|$LLDJHfLnO4fM:"D{m质E1Ó龓HHSNLM\I4L9AM@AuHuCRIHCHH5xHIJ LceH HS֒HHHI7J'.HK(HLM)LLsE1L;t$ԒzA6HT$]L|$IL͢LfMnIfM:"D[(HK8J|HyHMdLC HS8HsILHuQMuKL{8LK~k0fH:"k(M_LLS ACLMtI9}M;Ou E1HML)HLs8LIVJHLHs8LwHUM)LMHVIGHLHHL Lc8[@H@MT$X@I LPMRHC L[8HKHIHM?ItHS8LCHLE!HLcEx=HJ'HHxHHUJ N LKύHHxHItJ Lc3{@Hstuft H9uHuAߍHrHL虙H HLHSDJI9HC HHC鏓H9uM}-HT$LsE1L;t$jA>kLT$A9BSIILefInfI:"L&{ŌLc?HN4H+I9vtLHLcExjHItJ&HLHH LPIӌ~c0fH:"c(HkHk cH颌E1L9UvgI鈌LsL[ ~[0fH:"[(AFIHkL[ I9.HHx&HIrJ iLpLcL9|$A9?~LE1)LH)酕HE1)Lm %H|$@1ԕLI\)9LE1L)5FLLL9f9 <H1Ht$H<$|HH<$Ht$tL9/rHL)HtnLL9\;9t+HnLL9;;9H DFLL9;w H5&<>A9t7HD^LL9DAw L &GE9uVH鼕nLL93ʄu)HnLL93规tHqlgb]1Ht$H<$HH<$Ht$tL9/rHL)HݕnLL9ĕ;9tHFLL99t H镕鐕nLL93u,HnLL9_3σHCDFLL93Hc;w H5&<>A9t6HD^LL9LcAw L ^&GE9u>HnLL9є;9uHH鲔魔騔E1違Z1[]I1HLD$(HL$ L\$LT$Ht$yHt$LT$fvHL\$HL$ LD$([HL9LM C EL9/HL9M C WfvHʛHM6MILL9ɗƜHEuLL $: L $u@HM鱚MI郕HL9t{MI颚Hk1LHH+HBfvL $LM&HcH54I8E1鵞HH=){rH}OkoqH]I@HIxHmIx0dM`0M`H IpH闡IH0sIHHjAޣID$LH=Hp1IH#L5L]1  H@H= []A\A]A^1kc1H|$H|$ H}#1H IHt.HsH=q 1HΦHB#ŦE1齦H=5Hj* LaIPHA1L%'HD$Pjj" H HH&E1ܨwLE1"L鿨L鲨H}Ht5?IHHLH$"H $HtyItdH}H $>H $HIt,HHL$~LH$B"L$HL$IoH=ItII]nHHpH!LHILH)LHIVHT$虌HHrH|$@Ht!H|$8H!19D]HIL9G\A#vHt$@PHHL$PQH SATLL$@LD$(H|$8=H IHpHD$HLH)HL9||IVL9@DENMBAAz AB @IJIR0 uIRHHLLT$(ZLT$(HHt;L H\$HRAFHLLT$(U LT$(HHnL\ IJIR LLT$( \LT$(ZHT$H|$ ILL H5LT$艹LT$1鰨1館隨邨MHT$HLI)LIMFI臿HHpHH?L)HT$(^Ld$(LFHT8t;G A dD I*AAtGAE齫G \fA tfD kILGH龫LGH鵫邫ILAPE1L:'11HD$0Pjj H HH?HMHII)LH9L&H5I8:? 1铪LcE111IE1MM)C4 t.L9tHH tP tKIM9u;LeHD~(HMHII)LH9qLLAA1HY^ȧjHK髧AzLLAijHuIHD$HHiHPAL'1HD$(Pjj/ H HHE1騭2rLE17H鋭Hr~[]A\A]A^iHt^E1$ 1ҹHH=8tHͮ  LE1 L&H5E1I8m= ή HuHa II H$H H1HbuHHtH@HUHHtAXH]A\H}@Z1]A\H1[LH]A\D$ D$ 鬰]xH}J1hHʿ1[hHX1ZhHSIT$Hs1E1H=Î&HJHVH5H?DHE1HbILRHE1L%&H5dI<$E1; L5D&H5oI>; HLE1H-&H5nE1H}; zL-&H5 oI}; H=ލ&H5onE1H?d; CLwVuoE1.Hˌ&H5E1H;1; L&H5`ID$`I; ; ;LHE1H5H=*)L}9L=[&H5mI?: H &H5YmE1H:: |$HH5HD|$HtLID|$HdL^ID|$HiLcID|$H&L5;IDD$Lu!Q|$HH HD|$HL "dIDfHPHA1L'HD$(Pjj H HH־@HYH|$HLID|$HqLiID|$H[L5IDϿ|$HEH ?HD鳿|$HL cID闿L^&H5mI:8 L-c&H5Tm1I}dHH7&H5l1H;L &H5lI98 IuH<6fAD$hH=Ê&H55H &H91EuTHLKMHLEH&H5'jLT$H;4 H|$Lf&H5iI83 H=&H?[ 酨 HH=#0k H}HWLMt L;%& L؅&HR1E1H5iI8X鮧 (H=OFjH5H=zL&LH51I;QZHʀ&LH5H81.7H-&LH51H} H;LH51HCL_&LH5^1I:H <&LH5;1H9H&LH51H;}H-&LH51H}YbH &LH51H96?LL%&H51I<$H=&LH51H?Lh&LH5g1I8L E&LH5D1I9L"&LH5!1I;L~&LH51I:clL ~&LH51I9@IL~&LH51I8&H=~&LH51H?LL%p~&H5r1I<$H O~&LH5N1H9H-,~&LH5+1H}H~&LH51H;luH}&LH5H81IRL}&LH51I;&/L}&LH51I: L |}&LH5{1I9LY}&LH5X1I8H=6}&LH551H?H&H8u AH |&LH51H9[WHH|&LH5H81-s[fF<A~ApAb1ҹLH=GE1LߎHHt2E1HLIHt/LHhLy4 H LE1 VHuH OLIn MxHL)I9MH|$O H|$ E H|$(HD$ ) D$ L-9|&AL--|&5AM9AEN LHt$HULl$HE1HD$pH|$A;E1rBE1HH=_}.1髠 H=_e.1铠 <IcNAI~AfnfA:"E1fAN x HT$4LD$8DHL$0蜥 LcD$4ILMH) ~E1ʢ 0LHܡ eH=^-dH߾I` HHL M9uWMtL HtH H|$0Į H|$0G HD$0鬮 HD$0鞮 LE1p LMe L1Y IMHLF zD$D$\T$E1T$Xç HD$0L[L( DD$ I>HI5H1H賉AąH{@Ht HC@H{HHt HCHH{`HAfHC`AC@HC`HCHqHC@RHt$H<$LkHEHCHMtLdHH{H4HC`A;xHWn&H5SH8 EH=_'!LLLIL I<$M|$HII|$ ( LLHHi Hl&H$H5S1H;ML%m&I<$tH$I<$H5S1!LIUU L qm&H5SI9 1IEHHD$HD$I A HH4rHu.H[]A\A]A^pLl&H5&9I8 1I I|HtHT$HAHT$uHH?~M$1tLAԅ]A\A]11EH-5AL-hp&H-\p&AI FHth1@MnLvMAHmIMH=k&H5=R1HQH?1Hyj&L*IpII1J#At/LL$EHj&H5/RH: 1;EHt1H=`k&H5QH? 1;uZHFo&HHHD$Ht$HHtFHHVHHpHHD$=HD$Hi&H81nvIXt|LL$H<$HE1|LIgHHMuIWH=GLh)HIXt L"H=IHH=)1HLd$(E1Mt |$oH5pL?2blIHt(1H=Qe'|IH${CHE1oHLd$(E1jbLi&H5QI8 LE1D4H`i&HV1E1H5PLd$(H;H HT$1Ld$(E1H-@h&H51PH}1Ld$(Lt$PH=d'IHt`L@AtlLL$IyIAHHzLg&H5OE1I:> vdBHE1`NBHuLT$MjMuHjh&IPH5O1H;LE1"Ht$ LE1MbHj&Ht$L4 jH5L]H5LFupH5L3L=j&LH1H5OE1I?JzH55LH@ taI}MuRLL1pLHHD$Ht$AHtHAE+|Hg&HPH5N1E1H;LMuMs>HHD$DT$H@DT$HH6HLd$(E1}k@HL$hH|$pHEH|$3EH5,b'L$IHMH=a' IH H|$XH.YH|$Ly_LLYLH=J_LLXL=LL_LH$0L$0Ay {L>.kH$0H  HH@t H$0H0L$01HMCI9[ =IIMA*HH|$XhHtZHt$XV  t9@t)Hn0H~ uw|.tKLT$XILT$@"Hl$XHHH|$XHoHH=;AHD$@H|$@y|pu|yuH|$XHP1-HD$@ʃt-|.LxB|plB|y`f|E.L NfB| pAfB| y4IHc&H5JE1H:V E1LHtPLd$ M|$I[U=H Hf&H5KH: HLd$(E11)Ld$ E1?HIH54h&H=HsLvH$E1T$hHt$XL4L$0IBHH$0L訨IHtH$0LULsLL[x 0l pcHIHuH{H*Y[]邈HL Hd&LYH[]A\A]A^A_(HD$~H|$܎IHH5Y`&H>uE10f.=# zt"t2H `&H9諠1 fW DE "H5e&H>H ma&H5IH9 1齳 "tE1A;HtAL{HujB| 0HD$HHmHe&L H|$AEHLL$(IL`&H57JI;O t&B|HvHPHM)t5INB|MfLH=苐5E1HHE1H5H=H(tIn8E1ImHImHH|$\|$ t?B||$tC<HHC<_HmHpL{HSB|UH=//'UH5sHSQHb&H8HZH8LyH@H5HLx޺H5&HxƺH5HݔxH5HŔx H5H譔z&H5H葔Z[][LH]A\H=&UHSQJH=&HȫHHHt HR]Z[]PA1LD$APLt'jjH HHHl$E1(H ]&Ht$HH9I -AHֹH=AE1H\&H8ݜIE1H\&H5GE1H:D nLd$E1Mh|H|$HFE1QE1,FI[1]A\1WALHU)Ha.IL[&I;1H=`&H5AG1H?1+H [&H50H9b 1ATHHUHHuH~ HHu2PAL7'1HD$Pjj*H HHu1H_&L'1H5H81H y*H P\&HH1MZtHQZH*`&HJHmH u1H HHt\H LGgH_&HH]A\WAL1L'HD$PjjQH IHW5Hu IE1HJZ&H5EH8 10PAL'1HD$ PjjH HHD1fN~މMD$ 4T$ HuH=Z&H?tH51~1H5}E1f1Hw#(1NH@H]A\A]PHHH5oH=81ZIEH@IEH7@tiI}H@tI}0DD$A-$E1f f. 3HAHl$0tFMMH@tMM0fA9-A-AED@DD$I}HlAMMHL-X&H5AHl$0I}& EL3HjEgDHXA a\ML$M+L$ I9Hl$ 1:HHz1DML$HH|$(LMLd$(A@-M^LE19H=Um ML$HvH=\&H5oE1H?0 hLD$E1McDL$LD$L\$D$LD$HHL$DL$ItIHx Ic1H<$H9~EE\ HLL%CW&H5BI<$E1 LE1MD$H&MD$HMHD$(LLd$(E1EҾ0DL$EI)IcIH<$DAAHLD$HcH.Lcl$E1HHH\$MM9~BBI1EIILL|$(L$I,$A  H|V&H5BE1H8 ˮ H|$pCD)H=  1,HD$ LT$Mj1IE,IcH;t$yH|$(LL$LcJlMHL @HIEMH 0HUHL%ZV&MH5`1I<$ݰH|$pCFLc|$LHHD$pHtuD$|HD$ E1HUu[H HLU&H51I8eH|$pE$H=ژ1yY1H5/HH xHDL~D;M$LNH *Ht%H=\U&t$H5P1H?ޯ_AXqHH#H|$IOLHT$(H|$pE`H HHt$ HL"He.HtH|$pDH XHLL%E|$HUL-MDL ݐH|$MEH5<HtIH-nT&ASH1AUDD$$H5H}H$KDAYAZILT$hyLHH|$p^_H|$H=HH-HH|$pC)HL$XHN9HbM&H56H: 1Hs eH ,J&H56H9 1HJ&H5H; 1H=I&H5yH?{ 1HH&H:t ,HuH=~H5nH=N$H5}H=NPH=LK&H5|H? 1ZHPH9t4LO(IIM1MA?ILI9~ HwHr5HL_0Hw %JLHw HL)H H6HK&LH5H81x1=1Ҿ@BHkL5DHHHt#HH5g5H=1H=K&H55H? 1[*OH5.G&[H>UL|{[L]A\k{PH=\1ZH1P H=[ZHI&H(H G&H5ƀH9i H1[]A\A]HH:H5 H=h!HLu3H5H8 뫹HH=wL93H5H8 lH>J&H5+H8 Z1]A\H5y4H=LE1* 骢 p11H1 齥 HL魥 1`H{I΋LDHI&H5<H8 1AAADGHT$DD$$ID_LL$LDT$$H$H5EAAu)Ht$IDLH31H$$HD$H;I&LtH{LGH$DL1H73b$A1H=HbI|LZ]A\HHtHHI7IH|$PP~H=a0HZÃD$ D$ HHI}XHH I&LHH1bHIkH=qaH~H=]xGI} L1{HA@LHI9INI\$LL,I)U1[A\A^GHB&LH51H81褞Y[]A\A]A^A_GH(H&LH511H;t^HHH=[]A\A]A^A_zHLjLR1vH=?`wHtHHfE1f/vfWKAH|$ 蛚f/%f/DL$ XAAD$ ZufAf.AEEEt\AA~Y%X]H,tuD$ =~eHF&H50H;5 t tff.ztLA&H5FI8 ~1ɉAA D# H1,+ kRAy}A15IUH麦 ]A\A]EIUH駦 E11L׉f7B< *ǿY EuӚfWXA{E10 q莝 Ht#H"~)H阦 LE1{ LE1k 1Al$邩  ~V2 ԩ AT HA&H5W/H: H]11H911LE1H=?&H5yH?: HHyH5H= H+  I,$ HH=gppc HHH5H==A  1* !1 L$CL$LrMt$H f9H LD$ H|$LLL ,LL$eL$rC f1H& HLT$0HD$(/L\$(LT$0- uI{Ho I{Hf AE1`E1XAE1yA:A/A$ILMDI0HI DHHPLDx{E1UAJA?A4LIHM!L!I LEHH fAnEI0AfnfA:"LfA:"fl@HD$`H4HH=Jn?H.I,$HH@H5LH=bVH=<&H5vH?[ HH4vH5H=%HHvH5H=H 1[]A\ùHH=mHHH5H=ɻHtI,$H=5<&H5uH? 1 H$MLD$H|$LLL UL*cL$$L[HLT$(L\$ gL\$ LT$(>L$I|$HI|$HwL$$P@L$$%1q0@gMt$HHt&I,$VHHxH5H=׺H 1[]A\ùHH=lH=;&H5tH?j HHFtH5,H=t+E1Ѧ Eޭ HD$0Iѭ HD$PH/ I黭 AXLH]H rqA\TL%HL"1PE1L('11HD$PjjH HHHH; ?&Hqt}Ht$H{?IHt)HH;D$H 9&H5sH9J E1HRE1L'HT$R1jj3H HH^E1HrH52E1H=9HiHLE1|H5~Lu F,H5OzLu AH5LǟL9&H5E1I8f HֹH=i.1[Mt I}HuIt$H}HY[]A\A]_AXH[L]A\A][ HֹH=\vil|HB=&HnHֹH=.@ifrH =&HdLHH1A1H1+HuVH5j&շ L1Lh A$0IHt)H@LE1T)HEE1H3H O8&H5h'E1H9 QHu^1ZH|7&H5e'H8 E1LLHE1vLLܾ H=z1~ID$Hy I|$@HcH,H}Ht HER IZ1[]A\A]A^A_H$9&H8tt 諿H5&H:W1[]A\LՅ 1m 1[ùHH=gtOHM,$LLd$H$HMMx`HH H uI I|$Ht$$%uX1 I|$Ht$ %tI|$H$uI̾LHH=v5&H5%H? 1i HuXHHHt$ Ht$h )!H5&H5gH: !HHH=5&H5%1HUH?_ 17!H-4&H5&H}9 1#L%4&H5d&I<$ 1"L-4&H5&I} 1"L5w4&H5%I> 1"L=Z4&H5%I? 1"H=4&H5>%H; 1s"L 4&H5$I9 1V"H|!1A"Iz0Ht'LT$XLT$XD$CH,$KIJ8Ht!Hq6H,$HL$GIJ@Ht!Hy2H,$HL$(CIJHHt"LAA-H,$HL$0>IJPHt"LIAH,$HL$8IJXHt"LYA}H,$HL$@IJ`Ht!HAyH,$HL$HIJhHt+HQuy H,$HL$IJpHt+Hqy H<$HL$ IJxHyHL$PHL$PHH5H=}1j LT$XLT$XAH,$LHH5H=w11 HLT$ ]LT$ IJp@4H=H5H=-1HH5ٱH=1HH5ʱH=1H_H5H=u1bHLT$LT$IJhPxLT$XLT$XAt:H,$VLT$XtLT$XH,$,? Ht0 H~HH5xH=1HH5eH=1zHH5TH=g1TLT$XLT$XAt7H,$l(LT$XLT$XAtYH,$EX HtMu5 H" Hnp HtaH 60&H5_!H9 1H=1/&HU H5^!1H?蔊uHNGdL/&H5e!I;e H HUE1A|H鯥 HIT$LH=3&HH9u[aH(L]A\= Ht4ӷH-<3&LUxHtI,$ 魥 H=)HH 1H/&H HH30 1HtHHH H=  H[xHtHHLL.&I8@ HH)ځ?I1H|$H)LI/ H|$蕌H|$HI ATUSHGu H59 IHuH5\HA-&1AH:諈>HH_1&HH{8sH{@uLHH{8A+tD[]A\RH=1&f H5*+HtH5H=%H=i1&H5-tH5H=H=0&H5T]tH5H=ѶH=]/&H5^3tH5H=W觶XHc1HHH0PUHSHQkAHtH30&H(E1HXHJ@HHHB@ZD[]H-,&H5P!L$H}; H $HoLg!LZLRLE1GL?7L2L( LE1LLLH5 A'ELIMt#M LθLƸLE1趸L%+&IQ1E1H5I<$QL艸L聸yL=+&IPH5 1I?E1LULMEH*&H51H;LE1%L-A+&HV1H54I}ÅLE1H,&L%?'LHH?~)H`HRE1H'E1H-*&HOH51IUH}9HlH[LSI9IL8LE1-%$H=<*&HQH5Y1H?迄LL-H|$0۶H,&H5H $H81zH $H讶L覶L螶LHL$茶HL$Z!H=)&H5E1H?) "HEfHIl$ID$ AL$( t6H +&H9KtLg"H$"H{uHK"H͍ ;"H5+&H9uuH}#"H!ID$8LE1軵!HHT$H4$H4$HT$x HH] HT$H4$YH4$HT$x H @ |$T[v`Ht$`D$PH|$HHNIu t Ht9HT$`R \5 \Lȁ ۠ L\$`fQ\A9٢ HfBYHT$` HRAL'HHT$R1jj_H H!!HYHL%'&#L|$ "L%>'LH)D$LxOfoD$"fo$L|$ LLL)T$ L%0'&L9 "LE1foD$!1!L-c>'LH)D$L耬xefoD$Y#fo$L|$ LLL)\$  L-&&L9"LE1舳foD$"L|$ %#L-&&[#1"H#1#H}XR$H<$tH_&&HH2l$u13$Hi$H$H$I}Xu)H F%&HoLH1< H$I}XtH$HЅ$$HuH=%&H1HNH7LNH]$1$MA(%LF(%HIp%H=%&HP1H5<H?E1L%LDHEI7%H $H%>%I|$k&%Md$I<$%L%,)&%H- )&k%L,$&MtIH5uLE1 %H|$Ht$1H=I)H\IHuE1%H5;LE1@ %Hp%H=c#&HV1H5H?LE1Ck%HkH}~$HEHHHD$HD$%H-8(&1B&L5&]uH1߰Lװ&%X"&H=DHYD$XfHD$`H|$@HD$ )D$0T$HT$hPHA1LD$APL*&jj1H HHU&Ll$01'AHDtGh8_u EH^L "&Ht$hI:讐H&D^A&H^&H%zH}HtHt$ ss_HH}XADž%w;=HT$HtDE1$=H<I=HT$HuHT$Hq<I=HT$I;=[H;H^>H[mHC@`|>fHC`C@>HC`6l>HCH$M>LA\HjLPE1L~Q&1LHD$Pjj躣H HH>?H=S&H5dH?| >H&H5fH:^ 騟 1ҹHH=ѮFtPIH I}Ht$T t1Ld$О M L L=oHX E16 PHg&H5'fH8 ZE1>HtI>E1>HWHGH~Hu H9puH8tH HOH| RHwH1ZIn H)1H|8 fmHCHS֟ H9HHHB?y I- HSHC} L&H5II;  H&H5?eIH: PH&H5H8 Z1f>H=+&H5[H? H>>Hl>>1>L赡A\H&H5&1H=*(1 HCPH? @HCXnY?HCP\a?HC`H?fCJH&HjLVE1L /&1LHD$PjjH HH>HC`>L&ISH5 1I:n_?LwL%&M9Ml?IVtrL HH G? urx8?H=&LH51H?n>LwL%w&M9u1E1 >1>LR&HRH5' 1I8m> up@>@ ux>qH[ٟ?L&H5-I8v ?L&H5CI:X H萟HM@H{H)HH<1AjHSZ@HS`HHuLH?H@H?H(H?HBwHS?H56)HHHILP H=&1ZHLL}@A@HT$H<$zH<$HT$?E1@LH?H$H&1H5H:ltH$H~A$E1r@HH9wH<IH?E1=@1ҹLH=JCA@1AL%&H5`I:莾 1jAL&H5itI;q 1MAAqAHA蕝`AHA脝OAH&H5H8) t%AHgAHEPECE1XDLE1HDHu(sH &H8H[]A\LHCPAL&1HD$PjjlH HH+D1EDpH)DH f&H5E1H9 fDHufoC(PDH/yHC0?Hk 7D1ZDHT$H5y'xtH|$Hts}.H|$HHtSHMtnHHA˙&DHu$L &DH51AI8]g DADH &H5AH:5 CH= &H5BAH? HNCH &H5H9 1CI1MCHJ&H5{H:ù 1CHrE(DIDL٘LE1ΘDPE1L(11HD$ Pjj{H HHECHCH|$dH|$$E1HHLwHgEM\$HENIPFLw&H5E1I; 2FIFd;IFd-0IFdIFd-IHֹH=?+;J1JHJHKHADH5?b1H=<JHmJ1NKH1&3KH &H5H9 1%KAKAqKHF &L >K!HK1KLAPE1L(LHT$R1jjΖH HHgKVE1L (11LHD$Pjj蛖H HHtL5KHiHE1 1— L &H5YE1I;F 齝 11 E1鮝 1KHULDrlBlV HMLDqlDKH5e &1ɺHVVLHT$(H5}'LxPH|$(HtULEHL$1HT$Ht$ExlA@lE1 H}H$DlH|$(•H$LL豕1KL袕.KH蕕1K艕_ML&H5I;. 1KHD$E1KM9tDHr&H5H; LLd$(11HLRLH$H$BKLH|$SKHMLZI fNHֹH=8M1[HֹH=37M1[HֹH=R7M1[LE1fANEH]A\A]iD 11E1P3 1PLL H|$0Ht H|$(Ht1 1 HĈH=ˆ[]A\A]A^A_L%&}QL|$ 5QL%'LH)D$LQxOfoD$cQfo$L|$ LLL)\$ L%&L9PLE1YfoD$P1PL%'LH)L$L)$ًxjfo$foL$RL|$ LL)D$ Ll L%&L9lQLE1fo$foL$QL%&QL|$ $Q14QL%'LH)D$LJxefoD$Rfo$L|$ LLL)T$ L%&L98RLE1RfoD$RL|$ [RL%V&R1RHuMHHHH)H9r:HxSL9oSHC1L)HH SHR^H=&IH#SfH@ @LE(L@(I I|$(HX HHtcHu HOHIiMtGH}LLIMMt$Mt&H} J ID$ Htk ID$HRLE1zRHQ'HDDDDDDD1H9頜 L\kHHthIHtdHHOLI謐MtIH蟐HcHHt.LHHHyHtLlZH[]A\A]LH1TE1z HE1?j HD$H|$AH/ LўI/A  H跞I/A 駝 HH|$H|$tG @tHyP1HH5Hr<H(H[]A\A]A^A_錏JH=LL$LTHt1LD$L8IHTRHT$1HHrГ LD$LL$H=8LL$LD$HL$Ht$HIHt$HHHL$LIMH|$L\$H|$LLL\$^LH讎L覎HQLD$LL$H\QWHHuH([]A\A]A^A_Lc_QIc^McfL OIPL?;QL2.QHH=wQQ1ҹH=vN1QQ1HHt$• Ht$QHD$>RHD$4RH&HHERHERHH=Sc0R3HRt&HuRHHNH5WH=c[1]A\Ha&H5QH8AR1]H:&H5DH8@R1]Ht$H<$H<$Ht$R1HLGHRH$LL$ H$HL$E11LL$ID$0R1ARY^SLcXS1@SHc5SE1SH H8E1H5VH=ӛUH_&H5cjE1H;լ TLLHM?kIG\L-&rXL-&YLV]ITH&ZLs&YL=g&UITL5L&0THKH8E1H5VH=T=TL5&L4$PXH &VL-&w[L=&Z0LE1%_L$Le&M9Z9_I\$IIL_H-&\PE1L(11HD$(PjjHt$(藊H HH1aH\$\LLr:IH_*L茊LE1聊_LtLjLE1__E1_H5{&H\'H`H5W&^Hh`LLL^HLvLIՉLE1ʉbH5&HaH|$HLoHl$u/LHl$艉H|$eHwLE1lkbL_MhcPE1L'11HHD$HPjjH HHeH`E1 bH LE1aML)IL8IHcHeH5%|`L=%aH=eL覈H蜈L菈LE1脈iLwLE1lwhL%%tL95tLF,tE1E1M9A3B84HIL9$$:@vLHIHWtAH8LLL[]A\A]A^A_zM) wIMԈT$E1HD$IHL$ Ld$E1T$B:#HD$(1J 'A+8)T$HD$(H9EuuALH<$YIH~vH<$I)`uL$H8LL[L]A\A]A^A_|BL#HHHuMIM9GMEuvIHH9:CBL#HHudMHL$Hl)Hl$H9l$L9d$ ~LLL)Eu;L$LLM)N$0tIL94$u L$$tIRMLLAyHsuIYt1L=%vL%rw?HxvHwPE1Ln(11HD$ PjjH HHw>vLIwH%wL%#%H5GwE1I<$蘢 wHzH{HzH {H=b%y{H=V%{H=J%N|H=>%|H=2%6}H=&%}H=%~H=%~H=%6Iyu!AI HtHH5%=H5%髀H=%鰀LHz-H5Q1H=svu'LHV-H5Q1H=\vQԁH=]%$Iyu!AI ʂzH?H騂H5%L_LE1Tq1xIIH[Y"HH_HPE1L(11HD$PjjH HH L%%11HH=h#A1E3L%c%1քH-U%E1х1HH=Fh"A1EH-%E1ATSHQHw1[ IHt1HSHtHs(H5%I|$tI|$(H=%LZ[A\1H9}@DL %GMAt L 3%GAt H p%FDHH5s%遅H=g%醅H[%uHu H1oL5%Ά[]A\A]A^k1ҹHH=t!4[1]A\1H81/~8HsHT$H=s1裿 {H7%HHD$91_H=avH`Ht$费H|$E1鰇H薹+CHHH$}1ՈHmH-H]H|-HHBHmHLjHmH0LE1D}?鰐 H-%隍 L=_%H5`I?؝ LE1 } H}HX11[]A\A]A^A_ H-%H50H}菝 E1; HLL餒 LL$*LL$AI L`+^ xLE1H(H5zMH=!3LH(E1H5UMH=2w[I|$H{@Y[]A\A]A^A_VHVY1饉H迀HHt{KHt}1mHZL%{I;tKH5>1z S{ tHkPHt H;k@tԉL%H5{q1I:B H5&R1/ H-%HEHYfHD$0D$HHD$PHD$ )D$ T$8T$XPAL&HT$R1jjzH IHl$ Ht0H8HRSt!H*I|$Ht$ >1H1ELHT$L$LT$衜LT$L$HT$T LE1vzHnzLfzLt$ I LT$HL\$@H|$0HD$8| LT$H=%LT$XL\$XL9_HLT$HL\$@ H|$0HD$8z L-4%H5I}謚 Lt$ E1Ih HHT$L$ԛL$HT$j LL$$躛L$$ HE1yLyLL$ I L=%H5I?% ^LE1SyLd$ I$ј E1 4CH=`%H5H?ٙ 1遉H%H5gbH:躙 ^HP邉H%鹉H %H5nH9耙 $1ҹHH=A8H=I% L%H5I86 HC ŠH=%H5+H? HKxHC 闊HC 銊H1LAPE1L'LHT$R1jjwH HHHiHVE1L'11LHD$PjjwH HHtLWH=Z%~HiHRE1L7'LHT$R1jjGwH HH11)'HHtLp HSHHs8CLx)HuDLL+HHD$wHD$鞊Hw1鏊H==%H5fUH?覗 1rPE1L47'11LHD$PjjvH HHGLL/MtHt0H蔡AăsHىLAH=%BL%w%H5I<$ H|$pHtHD$p'v|$4u1HD$H|$v1ƍŎH5%AnLDT$L$鵊AM (HHEIIET$AQAT$D@ A < A@LHHtLH0L@A EGMcM9MO8IcA I9LO#IuAu D$ KLT$(DDE1PLATDt$0DLD$x:)ZYHAHt$hLT$(AELFLN AA0EACը9 IIMM9MMELM9 H~DH|$LHRLL$HD\$@LD$(M, IH"D\$@LD$(LL$HE}A tE$IDT$ AM9.ITE$IrIrrM9I|$LLHM<$H)O\H)LO\HHME1LDH$VATLL$(t$0'_AXIH\Au!MtAA$AtGlfGlE1E4$CDCDD$ oA IAE)E,$G|G|MM)L LM=#H|$r鹊H]D+HDŽ$L$ A0I.A*nE1H|$Ht$HT$`HHTHpIHHILD+HA.tGA.LD$L9D$`XHT%H5H;ݒ H|$hH rHl$(IHM/HA*H|$Ht$HT$`LT$@(HH}HhHt$@L%%H5GI<$O KuH=L$ IL$ A-A}I LcHD+HCDkAELcHL)HHL9mMk IMIE>AM (HHA tA9IIA|$AqAt$ILHI܇A.tL%%H5DFI<$< 8IiLT$(BLT$(LAC]tA.Euп/ HxD+HCDkD)D9Ek Gt)ʾpH=LG1ćHl$(IIM)LDLL$HLD\$@MDT$(LD$ :LD$ DT$(D\$@LL$HML%%H5I<$L HMWEE$AEGLfGL4MI|$LHM$KLKLLH)H)LHH L-b%H5JeI}ʏ Ex<$(vALT$(LCDkE1ńE1齄Ht$@șLT$@AcHl$(E1EEHH EoI_{E1鼅L$ A+H5%MGMEMO(I"IIH5%貱Ht$\LLT$(`LT$(HrH=D$[ILL$[AA 齄LH5g'LT$(LT$(HHtDLT$@HD$(!H|$(ImMLIOLT$@tsMGMO DLLT$(/t#IH L@LT$(LH IoL%U%H561HUI<$:L %H='%HQH5L81H?:LlAiAdEELjfAIDL$HLHHL$(LT$@`T$HLD$@HLD$@HRt$ DH|$(vH|$(IFlLT$@L|$hMAG `MOH@tMO0|$ MGEAA02t$ LDDLT$(uLT$(IEQH%DT$(L$(IoDHL%aH;H5 HH }LEID1F9BD$ A+M9MMML$ A#L$ A xLHHH5%軮IMw(A6@t$[AX,H<$H{L}AII!AM).(I#LD$@T$HH+A zHL-%I}V*I}H5 ?HE_ D\$[AL5S%H5q?I>܊ H8%$H;UVD $1D$[IAD$~H%H5`H;苊 MOHIV!H%H5 ?H;^ ZAIELH)HIIH.|$4t H|$\iH<$L LHHD$@iHt%HD$`D$4HD$|~AD$4PH)%H5RH8貉 1ZPD‰E11HD$Px ZY銂1鐂HֹH=y 1LHHHH B%H=%H5H?/ 1SHuHq1=ALH{L%HE1l[]A\  HuH{t1˃1ӃÃH==%H5H?覈 1_H鼄HG)H5a)H=Wa]w161H-n H-%H5H}Q 1 HH(H5(H=a wHC܅I,$,HH(H51H=]v鱅H=p%H56H?ه 閅HHH51H=e]vt1LH=D2(Hx HC(H [HHtHT$Ht$H|$HHt$HT$H|$HATIUHSHHD$ Hu ID$HyHt$ HMuQHxH9H=.%H5HH? ,HuHHUHL[1]A\TIL$(T$ 1)H[]A\H.%H5R1H8蕆 H1eՅHLLø LI<HEH)I$Le 觸 HE(~HH1{e銅L='%LE1_eH= %H1De陆L5%Ht%H51H8ۅ pH1 eaHH%H5[H8豅 15L-%цL%P[1]A\H5d%OIyIQ( ~莱HH\Y[]A\A]A^A_PE1L'11HD$ Pjj.dH HHm4HZHg%H5YH; 1:L骊HH5%荧鋌IyIQ( ̰HHLHPE1H54H=HYJsZLH+E1H54H=0Y%s8H5%2Iy'IQ( 鳎CH*H鑎1ҹHH=K{u[1]A\R1ҹHH=KUu[1]A\lATSHQHw1IHtHSHs Hx LZ[A\譯Ht1 H鼏蓯Ht1顐H]Ht$dH|$E1鵐HH#H5e3H=Yq1HHt$ H|$G A<$@I2AIH!$Lc4$I9}|t|t~C<LIIMtyHtgHLLutYLaLa$C4LgH餐耶E1鞒Lg0鎐鐒C<4CL[H@)CIHH5dRdLd$(Ld$0H|$@8M[~ H{HBt&H51r ϗ貞H:H5](1fr 驗H2%H110HD$_\M #H%H5H:r LHQMtL;QHE10Q鯚IHH|$Ht$ 鞛LH=?HBL&%H5I8q 1閛HHfH5LH=GK`E1E1H HH51H=G`C鋛L%H5wI8q E1NLH=G~D1H HE1H5H=cG_HHH5E1H=>G_כAoa)d$0?Ht$ H|$\LHD$bHD$XHt$H|$1Ll$饚H %IQ1MH5H9LE1POHoL:O$L%V%IQH5K1I<$E1驠LE1O陠HQ%IIHH81LE1NߢH%H5FH8qo 1HA鏥L %H5+I9Ko t LmMs 1s HEs E1鱦LE1MN顦E1wHa%H5E1H:n {LE1N LE1N饧L%)MuOH=%1IH`ID$LAD$H=R)uI$L%D)+I$![1]A\ÃLHD$|MHD$[HjMHHG1@qgH;%;WnLL$LD$T$4$DIHU4$UHLL$LD$ыT$LXHEHh(PLILH0L[]A\A]A^ÉӉLkJB AAJLAC<@zLE DBHD9 DZLA 8AHzAJLAC J@tLϨ@tL/鳬LUI}HMEH1BxH5%HzͬL|=HHU)H=%H6H5 ;1H?<H z%H61E1H5߶H9^1@BMI eH:%H5E1H:c 雮Lr0LrHA*AC AIL%H5ۏ1I8YHB1韯H|$`HHlL %H5/I9$c H\B1jHMB1[Lg%H5I:b H(B16L}4\DH˯H}HE1//E1'EtC@ItME߯LLH=D1ULHALIA߯MUHLA̯E1įL鈯IuHLE1Q飯YAA'ҰHH鿰H=[%H1H58H?ͰH ;%H1E1H5H9骰HH\H5E1H=8oPDH %H5E1H:qa &L%H5I8Va 1HMHH5 1H=88PHH=8 HHH5 1H=7O駱E1\E11e1^LH%H5I8` E1iI $HnE1H5^ H=7hOCHHaH5G E1H={7COL߱%H5I:H` E1HT$fHҳHT$馲HH=17A颳HHH5 H=7NIMHE1H5 H=6NrIMH}E1H5m H=6wNdHH=6 P顴藋HLL ڰ%H5I9C_ E1 HHH5H=I6ME1酳HH=<6bE1HLD$ IHuH|$Ht$ E1H|$Ht$ LD$дL/%H5I8^ E1HHnH5TE1H=5PMȴE1SI $H(E1H5H=5"M隴hIHH|$Ht$ `LH=S5µLx%H5>I8] 1XHHH5H= 5LE1E1ߴH HqH5d1H=4lLML%H5I8l] 1&H H+H51H=4&LLH=4%FHHuAH|$Ht$ 钵E1uE1sHHH5H=24KaҵLwL#LH\H5hH=3rK`HH=3:HHEH5+H=3*K1ڵH=%H5H?(\ H;wt&I,$8HHH5H=j3JH1[]A\ùHH=F3\tϵH=D%H5 H?[ HHH5oH=3nJHvt&I,$aHH#H5/H=29JH1[]A\ùHH=2tH=%H5sH?[ HHH5H=u2I뜹HH=p2lu H(1[]A\A]THHH5H==2II|$dƒD$ 蹆T$ HH=%H5H?dZ 1_LsurM,$11HLHH5H=1H>H.ut&I,$鋶HHH5H=1HH 1[]A\ùHH=a1Ot"H=7%H5H?Y HH|H5bH=#1aHLtaL#նHHDH5*H=0)H71HH=0j H=%H5^H?Y LHH5H=0GͶLst 镼L)%H5I;X MgHtLsA ML$H醼ML$H|LT$xL+$MnMD$0 MD$HtI|$H@u7I|$HI|$0H5%H>#ufE1ǽH=j%H5cH?W LE1(7顽H 8%HP1H5SH9LE16iv2L%%I$SH|$rH|$t1闾H []A\A]A^饭蠋1zLgHc苋1e HoHc H|$QrH|$\c 1e H([]A\A]A^A_ILE1>6 HH=.pYIHuH|$Ht$ h݂HZ¿E1H|$Ht$ LD$L %H5I8rV E1HHHH5.H='.-EE1GIMHE1H5H=-E鳿8qg 1[i H([]A\A]A^A_5LeHg E IxEA+|m 1k LPn l HD$4HD$n HHD$4HD$n 轁Hu(H{OuH=%DH5ک1H?`Z1[]A\A]A^A_HHS H)I9HI LH=IvH %LH5<-1H9Le%H5(I:T y1h 4HuIA DHH=,oBI}^ƒD$ 蒀T$ HH=ԥ%H5H?=T H(1[]A\A]HHH5H=l,B1oL"otMe11\LHH5H=',B돹LH=,CE1IHuH|$Ht$ HLE1H|$Ht$ LD$kH%H5H;JS E1HH H5E1H=+BcE1I $HE1H5H=[+A5Lp%H56I8R 1@~IHH|$Ht$ E1H HpH5c1H=+kAHHdH5J1H=*GAE1xLH=*1L%H5yI8R 1@~IHH|$Ht$ E1qH HH51H=W*@HHH51H=3*@sE1LH= *{1CH %LH13tu%LH1[]A\H}HWH}HNHt$H譟uHHuL$$LH+\$H1HHt@ t LFH@tLF01H9}fAxHLFH1HLH='1[]A\鐂H ѡ%LH1nslLH1A\1Z1[]A\A]1L/L/{HֹH=(.HLLi/La/HHV//1H=%H5TH?O 1HHH5H=&>1lHHyH5H=&>1HHH-!%H5H}O 1H-]1A\A]H|$(.H|$ ..Ht$$ LE1y.vLl.Hd.H{0HunH{H HCE1>.K${HuH=%LH?]L.L <%H5E1I9N HC HC0-1<1[)1HH=^腈 Z1]A\HHD$-HD$4 HHi HvHHCj-H{Hki HGH$i 5zHtH %H9Mi (H{HVi H{H{)i HGHP(Hr H:Q1H%H:/kLE1,Hy IH Il$HHEH8HLpV Ht,It$HHpHH? HPHLp H1,Ic|$WnHH HHLYp H+Hx IHIt$HGHHH HPHLoz H+`H8x IHjIt$HHHP HHLo$ HB+It$HHH H@HLgo H+H-*%YHw IHIt$L5QHLHH HHLny H*It$HZHHHb HHLn6 HT*It$LHTHH# HHLvnH*It$ LHHHH`HL7nH)Hv IHIt$HHHHHLm_H})It$HHyHHHHHLmH:)Hp)v IH It$H`HHH@HLBmH(It$H$HHHHLmH(mHXu IHwIt$HHHHVHHLl*HH(It$HHDHHHHLflH(Il$Ht-HEHHL4lH'H-%Ht IHIt$HHHHxHHLkLHj'It$HHfHH5HHLk H''Il$HHEHHLRkH&Hs IHIt$HHHHHHLjsH&YHPs IHcIl$H1HEHHHLj#HA&It$HHHHxHLfjH&It$HyHHHHHL#jH%It$ HHHHHHLiaH%It$(HHHQHHLi%HC%Il$0HRHEHHLniH %Hxq IHIt$H3HHH8HLiH$|Hq IHIl$HHEHHHLhCHL5Z$It$LHZHH)HHL|hH$It$H;HHHHHL9hH#It$ HLHHHHHLgwH#It$(LHHHdHHLg8HV#Hc~8xeHHt,E1H-a%H p IHE1L-5%IEH-$%H-%ZH- %Ho IHHXo IHtIt$HHH{HHLfOHm"It$HHH?HHLfHL5*"It$LH*HHHHLLfH!It$ LHHHHHL fH!Il$(HHEHHLet\Hz!BHin IHIIt$HXHYHHt,HPHLe[H!MLE1 !H-.%Hhm IHIt$H'HHtHHL etH At$HwHHtHXHLdZHx It$HHHJH8HLdH< H+m IH It$HHHHHPHL=dHHl IHIt$HHHHHLceHL5|It$LH|HHKHHLcH=It$LH=HH HHL_cHHk IHIt$H$HHHHLcHL5#It$LHHHmHHLbAH_It$LH_HH.HHLbH H0k IHIt$HIHHHHL+bHIt$H HHH`HLapHIt$HHH`H8HLa4HRIc|$ x_HH'HHLzaHHH j IHIt$HBHHHHL$aHIt$HHHHHL`iHL5It$LHHHOHHL`#HAIt$ LHAHHHHLc`HIl$(HtFHEHHL1`HHH-%H-ے%L-Ғ%IEHLE1HxLE1mH-%H`Sh IHHsLHH\I$8HLl_3H HkH:HEI$HL6_HsLqHHI$HL^HHg IHHsLHHI$ HL^iHAHsLHHVI$0HLf^-HHsLIHHI$HL*^HH-%Hf IH HsLHHI$HL]HdHsLHHyI$HL]PH(HsLlHH=I$HLM]HHe IH<HsL5LLɼHHI$HL\HHsLL芼HHI$@HL\rHJeH9e IHHsHrL*HH;I$(HLK\HHd IH:{tyI$8HEI$XHL[HHsHL蓻HHI$@HL[{HSnIl$ HEH6d IHHsLnHH?I$HLO[HHsL2HHI$8HL[HHc IHHsLHHI$8HLZHYsLNmHHoI$HLZFH9H c IHns(1I$(HEI$XHLZHHsLHHI$`HLYHyH8hb IHHsHLYHHjI$(HLzYAHsLlHH/I$HL?YHI$HEI$HEI$HEHa IHHsLHHI$HLXt{HSHsH1oHHtdI$pHLtXt?HHsH\LHHt)I$HL9XHMt@LE1,H-%H-%iH(` IHE1H0` IHtHsL軿HHtI$ HLWgH?HsH.L<HHMI$xHL]W$HH_ IHLHsL#HHI$ HLWHHsHL蠶HHI$xHLVH`{H O_ IHHsL臾HHXI$8HLhV/H"Hx^ IHWHsL.HHI$ HLVHHsHL諵HHI$xHLUHk醾HZ^ IHHsL蒽HHcI$HLsU:HHsLVHH'I$8HL7UHHsHŎLӴHHI$xHLTH鮽H] IHHsL躼HHI$8HLTbH:UHp,] IHHsLdHH5I$8HLET HHsLSHHI$xHLTHHsLHHI$HLSHg邼L6LHHx1L*I9L[LMADM wIcLH*I$HI HI$HI$HI$HI$HI$PHI$`HI$HI$ HI$HvHH$hL`H$RHO1C1<L%j%YE1PK L%CK HֹH=WmL-#%H=%HQH5#1H?18PE1L&11HD$PjjHt$(x H HH]Ld$yZHEIIHLTHH$LHlLu>? NH2 LE1' LHkLu7 Z LE1 L LE1  LE1 H%H5)E1H;k- iE1nHLcku L LMw qLH7kLu<[ H|$Hk HLd$4 LE1)  HLHD$ jHt$ u H HM LE1 @Ht$Ht$45HL$H%H9AUIVMHIH AHt$AHt$Lg L_ *M}HbM}HuM}HA L9LNI~_H$Ht[HuLd$E1Ht$IL9MC 'H%<ILFE1HM HLLL$siHD$LHD$ LL$?@M}HtM}0 H9HNHyHHtIvL$$E1Ht$H\$HL9t$HRA<L%E%A<<HL  Hy nMu @M}HtM}0 H9HNH}HHIvL$$E1Ht$H\$HL9t$HE$_fAL %CֵHKH bMT$IHLLu%H5E1I8($ &Ld$E<$D|$IHL}1LMxHr|$C:<>SIsHuL Vx%M9M HWIl$L-)LE1阻HL$HHu,L x%L9A^LߴHHtUIT$H,1LĴHHt:H ~LHKaH[kHI\$L(LE1GLHaHu +D!HMuH鉹E1;LMI uHMJMT$IEM*L)K|>HHH 4It$HGLHpdzIHH 9M\$IELHHD$ :`H|$ u5\IHLLH`Lu5H2'=HL4y%A<8LUIEIL$$M*L<MT$HLT$HHr%H5E1H;]! [LHzIHHHA_u+HeILMl$HIMHL$$6LHLHD$ ^L\$ u LLI $HE1H5sH=}Lr%H5߫I: E1H[H5AE1H==HH=rϢFHt$(wIHHL$I4$E1HAH/ALE1/APA?Hs%L HH=6@C@f\rHf\nHf\tHLu%H5)I:c IL$H; u%HqtDHHt$2vHHH;D$H p%H5]H9 HܩH5H=g w` H5IH2_IVHrAHHA|HeHnAʃ?HAɀA?HAʀDPLL1I|$L1jLrIuHL1HL1K1LUMMUHI|$LYjH1LTLGHHD$I I|$L1jLLH1LH5VlHmHH HH=襟IMH; ms%%LAAtiHHt$sHHt&_H;D$L En%H5 I9 E1IMHkE1H5[H=e qHaH5GE1H=hC O H]ݹHk HkHtm%H5qH:% [1]A\A]A^H m%HH51H9H=~m%DH5q1H?L am%H5I9 LIm%H5I: I~%AGHcGHUHLH=/&LE1膸IHJ/]A\A]JGIHH|$Ht$ H HŦH51H= L\l%H5"I8 1HHH51H= E1`LH= 1LD$_LE1胹qHUHB:Ht$H(AE\Ht$uVAExH+r%IUH]0cLEHCHt$Hþ(AE\Ht$t{fAEN{I]HHt$H|$/Ht$H}LkH]HMnHqHUH@)HU0 MnHSLEH@bLE0YHSq%AAAEUALAAAE:E]HAAB AAMH8FAA EULAAACAAUHIUB<A}LG EM~LMHLt$ C@MtMC4IEt@MtMC4 /MD$HLEHL]HMD$HHHH $I.E1HHH L?BwH HH LUH!uML5nh%RD$N_IvPLD$O_٬IHtxHuH}(ĬHHIH;l$0tLE1VHNHE1~L6H.ILLL<1LD$MM>MUL2QLLSAWRLt$(t$@LL$@LD$PHL$0y:H0?L\$M MM $LD$O_#DMfD9AASm@8/AH1j%H5BjH8 #1.EE 1f.MEDED8AADUD8AAHLD$W9IHthHt$HB9HHt[HLaLD$EH=D$mHUH9@@YHEH9G?L/UHH?HtH}HtH}>H]5He%H5H8o 1ZHd%H5MH:U PHd%H54H8< 1Z1HCPdHC`RpHU3HT$&?HtC1HIHT$>HuHT$HvIHT$I.LE1"ǃ1Hh%ǃHH=c%H5hH?O 1Ld%H5|I82 1E151[]A\1[]A\LՅ1H HH5H=Jx1D$ D$ H#d%H5gH: 1HD$HL$1HHfHc%H5gHL$H:f HD$FU1HSHHH5JHILD$荑u1H$Ht$HӅxH|g%HH[]ATIUHSHH u11HsLՅxH:g%H[]A\E1KL e%;L d%3L b%I#1ҹHH=+ xH1[]A\H a%LH51H9NHa%H5WH:6 H=a%H5H? I<$Ht$>I HH=!Jt1LE1UIoXHt1H%e%HKLHl$H3. HT$H=Hy(HHf%LH2_tL_H5=&Li{HHHHD$< HIHD$6L HHHD$HLH|$HD$- H|$HD$HL$HD$HHL$HT$(H5:=&LHD$CLD$LT$Ht$(LD$fHnfI:"HHt$0H==&LT$H)D$0 H|$(IH|$MHD$tMLHD$iL\$L\,L%c%H3LI4$ 1NL.HD$H!12LLLT$H H|$ILLSH|$H|$LuL\$bHD$LE11]LAtHH|$D$JIHtnHHcLIUHMML<HPALV&1HD$(PjjH HHAE1yHE1LafHH*XD$D$LwLpIHtMI~HH5_%/IL^HYHE1LE1: LE1*L"LE1AI?I)L9H-^%H5aE1H} LGH=]%H5aE1H?r L!H ]%H5aE1H9L LM HK\%H9tpHHPHtvH1HtnLIHL@L;^%tI9toL LK]%IPH5a1I:ηLE1kHWB%tWH=]%HPH5a1E1H?萷8LHAA%tL\%H5RaI;j LE1?HֹH=Ɍ1[HֹH=褌1[HֹH=J1[L\$LT$LL$LLLHl$Hu'H|$HtH|$Hu^HLmHt$LT,uBH;3tULLLL\$H3I{,,tBIk@LHEH]@HHHkjA\HT$H|$L,HֹH=s)1[HֹH=|N$1[HֹH=)1[L|$ LUL9SLEI$LL%Z%LuL%Z%AL|$ YL%$s&LH)D$LxKfoD$tfo$L|$ LLL)\$ / L%AZ%L9&LE1 foD$1 HֹH=2H1[LLE1LE1HE1LE1H}LE1vHneHE1^UHauBH{ xHAHH9AENkLE1[1]A\2Hu5LbIHt*H=X%H5H? L1RM\H LH4$莰H4$$ E1"h2HEE1 E1H2HupLH5q&LQIHtL|$ LHZmHHtHHA' H 3X%HP1AH5R]H9貲^' 1HtA[' e' AK' ; H=lE1 A AHH9@@LLn=LE1^jA{HABhH|$A/UE1MHY%H5H8 1AJL$ HX%H5H8 1HD$UH$LHD$<HD$28 f(Bf/f(f(+1wG`lZH U%H<$H5\H9  H$XHU%H5\H8 1;H hU%H<$H5%\H9 H$HEU%H5.\H8 11Z1f.GEOGW 1H Ht$0H|$.HD$bHt$ H|$ HD$AH ZH(L[]A\A]A^A_3HH5_IvLHH5TL)IvLIvL1HH5 H(L[]A\A]A^A_еEtHH5軵rIvLqXHH5L腵v1 H-!dI}H D%H-GH9OHD1HH5VAHD$HH5$ gE1HHH5^L֨k~H-=L<AIEAۃA9dMfMtuI$HD${E1|$L;t$MtHHLgKtT$LIHH5I.uHD$HzC%HH5I9^IvHt?IvH(L[]A\A]A^A_IAE1HtLM9}JT:tIE1E1E1AH{2EuHH5tLeHH5LIHsHtL1$H{E1HL'HS HH*HD$L)L9d$EuHH5tLԦLCHL$LIt#lHxJHs LLMLL$t7HH5L聦8Ht$L6HD$HE1TH{HtH?"E11!HH5AsL)L[HH+D$LIt"MyH|$H$HH5ЙL败kHS0LJteuKHH5Lx*H{(tREuHH5{rLKHH5iL/Hs(L"HH5)LIvD$0b@HvD$0>L<%H5CI:111[]A\E1H|$LE1LLE1LE1H~LE1swH:%H5SE1H:Y1LvHH14HC " ]8uH :%H83zILE14Ht$H|$l x,D$ I,$A I\$LS0 Lt$ ImA  E1 L$ ) I,$tIm IULR0 IL$LQ0Im 18 I H|$;H|$L|$ L%0:%L%$R&LH)D$L衿xOfoD$fo$L|$ LLL)T$ 4 L%9%L9LE1foD$1H=%H;زH;H5A1E1KH]8%H8xI4HH=Be!RZ1[]1ҹH=!emi;X\Ef(fTEXo1|$H<%H5H8n1L:%H5I8QIYIk)H=MsIE1H=7%H5AH?IHiHRE1L%HT$0R1jjH HHE1HLE1HPE1LC%11HD$0PjjH HHtHHL$Ҝ8u%(u1Lwy$11Ha6%H8v1ML+t$mHp;%H5a?H: HֹH=%Xg1[HֹH=3g1[L%N&LH)D$LmxefoD$fo$L|$ LLL)\$ L%6%L9LE1ufoD$L%6%lL|$ 1HֹH=fZ1[H1Ht$H=6%H5@?H?1Ht$HD$H9%H5=H:s>1Hs0iK H=9J1rL@Hdt0L[H@tL[0E$-tLKH@tLK0E$)L[HLKHLc4%H5zI8AAH6%H5߂H;AALS0LSHH Mt3L 4%LH5rz1I9@L;L%pH (L%pLy4%H5jI8HHH  &1HLD$IH$H~A1EtH4$H|$,H1 H 4%H5t3H911ҹHH=H*d1I4$H; 9%tAHHT$HHD$\HT$H\(H]D1=AAAJ\Ht#?NE1H[HH@]A\[]A\P H=LGHZ1[]A\" " IJLk@LHt&LC@I.E1%6E1Hx][H=BG1]Ã1E1M @@HMHqHM0hHuH@Hu0w%HH1|HEHHHuN 6E HMHH}HE8HE0E t HMH@tHM08M I@ t LMH@tLM0H}(MMI)IIIM9s7AB AZIIHH AZHH AZHH ICLL_1H)HHM9LLBHMM9HBHL9sDHIfEY@t @HUHtHU0DE Hu@AfrAHuDE HE8HE07HE(HE@#L%H&LH)D$LXfoD$fo$L|$ LLL)\$  L%0%L9|LE1\foD$FHGHp`Ht^H H9N(uQHT$0Ht$ H=qE&)D$ 7v 'HuH9sLEiI$LHH[]A\A]A^A_C L%/%L|$ 61L豼H1L^LLE1苼H{ NH{(=H{0,1H IHE11rH+H|$H<$H|$ oH<$HtH|$HSIL׻-5 A H *%H5 6H9 1 L*%H5IdI:1 HHyH5H=1u LB*%H5dI;1X HֹH=R[J 10 HH)yH55H=&?1 HuɏH-%o 12 Ht'H~t PH*%HH5UH811ZH=ߵ1_Ht$(H|$ 豧 { HD$ L%HL 1L H*%H5H81/ H)%H5[5H:{1 HD$覶1r HHt$rHT$ 1P HHHT$HHT$ > HHHHHHHHHHHH`HHHHPHHHHHHpHHHHGHH\$E1HL5+%H5"=I>RH$H|A\L(%H5<H1I8HCuH$H$L)1CuHDŽ$LH ,(%H5<AH9HD$HGL '%H5<I9Ht$H H'%H5;AH8VAHuhLyHu0LyqHXLyt HuHLyWZHLy7?HL`yAǃ >HL=yAŃGHuXLy\6HLxÃR9HpLxAŃ7HLxo Hu8LxAŃOEHLxxAǃ,C<HLUx :HL5xAŃ;ECHDŽ$LHLLEL$MKIKI_H4$H_HD$HL$E1Dl$0MLT$ MLd$`IHLH9hDMEH=b7M4I:H $HT$ LLQD$@X:LL$@RI9mLL$LT$MLHHLL|H$HvL=hDL9H $H$HHiA9EHDŽ$HDH@LL2L$MxL;%B"%SLt9jH $H$LHA=9EBHDŽ$Lfn$L$f:"$fDn$fD:"$fMnfL:"$fDlMWH<$HD)L$ D)D$1fDoT$fDo\$ HHT$DXDP8HOHLLGL$MII_H4$He\HD$ HE1Dl$MMLd$0IHLH9IEH=L4I7H $H$LLD$`7LZL$`I9mtL$LL$ MDHAOH-B%H5AAH}-L %H5=AI: H=%H5=H1H?~vH=%HDŽ$表HDŽ$LLLd$0Dl$HDŽ$MlHLLZH$HD$H%HL$Hy0LD$L<$IxLH|$`ZD~d$ HD$hfL:"D)d$PH HD$ Dl$pL$Ld$xMLL$`L9L$ LD$H\$ H=MHMHD$ HL$1Dl$`MLL$0MLd$@IHHH9cIEH=6L4IH $HT$0LL]D$PdLDD$PE\I9mVL$HL$ LLHH$H5.AH:p薱L$H58H1I:KXL %H5I90L$MII_H4$H<HD$ HH$E1Dl$`MHT$0MLd$@IHLH9'MMH=N M4IQGH $HT$0LLD$PL贉D$PI9mbH$HL$ HtHH$H5 AH:*PL$H5 H1I;WH i$H5" H9H-F$H5W AH}ȩ1H $H5p H1H9VLLLLd$@HDŽ$Dl$`轈HLLL$MEL;=$ H=~H$H$LWHDŽ$L:4$D$AR$RD$ASH$D$L$HL$@HT$0H$ Ht$(H HH@LLLd$@Dl$`HDŽ$M讇HLLL$MLI\I_H4$H9HD$0HL$E1Dl$@MLD$`MLd$PIHLH9IuH=w L4IzpH $HT$`LL>D$hEL݆L$h?I9mL$HT$0LTHH $H5AH9SH=$H5PH?8H=$H5 AH?=L=n$H5H1I?SLLd$PDl$@HDŽ$HLLL$MRL; $-LLL$:0HD$H $H$HHHD$`D$L$H|$`HDŽ$vHLLdDH$HH;-t$LH$H$HArEwHDŽ$HARt$D$AWD$ARD$AS$RL$L$HL$`HT$PH$H$H\$8H0HHL5$H5zI>*H=$HDŽ$MHDŽ$Le$H5I:H$HH{0H{H4$H|$}6HD$0HMH$Dl$@E1HD$`Ld$PILH;\$3Ml$LMlIE H $HT$`LHD$hLpDL$hEHD$I9D$H$HL$0H|HxH=X$H5AH?ۣDL2$H5H1I8P_H-$H5CAH}蔣躩L$H5\H1I;oPH=$HDŽ$蒂HDŽ$ LLd$PDl$@HDŽ$cHLLQH$HbH; a$=LHL$LT$H $H$HLLT$`D$LD\$ELH|$`HDŽ$ȁHLLH$HeH;-$@LH$H$HfAEHDŽ$HGAQt$D$AV$R$VD$APL$L$HL$`HT$PH$H$.5H\$8H0HHBH$H5H8~'H=$HDŽ$血HDŽ$L$H5jI::LLLd$PHDŽ$Dl$@THLLBVL$MI~MfH4$L2HHjL$Dl$@E1ILL$`M9IVH=0J,HE2(H $HT$`HLD$P HD\$PEM9fVL$NDIH$H5AH8w4L e$H5H1I9LLM$H5FI;ΟwL52$H5I>賟\H=$HDŽ$~HDŽ$LDl$@HDŽ$~4$$IP$V$QD$HL$PHT$@Ht$0H$*QLT$(H IHH=y$HDŽ$8~HDŽ$H=P$H5H?ўzHPLL2L$MfI~vInH4$HP0HELE1IEI9HCH=dN$I$ H$H$LD$ LY}L$H9kH$KTIHLLsL$MmI}I_H4$Ht/HD$HD1Dl$ MMLd$0IHHH9IuH= L4I H $H$LLD$` Lj|DD$`EI9mL$HT$LLH|HLA_fn$H<$Hf:"$fn$f:"$fl)D$HKH|$H,H@LL$L$M5L;-$H= H $H$LH[A EHDŽ$L6{HLL$L$ML;%4$H=b XH $HH$L, 2HDŽ$LzfDn$H<$HfD:"$fDn$fD:"$D~$fL:"$fElD)L$ D)T$fDo\$fDod$ HHt$DXD`8HAFHLLH$HRH=V QGH $H$HHAEHDŽ$HyHLLL$MI)L$$ILH|$0+HD$`HH$Dl$hHD$HD$PLt$0L9t$FIwL\$H=s N4If\L$LHHDŽ$Lx2H$HH= H$xLxVH=$HDŽ$^xHDŽ$H=v$HDŽ$5xHDŽ$tL\$IH8LLL$ML;-$H=?5H$H$L HDŽ$LwHPLL~:L$MI}gI]H4$H)HD$HLt$0E1Ld$ IHLH9M]H=M4IoeH $H$LLD$`7Lv|$`1I9mH$HL$HDHHPLLL$MHIXMgH4$L(HHDl$E1IM9`IwH=J,HEJH $H$HL:D$ THuD\$ EM9gH$J|IHLLH$HL=tLH $H$HHhAEſHDŽ$HCuHLL1H$H H{0H{H4$H|$'HD$ HUH$Dl$`E1HD$0Ld$@ILH;\$It$LL,IE H $HT$0LHD$PLytDL$PEپLT$M9T$H$L\$ ITHyHLL.H$HL=LvlH $H$HHA?EDHDŽ$HsHLLH$HH{H{H4$H|$&HD$ HԽL$Dl$`1LD$0Ld$@IHH;\$It$LL,IEH $HT$0LHZD$PaLrD\$PEYHD$I9D$\L$HL$ LDHyLLd$@Dl$`HDŽ$rHLLAH=$H5AH?!LLd$@Dl$`HDŽ$>rHLL,AGH=:$H5AH?轒&H$H5AH8蜒˜L=$H5H1I?w? H-$H5AH}U{L=$H5H1I?0?ٻL$MI~I^H4$H#HL$HD$1LD$0Dl$`IHHH9MVLM$I$`VHT$0H $LL$D$@+LpT$@%I9nL$HD$L\HL$MI~MfH4$L"HȺL$HD$1LL$0Dl$`IL9IFLH,HEH $HT$0HLTD$@[HoL$@UM9f=L$H|$LDHH$H5oAH:i菖L$H5yH1I:D=L5$H5I>)ҹL$H5AI8q.H _$H5H1H9<錹LHl$Dl$`HDŽ$oL$fDn$fDn$fD:"$fD:"$fInfH:"D$ fElMH<$H)D$ D)|$WfoT$foL$ HLT$ HhHP8IH-$H5UH} 鵸LHl$Dl$`HDŽ$)n4$D$HAVD$D$$Ht$0H$kLL$IZYH FL$H5"I;肎L|$IHT$HL $H5I9JH$LH5 H81*;ӷHPLLSH$HH}LeH4$LHHCE1L-HM96L[LOHD$`LMHLL賣Ld$`MLHT$hLHAEHD$`L[M4$|$XWDD$hDL$dL$lT$xH$H$kLD$IA^A_H0-A H ($H5AH9mL $H5AI9mޯL$H5oAI;im齯A鲯L$H5AI:=m鑯A醯Hl$E1HEqH y$H5AH9lPH`$H5H;lA*H LL?L|$`M<HHJH $HT$pLH辨AEHD$`LKHxLL芡L|$`MI+MgH4$L HD$H`Ht$xDl$0E1IHt$ M9IJ,HHE%H $HT$ HLD$8MHJD\$8EM9g>LT$xHL$NTIAƭL ν$H5AI9Qk饭H$H5AH:0k鄭HLAŃvH(LL6Ll$`MI}I]H4$H IHLt$ E1Ld$IHLH9IUH=!L4I,H $HT$xLL蠦D$0LIL$0I9mH|$xI|HLt$ LLLd$HD$`KIHLL98A?LG$H5`AI:ioL !$H5bH1I9H|$`HzuHLC]~H LL蠞H\$`HL9xH=RuH $HHT$xH]D$t$cHD$`H7HH0LL% H\$`H6L9H=j H $HT$pHHޤD$5DD$EHD$`HGHLL褝Ld$`MM9H=VH $HHT$hL]iHD$`L=GfnL$TfnD$\0f:"L$Pf:"D$X~T$xH<$fH:"T$pflLt$h)D$ )T$fo\$fod$ H0LL$LpX` I֩Lt$ LLLd$HD$`FHLL荜rA铩L$H5dAI:grDmL u$H5nH1I9OH=U$LH51H?/A"HD$`LEHD$xHD$`LEHD$pHD$`LEHD$hoLT$IH$H5AH8?f铨H$H54AH:frHz$H5AH:eQ#lLT$H5H1I8.H\$`HUH=Vi HT$xHHaA9EHD$`HDLPt$DL$`DD$dL$hT$l$qL|$IZYHLDl$0HD$`kDfDnt$THl$pfD:"t$PfDn|$\fD:"|$XfHnfH:"L$fElHtEH<$0)L$ D)|$foD$foT$ HtCLt$ P@ IL%*$H5I<$dLL$IHT$HHѶ$H5RAH8Td騦H$H5IH89dL$H5I8dtH LLGL|$`M!H"H5H $HT$pLHA^EHD$`LBHxLLҘ(L|$`M!I "MgH4$L+ HD$HHt$xDl$0E1IHt$ M9!M_HK,HEmH $HT$ HLD$8H-BDT$8E:M9gq"HD$xHL$JDIH(LLLl$`MI}MeH4$LG HLIE1HLM9*L[H=vAO,IEH $HT$xLLdD$LSADT$EL9cpHD$xJDILL$H5=AI;a#H8LLL|$`MH=FH $HT$xLH躝AEHD$`L@fnt$Tfn|$\f:"t$Pf:"|$XH\$xflHH<$0)|$fDoD$HHT$ HXD@ HDH LLiL|$`MfHHdH $HT$pLH؜A0EHD$`L?HxLL褕L|$`MeIuMgH4$L HD$HzHL$xDl$0E1IHL$ M9MGHK,HE?HT$ H $HLD$8gH>T$8M9g(LL$xH|$NLIAL$H5kAI:m_A鶡H$H5AH8A_镡H=$H5nH?&_L\$IpLL$I_L\$INHt$H5H8^Ht$H'HxLL7L|$`M4L-LEH $HT$xLHHD$`L=HLL臓Ld$`MnL|L<$HT$pLHLJAETHD$`L(=AVAWH$DL$`DD$dL$hT$lH$sHt$HA_ZHHXLLҒH\$`HL-LHHAtHHD$`i<H`LLWLt$`MLLL$$HT$xLHLArE$HD$`L;DQATL$hDL$`DD$dT$lH$JHL$H^_HٞAɞLѮ$H5AI:T\騞L$H5)AI83\釞H8LL\L|$`MH=MH $HT$xLHAvE(HD$`L:fnL$TfnD$\f:"L$Pf:"D$XH\$xflH H<$0)D${foT$H%L\$HXP I骝HpLLgL|$`M8Hg:HmH $HT$pLH>AEHHD$`L:HxLL LD$`MIxkMHH4$LD$ LLL$Y IHHL$ LD$E1HT$xM9fHD$`H9HLLgLd$`M I|$ Mt$H4$LLt$ IHPHL$E1HT$xI9 HD$`L94$|$XLLWDL$dDD$hL$lH$uzLd$I$AYAZHA؛H$H5AH8cY鷛H$H5AH8BY閛HLLkLl$`M HHYH $HT$pLH*AE4HD$`L8H8LLL|$`MHHH $HT$hLH輔AEHD$`L7HxLL舍-L|$`MIMwH4$L HcLD$xHD$E1LD$ Dl$0ILL9IWHL$I$} H $HT$ LLD$8HL6DL$8EM9wH|$xL\$I|HHLL行L|$`MH=|H $HT$pLHcAEmHD$`LA6HpLL/0H\$`HoH{H{H4$H|$<HD$ HE1Ld$0ML;d$HsH=NATEHhLƒ,HXLAEHLǃHLAÃEyHLuAƒEPHLLƃtg-HL)tD  H Lt#H$LH51H;蹾LQ0gH $H5H9PLD$I@Ht$H/L=$H5I8PH\$`HH=%0OHT$xHHGAEHD$`H/LVt$DL$`DD$dL$hT$l$/ L\$I_AXHH$H5(AH8 P^Ln$H5gI:OEL5S$H5I>O*L8$H5aI;OH $H5AH9OHLL\L|$`MI$I_H4$H HD$H1Dl$ MMLd$0IHHH9IUH=.L4I谼H $HT$xLL$D$8{L.|$8I9ms Ht$xL\$ItHHLLփL|$`M}L-QL!H $HT$xLH蕊HD$`Lu-HLLc L|$`M) L赻XH $HT$pLH)肻5HD$`L -HLLLd$`M LIL4$HT$hLHL躉AEHD$`L,AVDD$XAPDL$dDD$hL$lHT$xH$H$路LL$I]A\HliA\H=d$H5AH?L;MT$HHT$ HL$@OLD$8IL\$i HD$HT$ HH $HHT$0HD$ ڵD$%H|$ +t$HL$@I9L$HT$0LD$8LL$xOLIZmRH=$H5H1H?"xH~$H5AH;LULYHHT$ LD$HKHL$@LL$8HHD$"LT$HT$ HH $LHT$0LT$ D$;H|$ *t$HL$@LD$HHT$0LL$8L9AH|$xK|IL-$H5fI}=KcQL=$H5}H1I?nL-t$H55I}AJJHR$H5AH;J)AH-.$H5?H}JHLLL|$`ML-rL"H $HT$xLH薆HD$`Lv)HXLLdL|$`ML趷YHT$hLH臷:HD$`L)HLL~Lt$`MnLNL$$HT$pLHL迅AEHD$`L(ATl$XUH$DL$dDD$hL$lt$xH$8HT$HAXAYHspH8LLC~Ld$`MM9H=E舶+H $HT$xLHATEHD$`L'fn\$Tfnd$\0f:"\$Pf:"d$XH<$Hl$xfl)d$bfol$HLD$Hhh I鑊H=$H5jAH?HpLx$H5!AI;GOADHD$`L'HD$x2Ll$IEL$H5tAI:GAA܉L $H5AI9gG黉A鰉H $H5AH9;G鏉aMH5HH$H81L r$H5AI9FIMLL$H5H1I8H0H|tmAjHHZtKAHHH8t)A&HƘ$HH5H81JL$H5*AI8$FxHD$`LLLd$0Dl$ A%H@LL/{Lt$`MtMI~taMfH4$L D~\$HfL:"D)\$H~Dl$ E1I L $H5bAI9tEȇKL˗$H5lH1I8O(L$H5I:4E HD$`H^$fDnD$TH<$0fD:"D$PfDnL$\fD:"L$XfElD)L$HfDoT$H\$HhE1DP HfDot$fDo|$ Ht$DpDx HH $H5UH9uDNH ٙ$H5H9ZD3HH $HT$pLHqAɱE{HD$`LO#sHk$H5AH:CBH J$H5AH9C!IL$$H5H1I:H $H5EH:CfAօIH ٕ$H5H1H9]6LDl$0HD$`"fDnL$THt$pfD:"L$PfDnT$\fD:"T$XfLnfL:"\$fElHtKH<$0D)\$ D)T$fDod$fDol$ HtFLd$ DhD` I$L5;$H5lI>BHl$HEHD$HL$H5I;kBH=w H$Ht$xL{AٯEHD$`L_!<赯kA^H=f$H5AH?A=HE$H5AH:AL$$H5-AI;AH-$H5AH}AكH$H5AH:dA鸃GL $H5H1I9?LDl$0HD$`d fn\$Tfnd$\f:"\$Pf:"d$XH\$pflfHnfH:"l$HtEH<$0)l$ )d$Ԧfot$fo|$ HtDLd$ xp I$H=($H5H?@Hl$HELt$I L͕$H5.I8N@H;=$u1HEنH$H5{H:@鹆1鬆HLttE׆ĂH4$LH5JAH81馆IuL̊H-U$H5?H}}?A/1鑉L%[$H5;I<$[?1sHՐ$H5H:>?1V1 I}HH5ɉxIuL3{1I}H#H5|草1YIuHLg$IUHt H:MM MI9Ht H:MUMM2M7HLM9JDHpHtLH$ɈH$HpHLhfwIUIIuHt:L肈IuHt#Ld@@骇I}u A/颇L$H5I8<1E1#H=q$H5H?<1E1 Iu HtH>uCIuHtH>tLUAAH $H5H9<1阆L!uIuL臇IuLnIuHLeIu L迅@@酆Iu>t A}  LZIuHtL1ɺH{|Hu1DH{|HuH{|HuHtH{HuHtH{wHuHt9H{AA|Lҁ$H5I:;01{{H$LH5H811g||H;\$HtH;$t\Htm1|D AD D;K9HHHtHuIHtaHH|tkLL}$H5+I:~/1N|H~5H=ρ$H5xH1H?S1#|w[HHt)z1 |HD$ gL_D$ {Q+{ARHu H>$H8jjzY^HǃHt1ZE1|PAL1%1HD$Pjj H HHJ}1}8u$gD}1n}ZH*}H$H:ɿ J}1}H$H5iH:7.1}H $H51H9.1}HL$AH8p }HyMAPE1L0%11HD$Pjj H H}1~YH ~}H}H}HYZIHtjH&Hx HwXL詙HHHuIHtfHA} Lu D1M9}<}L $I9AƒE}1}1}YHtH L z}Hl$ E1~H }$Ht$XH9 Io~I~I~G`迂zDY(D^D_ DEXDEYDX1H1R .H= 1Q+XHu^Pi1ZH f.,6]WWHuH=G}$H5hH?+1r1kLE1 H sE1kH ^H=$H5H?_+IQ t'H8IL1HD$ YD$ H}$HRH5H81ƆH|$ HD$0 HD$/E1UE1EH5H=H$}$HRH5H81髊H 8$H5)H9*鍊HbHHtHpHHt YLH]A\H}PH| b HHԋ̊\ XHO骊E 鼋HֹH=w1[1[]A\H;=$u:LʾLˌHHAk 1HH)H{$H5KAH:w)7L*[]A\SH {$HPH5:1E1H9=鞌H1nHT$HAHT$;H]A\UHH0Ht HE0/H{$H]H1醍1ύATUSBD HD#[]A\UHcH'SHHHH R'H5;~$Hn(HP=$t>Ht$\$dHy&$Hcu tH5H H[]HGHW@ǀXHX遽 SHHuH;/2u+HֹH=`uSHuH~$H8Q1[H{$HHI]A\A]HsLDHH]A\A]qAH2-H6M1,E1G`f}饎USHQP=pu G`+}{`t 1w<Hߋk,Hu{`ku5H},HukqZ[]H鼎HU鰎HѴ餎H阎HwH;5|$HmH;5z$H}lH;5{$HoXH;5|$H<H=kHD:H.H"HqH HLw$O H5ǻ1I81܍HЍHwčH鸍H鬍Hh頍H锍H鈍H|HapG`n{餍JDIWAJ;H C`?{Da7HLH1 HHٍH<$IL9IHt$HJ4L$aHt$HIu|H< C`zDe鸍qC`z)EaE1鏍C`E1yzDfqE1Dg_HDsDJtI麌HGHP(Hr H:鸘 Hw0H1H=Vӫ ATE1UHQHPwt)HmH}H-z$HEHއHILZ]A\Ã9]S S }~Hm5I9R oS T 1FLڍH|$c>H|$u1>HoH錍11H-Pt$AH}s 1Ll$@1LAąudHt H*H.LLHSHCH|$ L~Ht$PH|$gLl$Ll$ Lm鷏H|$ HH={$tzL%z$Ht/f+H *H!I*HHK^CH|$ Lʚ;JH|$(Lʚ;HE12HH](ArH=J'u >'Ht L-L )H5H3LCLK\HHt@Bʚ;E1HE髎Lv$H5AI:^!錎A_pHH9 Hy$H=w$H5AH?%!SHD$L+eH\$MHT$Ht$HH@ H|$L苎IHH$ LH$fH1WLE1ՏLHWLHtCLq$H5MI;] 1sLHD$HD$\LE1tܔLE1d鹕HHD$RHD$HHֹH=aՙ1[Z1[]A\A]H[1]A\A]A^HLLHLKHu11PLHu$HZH=1.@ H=1[/QzKHuH{t1銜1钜邜Hc1L>HtHBH1[%KHuH{t11Hw[HH=5]1A\? L[1]A\H/p$H5H;1E0JH1&JHu5L IHt*H=o$H5^H?BLz1:5dtLLP鋠H\r$鵡HPr$驡Hto$H5aH:1YDIHt1>E1ӡ1[]A\HH$LH$.H1IHu[1]A\H,[L]HH=1A\1O|IHuH{t1錤1锤鄤 L`Z1[A\Lq$åH=no$H5,H?1飦1NH I,$cQ KR H8E1HT$LC\HQ H=.H=o$H5H?1<'ߧ1HH=.+^V1[H&LH5H=+ ݹH=*蝞Llr$I@1]HHǨ1ϨZ1[]HHD$HD$颩E1BHW0Hw1H=A[[]A\A]d< LZ1[]A\A]LLL m$H5I9Z1黬馬tGHu99`GHu%1H-l$H5H} 1n1g1闬1鐬Hrl$H5_H;1-FHt1HCHTHzuHq$C(H1颬LZ1[]A\A]PHl$H5hH8b1ZAYLA\1H=A]G H=b1 ; H o$1H=(蠜71[1[HH=.T1XH;-Kp$KH9]uHEHh 7HL:k$H5I81LHH5`H=_1H=`lLk$H5tI8?1CH=j$H5H?"1&1HLH1[/EHpHHH=HdدAAUL-8ATIUHHHt H;=Ml$t%1ILD$LHtHLRuE1HH<$|HHtL1A$0IHu H|HT$fHnHfH:"@HL]A\A]AWAVAUIATUSHQHt H;=o$t)HKIH0HFj$H5H:HH=^PQuE1dHxHHtAJ|{IHt!JDIM9u1LA0IHu HHhHCHID$ZL[]A\A]A^A_HՅ߮[]A\11[]A\1[]A\1[]A\HֹH=~莙A1EyHH|$1H|$tH5 HӢ1H7HHt2LHHHH[]A\A]A^HL1[H]A\A]A^IXH[]nHgg$H8t cHy1gLHGLWPH5THG0H=sk$H?1ZþzH=C1#H[HH1E1鸳H騳頳1jLch$LI8b 1QH´H麴Hk0$Hk8hAHuRHk$L8H f$H1LH11qH5f$H?L1H6"1M1FPH|f$H5H81Z1|D6IHt/LHQ,LIMtLHM钶LE1釶H9FĶHTi$H9t H9tHh$H151ҹLH=tٖǷLt陷H=Q1ҹHH=蝖E1{L5LE1*cH Ff$HPH5S1E1H9?L)PHD$H?HM,$RAT1UHHHSHHtHAH0HuH~ HHu0APAL-$HT$R1jjLH HHu16HL'tH[Au>?HtE1DLHNH[]A\HIEIL9u}L锷Ht$gHt$HHtfH@HgHt3HuKHD$HD$MH=H3GHDH'%j{13LE1H n1H=Xd$H5H?KL]c$H5I80H i$H5[H9J4HJH0H?1H= c$H5H?u=HLc ,HgHHtHs8CH访xHsHLlgH H=vE1cE1ٺH :h$H5E1H9黺H=E1AcAG`MA`uA_AgAXEAAEq#HuAAAAG`5#HDEAG`A7EA'"HEAG`AEA"HEAG`AAG`&AG`EAky"HAAG`AE"HAAG`AL.IWIcA`H4Dv^EAAG`KA`sEAA#AG`KA`fEAwALx?IOA`J4Dv^A1!Hu#AAAG`AAG`sAG`DAG`AG`A= HEAG`AAG`AG`EAYEAIEA9EAG`A!LL3IwHcA`H$H5'H81+G`BGDADFD1EAG`B1wAG`BA`9AbAMAG`WBA3A&{1HAG`BAAG`BHgAG`AAG`AWAHAAF`AAAvI~MHD@DH VDAv H=?$1L$袆_AXHH;HtAAF`gAXAvI~HtfDH D@ARDAv H=A$1L$*A[]HHHAAF`AAAF`k@A~`AnBIHAAF`AF`"@A~`u AnA\G`?]1iA2A#AAF` A-1H:$H5H8I1eG`v?kDH1G`L?"AG`:?A`:Ag{1AG` ?BHT$HLD$HHH4HD$aLD$Ht^HAG`>AAAHAG`>AHAG`d>AH9$H<$H5H:H$HT$LLL$HHH4HL$菷LL$HI~AG`=A`,AL<AG`=AAAG`=AAAG`q=DC1G`U=kLAG`;=AnE1`G`=HH2C`)E11H7$H5H;1w{HD_DCHEXsHD^kHD]KHDYDKHEYxE1DKHEYcSHDZWH6$H5yH8SH1DZ3DSHEZ&LH׉$D$$LHSHhL1[H5Ӄ]A\A]A^A_=KHH,$D$H5HG8LtLAoF(1 KDd$:HhLL1[H5-]A\A]A^A_JLLH$H5L1JnH5L1JHhLH5 1[]A\A]A^A_zJH߉ $D$$LD$D$$H5BL1L<$ASINLAPIvHIZE1YLIT$HuL I~8IHINIvHHD$HPLAIAUwZYLT$L@E1LLLH' I~8HHINIvHHD$Ht5APALIAUAYAZHT$OH׿1@ASILAAU[]HT$HLLH[L]H?A\A]A^A_ APAILAUAYAZLT$PH1$H5hH81ZE1LE1:}H=V2$HP1H5H?ٌ1H S1$H5HT$H9HD$sZ1[]A\A]H4$H9WpHv1ZH11HL莾H1脾~Z1A\A]H5$HL0$H5HD$I8 HD$UH=2$H5H?18PHd0$H5~H8Z1E1E1HtHH=#_F1LD$LH/$Hp1^t=HD$Ht H /$H9Ht+H=/$HZ Ht$HH HE1LULE1JL=L0LE1QHHH=/$INL1H5 ~H?譊HHD$޼HD$HTPHHTh;PA1LD$APL$jjvH HHHl$E1PH .$Ht$HH9% I4Ht$`裍ALE1P1ҹLH=_H l.$HH51H9ЉH1[]A\H;Ht$ iHy3APE1L$11HD$Pjj蚻H H 1) H HHE Ht HH]E0t< t7H HE Hu11ҹHH|$|,H|$tޅtHH 1 H-$HuH8轛 o Lt$LLt 蔌9 Ȕ- ATUWHEHu Ht#hHHHI论ItMyH,$H5pXH8Y1]A\GL1MjHHtHpHx u H\1HZ]A\ùCh UHH$SHHt$ tL[|$ HYHHu;tH+$H8l HuHH[]H1[]H,$H5{AH:qH8D[]A\A]A^A_HHHUH5P{H-,$1AH}:E1LmH|$cIt$LvMx[I|$HD$H5JHP4HzH9vHfD9"uHH)H/HH)HWALT$HHT$R1jjЮH HrHuwAUATUSQLg MtI$UHHH賰IHtALkP1H;kH}-IuI}IHu LE1莮IDHI$Lc ZL[]A\A]IXHPAL$1HD$PjjH HH?11pHHuHXH#$HLgH"C$H9fZ H5'$H>OZ SH1H5HHT$ A1Et9H|$Ht$CÅtH$H8Y 1 Hc|$H[1HH1H|$,xH|$H1H1H1H|$5A1Ex H|$HH1H|$xH|$Hl1HUH1H5-H HT$ t$Hl$|$H%stH$H8Y 1H|$H15xH|$H ]H $HPH5^1E1H9^tHLE1聦HT"E1H[;рIH j$HP1H5H9s1H)$fo$X11[LxH [1]A\Hu*HuLH=I#1HyM*M\$HaH=$H54E1H?!H[]A\A]A^A_ HH) HH Ht$H<$ H<$Ht$1L2$H5jI:1L$HP1H5hjI;r1LG0LGHtLOH@tLO0A9oLOHHx$ HU!HL!H!H!L)4!HH|$2H|$tH5!HQ1HH|$H|$"10#H$H #B<"H_H"H|$H|$6#1#Hb$H#C<{#L_H0#A;4$H|$|H|$#11$C<#L_H#`Hu&H$LH=Fu*H 1[]A\A]A^HL$ L$ Y$$Hu&H$LH=:Fu*H 1[]A\A]A^HL$ L$ $$%H|$H|$%1 &HoH.%H]F&&H&H`H9v H9*uH)HH&H&H)HI&t:M A1~Ճ'A0A0'H'1x'HLDEZfA^'fEf0P'HuH&L@H'L@H'L S$HLH:I1H$H5!xH:)1'H$H5lH8 1'1'L6HT$Ht$ H|$(H8[]A\A]A^A_T H=Ԅ H)'H(E1(H(莣H'Hb(H]2 H|$H谠H+*HF**HT$HAHT$*H]A\HT$HAHT$*HT$HAHT$*HT$HAHT$*LGhMtPHGhL1Z1HC*UHpHEH]H@SHHHt HC谟H{Ht HC蚟WHC 1C([1HtHHWHDAVHAUATIUSMA$ Hc HMd$Mt{M,$1L9}mI|HuWHMl$E1MtMMu1L9}?I|{IHu.Hu"uIt$~ uMd$aIE1[L]A\A]A^HGHtHHuHGHHHDH 19~'L HMAL9}HHHHHHcHx,LH L MBL9}HI HHH$H9GuH9FtH$HB``hH$H9uH9tH$HAWE1AVIHAUIHATUHS1HLd$LD$L裔LI<LH)HtIL;|$tHHHĈL[]A\A]A^A_HH1HWJu1ɋGDHrAHw)DGGDJE)DzAD‰GÍBwH 8$H9OuH9Nt H$HLFE1L9GuHvH9w@DσDE9u HV$HH$HHGH@HHHHHt1AUIATIUHXHHuLHL]A\A]eHՅt]A\A]ATIUHSHHHuI|$1HtHH[]A\HӅt[]A\HC$G HDDwH6HtOfDHH1[SHHHLJ t H?Ht͏WHC1C@C0[PH#H8LRII: IAǂ# IAǂ H$AǂHZPHM#H8HzHHφ H#HZH#H8HBHHuH#H1u:HW:u1HBHHH; a#tH; #tH; #@@!øHg#G H1H9HGH@ UHSHQ_ tCtH{HvHcZ1[]SHH_ tCt Hf#H H#H[HWHHuHHGHHuHH1HuHHtHLGHwMt PLd1Z1UHHPHEH]H@H;5h#t HtH1LGHHwHMt PL1Z1ËGPHW@ȉGPHH<UHSRGh_PȉGhHHk +\xHcH~ HHX[]LGMtPHGL訆1Z1LGMtPHGL臆1Z1LGMtPHGLf1Z1LGMtPHGLE1Z1PH#H8HzHǠ _HH#HZLGMtPHGL1Z1LG(MtPHG(L؅1Z1LG(MtPHG(L跅1Z1SHHHt HC薅H{Ht HC者H{ Ht HC j1[SHGHHt HCEHHtHǃ)1[Ã=^#u H-#HP{H#HZadUH蘑HHt HE„H}Ht HE謄H]#UHZHHt HE脄H#H8HrHc`1OO`1H.]H]ʨUHHHt HE+H}Ht HEH#H8HrHc3OO3Hh1]H][UH蒐HHt HE較H]3LO$19~-HW8LW@L L MMtMMxMMHLHcAFuE1D9~J J IHcHxH H HAUAATUHSI1Q萉D9}LIPXH[]A\A]lHt PH1Z1PH}H#HZPHg1ZP 1ZHGHPP1HtHJH@H; `#@@!H#HcxHc=#@@1H=#@nHGHt1xl@VHG#HHGHtHG(H#fD$fL$(d$fT$f\$fXd$)d$L$D$fL$fT$f\$(L$fD$D$T$fYT$f:fYf)T$L$D$HGyxH#H=9#11H8HtHHIAEuIxSHH֏1x H7#S(H[H(鶏Ho#H8HwHJH hHwHhHC#SH8HZHhHt'LGHOIHq0pLhp[HWHHHHtH1H91H;=#1H;=#1H;=S#USHQHt?Hu 1H5_ YtH5hHXuoH5;HXuTH5)HXu9H51HXuH5HXuZ[]AVHpCH5X AUfHnfHnL-oATfInL%|L 2UL=H-B1fI:"H=1 fHnHw (H r Lu1fInHLrfInH$L%^3%fH:"HDŽ$fH:"HLHDŽ$fH:"fI:") $fI:")T$$$$$/YL52%(HLYu%(HH=1%XHX0L$(LLXu%(LH=\1%XHDH= H5h3 (,$(fHnL # L0LfH:"fInL1%l$X$(t$Hm1%fI:"LT$PH$I0H$LT$ $t$hl$(t$8 XA1EHt$P(H=0%WA1EHt$ (H=i0%WA1E(HH=0%W1uL-0%(HLWuH(I}0nWHtFL$(LLIW1u&L(H=0%-WHHEH]A\A]A^P1  Z (h/%Hq/%HGHG)K/%HT/%1HAWIAVIAUATUSQHo Lg(H'MI)HHHE,A tHJ HHs,lHHu#I~ HtWAF@AN 4J< L%UA t D DHDfHnfH:"1AF Z[]A\A]A^A_AWAVAUIATUHSHH HƄ$ L|$LVuL LJIHu1H H%LA| HuA<$#tIE11ALLJ uL$$MtLLH54THHH50W1LH5+ZTHHtrH5#Wub1LH51THHtI LHy,1HH;u4H5@H9EfHnfH:"E L8,H H[]A\A]A^A_LB'5@'1HB'9t3HHt#H?HzH%H9sDH@MH0LHTHDH#H8HzPHm#HZL_E1IM9|PKDH5#Hx蝼uIM9|߸1ZHÉ!$_$R3/ x  W v  bwЃ <X-=CLIcLWӦ" ϨU ӧ:'v5zXΤܧZ!>}ħJȦ/c*Υġ-`$=IBH +Hc4HW^=,¢ǣ<R)ХE#-!WBH=LcIA ֥Tzɣp-X ALMc MA6͡) NWy.D - @L %McMAxe,ТƞW- N@HHc HPeÃ1W@H=HcHmD:`>Árvi-W?H5QHcHǞnÁiw{_vj-aW?LMcMAvMCiGÍ wj-W>LMc MAϝvŝɚ@DA wi-g W >HFHc HyPFlJÁw e -f 6=LIcLPe1WMWÁo w{e vj-g W<H=oLcIA5 ٞ(Ϛ}Í wi- W_<H5HcH6\RÁx e vs-f g;H5Hc 1ؗÍ wi- Wq9H=HcHʜHndD0A wj-W8LMcMAJ!ț=!|8O!-P!9H=HLcIAW-pߚ4J!Ț=җn],SB=7|h-j 7L McMAQWՙz7Օ|˕ÁIwz?vi-AW56H5OHcHe [2(_֓DpA wi-W5HHc HܔW.A5:-5Ávt-4L dMcMAQ(ϗD"WÁvt-93H=DLcIAɗGmcW ÁOwzEvi-GW3H5HcHC6ݑD0A wi-W k3HAHc HĖBh^ ÁY{?vs-@1LIcLq8ܔ+Ґ WÁYw{Ovj-QWb2H=LcIA8^TÍP wi-W1H5nHcH= 0׏-p wfL 'McMAύ+zQW Á22- 2=H=LcIA 9~\ʏ^ӑz(ǎ,0DAwk-w'wXHHcH~EÒ8ߍÁ:0 0-!03.L oMcMATҒpf=3j0.WY1.w131.1.ˌ1u.͎,X.AˎQ>.N,.N.UM;-w=/4-3*8-4-2N-N-ڌNt-w1 N^-W]NJ-N--&N-JiN,wN,'6pO,Š,N, O,#FQ,EQr,LS@SvK-AS  +H Hc4H7~]|kQ+mQ+iQ+_+^+X+wRVp+w-SX+QHX;+z^+^ +: _*v_*҈ _*>Us*wdLc*wb|*g_*XoK*~v.*'*KÁ5/vK-1)H=LcIAe\Á)vi-!W)LCIcLdي!!)w9X )0(((?L(wɆF(x((WDYA wn-d(L>IcL2XNÁϩvs-Щ)u&LIcLj1Չ$˅W-Ш9weH Hc4HŠ@f\WÁvj-W&H=mLcIA7ۈ*фDUA wi-QWh&LIcL?e[ %vi-W%H Hc4H3 ׇ&̓Ws%wEs]%xI%Bk5%%%Y%$ÁvS-τ$LIcLNԄ*Á } - =H5HcwsrDA wi-W|LjIcLxtSxtywvosqsÍ0 wi-WH=HcHXx/tw%tvKvr)qrÁw{vj-W}LMcMAwsSwsyvuorprÍ w|-1W LYMc MA/s~wEwsvsu8uqpqÁlOO-QWbL McMAvvv7vueuttJrv`v7ru-ruStp1oDA wi-QWHHc Huqhuqtspn2pÁYw{Ovj-QWH=)LcIAgu>qt4q tZsp8noÍ` wi-WH5HcHtphtpsrom2oÁ=1p-q=wkL nMcMAlqtRt)psprErn#mnÁakOk-PkH HcHpooss~o%stoKrqAnxlWmÁn$#-$mL McMAqJnoopksrnZrnqpvmr$mÍ wj-ajWH=LcIA^r5nq+nqQpl/klÁav|-WL9Mc MAmqqmCqmipo_ljDA-nW LIcLnnamnnfnUn4nl*qploplonki9kÁ=vf-0wXHwHcHrpIlo?loen kCiWÍ,-aH5HcHcHmi+mziQlkGh~fgk  +v!-W HHc H፷ wj-W H=LcIAlh^lhkjzge(gWk w1Yhfdk0h!f* 0ej wf jj)gw\ YwPf Cg=gg=gMJL IBHHHtHHHtHHtHH#IHHLH8ATfHnUfH:"QH#H8LMMaAIiIQMtLC0MtL60Ht ZH]A\%0X]A\HHWHHDPPHH1ZAWE1AVIAUATUHHSQU HUHHELhI!N$MI9\$t MM$$It$LU(tHMI4$MtI7J4LHMMt$UHH}HxH*IIL H*XLMMxI*MAIM I*X^ \Zf/v H9 E1ZL[]A\A]A^A_AUIATIUSHWH=&&HŃHt2HLLEA1EyH=Z&Hq&Z[]A\A]ÅtH=&̸H&UHHt+HHlHHtHH=&H)&]%&]AVIAUIATE1USHL9cv-HCJ,HtHUHuLHAօu HmI1[]A\A]A^Éq HH5HHH ڢ#1~#H5Q#IfH:"3#H=A)$ HHH5##H=#1~#IfH:"#H )$ HATUHQIHt!HH5DHt LE12LZ]A\ATHIUSHHŃHt"HL@A1Ey H[]A\E111 AUATUHS1RH9]v6HEL$H4HtL.H LHUHJ"HEHX[]A\A] HAWAVAUATIUS1H8HHI<,tHE1HHZ#E1E1LK<(IMtIIL|$1LL, HH9vA[HsH=L&HcHtH#H3H95-&t INHHHMJ<(H-ϟ#LH&E1HEL1‡ H8D[]A\A]A^A_H(IWHL$Ht$)D$H(I1LI1ALIpI1H]ALIPI1ALAp1|$1|$AVAUATUH8HK#D` ELl$IH1LɅ MuHu*eH=&Li H&HuA=H=&HA H&HuH=&AHx&L1^ AH8D]A\A]A^Hb&Hc&HAVIIɾAU1ATIUH͉SHM2HL$IL{LLﾀH921{HcLLH蒎H[]A\A]A^AVL5 2AUATAUSHHĀH#H8HjIDLL1${H5#B&HHN(IHN ILHHIuH[]A\A]A^Hy#H51H8HJ@,0HP#H51H8HJ)(H'#H5l1H8HJ.hH#H5V1H8HJ0&WUHSHHHdH]AWH)H AVAUATUHSHHq$H9uE1H9 J$A E1H9AE@ H1H5>E1E11HE1H$H$L&A?HH$HH$^&D9IHtoIE`?tH$@HH@MpI9vADEt0y$D1HHDHD)HH@AI0tH HH=wn=E1E1Ll$HD$MHH5/HD$D|$$EMLܸSMt|LܸHܸP1APILD$HMH|$8L$@ELL$HIk0HHT$Z?1Y|$0HHH|$(IIIH5.IHL$HH!gHH H\$Ld$0ED|$$Lt$@Ll$(H&H5.H襊H&H5.HH)茊He&H5.HvHH5.HdHA1H.L-wHLHH3H HT$0H5.HHT$(H5.HIDᾀLA@IH.1vDLHHL%.HT$H5.HI詉HT$H5.HI蒉H$H5HI|LHITlHH={.Hc&H5{.H=Hcn&H5{.H'H  H5VHHc;&H5Z.HHH Hc&H5[.HHH ̈LHH轈HD[]A\A]A^A_UHyHSfHnHHfH:"#)$O&S K ( $ t@HsHt Hs0HsHH{HpHxHE1HH]MH[]SHQ#H;t H3 H;H1#H[H͕#H@H#H@H#H@H#HH#H@(PIx HAKAA@I@I@ZATIUHSHH|$ Ht$HH!HL$Hƒ9u;"tHH9wA$1H[]A\PFZHc<H#@H#@ H#AHcPHH|PE1PDUHJAEuHH#t;Ht1H5zH¸tH5-H}]ËG(1G(Hݗ#H8HHƗ#H@ H#H@(HH#H@gHXHXHHHHHHHHHHHHSHHHT$Ht$OHcT$~D$fH:"H[HGHW@GXHX P=&u11AUIATUSHHXHLd$(z L1x{  HHtL HEHu H11LL| HtHHuH+HH@HuHjHX[]A\A]SH| AHtHE1D[H1H|$ BAEuD$ y H1iPcZH#H@t HH1HЕ#H8HJHQHtZHtUH肯H]iUHSHQH EDtH5s%DHDI&LLDg|$t"H(D[H5Q']A\A]A^A_>H([]A\A]A^A_AWAVAUAATUSHHt H5H[D$dL=$L%L5&H5$H#H#H9CgHߺLDHHUhHHJLDuHuhDVLDYH~DH5%D$ 9|$ HcD|H5DHupHLFADH5VDHH[HtkL$H5#HD[]A\A]A^A_LD(LDqJLD\pH[]A\A]A^A_AWAVAUAATUHSQHu1HHu0Hu'HƎ#L%H@HuHHuHkLeL=#dL5"MI9uLD LDI$D9H5"DI9u"IT$0tH5"D^L1D#Md$Mt<H5D3VH5"DE1L%ZL[]A\A]A^A_Ë[&uJUSRF&HƅtH1Ht &X[]AUATUSHcRIHiH&;D(tCs{Hu{t/Hs 1DzDmDNDms1DDmX[]A\A]AVIAUATUHSH@?/u E1ILl$ DŽ$ @L AHt|LyHHnIH|HH9v IE1FHE1IHt2H HLJ HHW/HBH@D[]A\A]A^1UISR1҉ljKt9 X[]H͋#H8HJtǁtPHT#HZH#H8HJtǁtPH#HZHc#H8HJtVHctYݰaHt1ZUH6!HHt HEH]9SHN t 1H{[SH5 tHC[QHu H=6H u1&t&ZAWAVAUIHATUHSHHt#L0HH#t H3HH;E11AdI4L>HHu"LE1 Ls螊LDd$L<H,#L"MtALHD$t$LLIHHt$>|$LCt LA|$Lu.D$DL$EoHRuAHsHTIHH L賉dLHÀ| tHt?LcAM9r6HE1LCL#H5I;3HAdI~HL[]A\A]A^A_AWAVAUATUSQH#H8H#H9+uL :#H5=E1I92IHQ#IIH:u H H H='u/n H 'IHuL#H5"I8_2H+肿H='HLVuLLLCI*L0tL%#LLLA$IHH=o'HMt9LVLhLHHt HLLLI5ZL[]A\A]A^A_PHވ#AQIHH5APIHH81ݹ HHHu#IHAPIHH5H81讹 HHJ#IHIHH5H81酹 HIIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$Hb#HL$ E1LH$H8HT$LHL$HL$D$D$ 0HHHH=Z#11nH#AT1H5?UASH8H1H- x#HtHHE1HHt&D[]A\H#AT1H5UASH8H1H x#HtHHE1HHtD[]A\PjZHH=nH=H=H=tH=5hHG(HxHtVH#HHG(Hx Ht9Hr#HQHHx#H5H:.1*ItHX#H5H8.1 H#HZQHH+#H5H:.1*ItH #H5H8t.1 HA#HZQH$A1Eu H#HZSHHyH#H5wH8.1H|#WCH[SHHDyHX#H59H8-1H>#C H[HW01HtiHG HO(H9H8t#PH5dlHG0H=#H?-1ZLGHwHJDIHW0LGMyH~LHG?LOHQLWIH5a#L PL;#L;#„tuH~#H5H8-IqH>@H;5_#AD @ZHuPHE#H5H8,HZHGATE1SQH0u5Hh HC0HuH#H5AH8,HC DZ[A\PH؁#H5H8Y,1ZATUQHH?HH-#AtHEH$HAY DZ]A\HGHHuPH #H5H9+1ZHHuHF#HH~u Ht"HztPH~#H5H8+1ZH#HH~u Ht"HztPH}#H5H8o+1ZH}#HH~u Ht"HztPH}#H5 H86+1ZH#HËG(uHWBu ǃ lPH |#H5H9*1ZËG(uHWBu ǃ 6PH V|#H5H9*1ZPH}#H5H8*1ZPH}#H5H8*1ZATHuH |#H5[AH9d*UH;5ˀ#t.HF@uH|#H5AH:2*#H1LG0G8E1Hw0MtLM DA\ATHuH a|#H5AH9)QH;5M#t.HF@uH/|#H5AH:)H1LG(E1Hw(MtLDA\ATLgMuH{#H5|H8l)I$LA\SH5Hu A1EtHC[SH5Hu A1EtHC([SH5H`u A1EtHC [UHH5SHQ;u AEtHk1Z[]UHH5#SHQu AEtHk(1Z[]UHH59SHQt AEtHk 1Z[]USQHuHy#H5DH8d(#HH5]Ht AEtHk1Z[]ATA_pIUHSHA_pHH H9v6L~#H5^I8'HHIIN Hiʚ;1Ii\$IMI)HI9}L%~#H5]LI;'H][]A\AWAVAUATUSHH=&DD$t|$uu|$L=ߨ&IH5MI=Mt(LLHc#H5'MtLLHcH5LH5He|#LsMt7H5L-H5kz~{ t H5_c{tH5DH{tH5)-;tH5H5LH8IHtLk E1HtLhMI9 ˆT$&IL$XIt$`WI|$hAD$XHL$ Ht$(H|$0ID$hHH=:X$u HD$HH;{#HL$0HT$(LHt$ H|$0uL{#ILD$0H\$0Lt$(HLH|$ HtyHLH|$+H|$MtLHtHLL$Ht$8H=HW$HLL$8 HHu Lu H;z#uLxLL#LA):|$H{#ATIH8@AL1҉Ǿ~AUIATIPHa{#H8ALLǾNPH5mH=HPu#xtSATIUQH=E&0;HHtLHHH=&71HtHEZ]A\1AWAVAUATUSAPHt#xuAH51jIH4H5E1"L=H L-AT$D9~XIcHκHk ALHs LsLH A띺LY[]A\A]A^A_X[]A\A]A^A_AWH1H5+AVAUATUHSHHy#H;HuH3H []A\A]A^A_EUH;H5 1PDmE1IItBDII H;LH51H;1H51|HHuH H= RH;Nd-1LH5Q1A<  HHuH H=f MH IH=' L5/ EH A)AM9sAULH1I0M9rH3 JMM)I~Ml$H= sL= H;M9sAUL1IH3 H;H;HH[]A\A]A^A_H;1E1H5GL=' {C 4H;DL1L$b@|$@tH H= H3 IIuH;1E1H5L= L5 BL%H;1D)LL$T$tH L?H3 IIuH H=PH=&ɶH=&H=Δ&H=&H&H&迷H=&YH=l&ZLHop#xtYRH5&1@3Z H=|&gZ H5&Z VH5&H={&&H&YPHt#HZATUQHo#L%t#xt%H5&s#H-&H/ 1H I$LHI$Z]A\Ht5UHHH?P H=&芵H1H=&]飶SHAExH{0PHC H{0s1[AUIATUHSQL%Vs#I$8I|$HXH[HtML9tH[LHtHEHI|$MtLzH{ I|$1Z[]A\A]AUAATIUHSHQHP脴Hcd A;`tHE1HLa`HYhdH}PyH?ZD[]A\A]ATIUHSHUr#H8Hu MHtHxH{([LH]A\PHm#ATL%r#xt+H=&ϳHБ&H=ё&H&I $LHI $A\AVAUATUSH0HH-n#uH0H[]A\A]A^آ Ll$I1LL5E/V H}fH}]H}TLi LHEi LHEi 1LHEHV H}t H}tHuH5H=Z9RH0[]A\A]A^H q#H8HXHJHq@鮨x+USHPM{HHZHc[]]HNo#HUHHHEq#H]PH5H|p#H8`,ATE1UHSqHWHH9B0uHHIu81H|HtHH uHMH@Mt [L]A\[]A\ATE1UHSH_HWHH9B0uSHHIeu:H-HMH@Mt#[L]A\nH| HtHs[]A\H{o#H8HuPH5gH=p醲RHGH1HHH0LH9tH5H=pYHrHXXHv@ϦPH5H=px0PH5H=<~PH5H=~AUIATUHSHQLAu.E1߃Av*NЃ v"_@E1AA! 9uHE1L`IH9tH3ZD[]A\A]HtgATUHSH0?tNLd$1LR Hj#H;H]f 1LHHS HuH5zH=5*H0[]A\HtiATUHSH0?tPLd$1LgR Hj#H{ 藩He 1LHHC NS HuH5 H=5H0[]A\HthAUATUH1SH8Ld$LQ L-i#I}(+He 1LHIE(R HuH5H=?5OH8[]A\A]AVIAUATIUHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$=H&tH>n#0&L(LH5ljMt(L/LHcH5H$HL$ LLHT$HT$HL$D$D$ 0L [LSA111xATIUSH sHim#LH;tH51)H51I$H;1H5H;Il$H;1H5HHHtHUH;H51H H=~&H;~HT$Ht$H|$SH31LqH;NHt$HT$H|$H3 &H;H []A\AW1MAVIH5 AUIHDATISH3l#H;MtH;LH51H;MtH;LH51H H=.H;MtH;LH51H3 `H;XL'rtH;LH51XH;0EID$M@tMt$H;LLH3 H;H5H=xH=%z H=p#. H=t#" AVAUATUSH Hi#HD$H9u HHHFIHLt$ uHe#H5H:81OHT$Ht$LHwtHt$HT$LHH6H|$A6H|$,Ey1H []A\A]A^HHT$ Hy 1H|$1Ht |AHHH5u%HT$GHD$HtHPu H1HAVAUE1ATUSHH9uAML}HMtLcHu I>HErLuMu HE1=\Iu H}IH=pE1t%HA ,J|HWAąu IM9|E1GH[D]A\A]A^AUATUSQHFuLc#H5I8i1~H_HIH[wuH=c#H5iH?91NLk1L9}5HUHtHNtL\xt He#HHHFe#H1Z[]A\A]H(D$HBHD$HWuH ~b#H5H91HWHLD$HwE1KTH(HIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ LD$L1HT$A1H$D$D$ 0HD$SHATIIIHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ LD$LE1HT$H$LL1D$D$ 0HD$ SHA\LG HGIH5HOH=MHPHDH={1 HG HH5ĮH=HDHPH=1ݖ Hw1H=˖ HAUHIHATH=FUHN1A螖 HtHHǺLSHAD]A\A]HOHH9H d#HAH=HP1H ATIUSHHoHd#HEH9tHHLH=1[]A\ HHT$H5^$HHECy HE1!}It$LD$HHHNMt IHu!LFHL1H=IP蝕 IH~HL1HWH=| IHH|$HtHL[]A\HW HGHt"HRH5HtHpH=n1' H5HtHpH=1 HO HW1HwH= Hw1H= ݔ SHHHSH=[H1麔 Hw1H=騔 Hw1H=閔 UHHH=HE ]HPhL@p1m wH1H=Y Hw0H1H= D Hw0H1H=/ SHHRHSHHzuHRH=1[ H=1[ HHHpHtHVHDL@H!1IH鹓 H5H5H5H5*DG(HEuAHJhHrpHtHAtH=1] DH=1L HOHHuH=12 HAH=HP1 HWIH5HuH5 HwHH=1 HIIHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H5]#HT$ LD$LHT$H$LH6D$D$ 0HD$bHHLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ H$D$ HT$LD$H pD$ 0HD$ѭHSH=^H\$HD$H?vH$HHw 1H@H]H)H9sH)HH^#HL$H5H81EH1[AUIATSHy[5IHtPE1fH^#H{虠Lc Mt LHyE1 I9tM$$H{蚡MuH<^#LH5H81踵L[A\A]ATUSH?HuHtnH{UHt`L%F^#1I$8H;BtHpI$05HHC HtH;H{HtHt[HI$0]A\[]A\UHHSH5HӺHHq^#LD$IH$1NA1EtH$Ht$HH[]H ^#H9Ot!PH"Z#HH5H81覴Z1ATSQH [#H9FtLY#H5I8w~~(Iu H=\#H1H5H?NUHH9tH \#H5H9'.HVHHOH1ID$AD$(Z[A\H\#HH8;UHH1SHQvA1EtHH ]#HZ[]UHH1SHAPEtHHctY[]܁2HtZ1[]QHGH;X#t!H X#HP1H5 H9B Hu1ZAWACBAVAxV4AULo ATUHSQDgA$+HcHAr'I}I AUL1H1IIHIE Z[]L1A\A]H|A^A_AVAUATUQH-"{&EgHuf}L-z&|H:IDeMtHV#A;BMk H z&LIIL$ ~WLfnf8=fA~D$LhhHWMtWIutJA} yCHwz&LHPHtLh#IEH=Xz&1LNy LMl$ fEf} ftf} LuIHZL% z&HHELAT$HtLh^DEH=Ez&AMcMk IL6z&IHt3HHL1H=y&H袑yLH=y&E1z&ZL]A\A]A^AWAVIAUATAUSHQ-Ht>DIxHHu4cHHtH=by&DH/yHALHmHtHLhH)y&HHH=Xy&Uy&IHtHHLHLhȐAątH="y&L9y&!Hx&E1H;x&Hx&vHx&ZD[]A\A]A^A_AUIATUHSHQH?SIHH=vx&HtFWL9t H1t1LLyH5H=H=-x&H51LLuH= x&y$LH;E1S ZL[]A\A]AWAVL5w&AUIATILUHHtEI<$LHAT$IHthHtcH=w&胙1H襲H=w&蝚:H5V#L輖 gHLLADI{1L葖 ]LA\A]A^A_AVL5v&AUIATILUHQTHtEI<$LHAT$IHtXHtSH=v&Ҙ1HH=v&*H5U#L LHL1LI ZL]A\A]A^AUIATUHSHAPAH>EtHHSI HHSIMtEH=Qv&7H1LIH=/v&yFLH;E1S 3ZL[]A\A]AWL=u&AVALAUIATIUHSAQ!Ht9H}EtHELAXL[]A\A]A^A_LHEYI[]A\A]A^A_H5T#L 菢LLHDI袸L1踔 ZL[]A\A]A^A_HH1?HHH,AUL-t&ATIUHLZHtHEH}L]A\A]H54T#LD LH1NL1H% H]A\A]AVL5t&AUIATIUHLAPHtHEH}LLY]A\A]A^H5S#Lϓ LLHL1H诓 ZH]A\A]A^HQ#H5[L,SHH=T#IHtHx@1IL.L[SHHHt1HLHtHHLHH u[SH4IHtHHHXզL[HHO#H9GuHPHN#H5جH:`1ZSHH=P#,IHtHHHXuL[HQ#ATUHSH8HHJ3tȉ3HLh1LH=wR#¥IHt'HEIl$HtHI\$LAD$ L[]A\SHH=O#{IHtHHHXĥL[H@SHu\H@Hu+H@[ATUHHSnIHuHHzLHYIL[]A\UHSQH课HuHH}H藾HtH1Z[]SH_HHuHHkHtH1HuH[H\P#HAH׫H8H5IL#1H6gUSHQH=R#CIHt%1HHx HI1HI[LAkvZL[]22V1Ht HxY[1Z2ATL%UHHHu"1LD$LH5zu5HL3u$H|$4uHL#H5zWH81H]A\ATL%UHHHHD$u11LD$LHyuHLP3u1 H|$}H]A\ATL%iyUHSHHeM#HH\$u11LD$LHJyuHL2u1 H|$HHxHtHM#HH[]A\ATE1UHQH%LtWHmH}H-N#HWm u%HEH J#H5٩E1HPH91PHE^HIzLZ]A\H I#ATH8tAHL#H:AąuDA\IH54L#HH9t+APt 1LY齊0 H=1Z1L鞊QIH5N#HjuH=B1IQ1B uIAZQIH5N#H+uH=IA@ZUHH<+HuHt H*Hu]/HpI#H5H81]ATSHQY3HHu2 #Ht(HHM#AH;Tt2H;H5!H#LH E1HCHCHC DZ[A\AWIAVAUIATIULSHAQH L5L#L9tHGu2IHEL9uH?HsH!I$!HWtz2H HHHI$IL9uH}ILIMM"LGAt92H<HHHIEI9]bI9$XH}Z[]A\A]A^A_SHH1HHt HCHu-!I1Mt&HH|HPHH9HOHSHK#H[SHH1HHtH{t 1HHHHK#H5H9JF(HtH5hA#HY1H6#HHF(HVHHZHvA#HH8uGATAUQ?wKHcH uh&HHL!LH5?h& tE1H5"h&L AąuDZ]A\ÿH@#ATIUSH81Hj9 ~;H HcH#H[ÍBATH ?#UHSH9Ou HH9Nt H;#HTHvHAԺZƒu1HsH9u1x#Aut t H/=#H=#H[]A\H;#HAUIATIUHS1QH;]}+Ht Lxu I$Hϸ1Z[]A\A]HHT$9"HUHH1H51H LD$LL$HD$|hA1EtLHt$HT$HHD$!ƒt1u#HD$HHD$Hu H>>#HHH ]H9USHHHF H9G HwH|$ 1Ƅ$Hl$Ht$Ht$H|$Hy5u;Ht$HH3!t1tu*H4$H|$耎xu u1HĨ[]øH=#H9GuQH9FuKSӍRv HA9#H21x%utt H;#H H;#H[H9#HH:#H9GuYH9FuSSӍRv H8#H:HvH1x%utt H ;#H H:#H[H8#HAVHBAUIATUHSHHHwHLu~(Le)HE1H=.rhuAL%E<#LtE1)I}HT$LHD$zxtLd$I$HL[]A\A]A^UHSHHHAEuH{HT$HHD$"H[]AWAAHAVAUMATUHSH(L_L5k7#M9DAAAu AEgD!DsHHDJ| HALD$HDDL$HD$`AYL|$H$I9GMOIIwtI tmHHHuH|$E1Iw HAMsJ{KPHL$QE>ZHHYLHIILc\[H[]A\A]A^A_16ATHHt$&IHt(HtH;D$tHp#H56UE1H8HLA\SHHuHGH;= #tHGtHHH #HP1H5H9pv1[SHHuH>HGt-HHH #HP1H5H9v1[HGSu BH4H(HtS ``uHC1IHMuHC@[útD1酇AUL,ATIUHLSHHQ 9Cr(HCH+C L9|H3HS @~ @ u'MtLH'uu@@LNHt LN0LNHtt4IHLLAHE1INDM9v.fF\fGQII1HtI9v |HKxs(LXHHQ HIHXfHnL@Hщp(@ fH:"@0[ATIUHSHHt/HuH-#HuH #HEHhI$L` HHX([]A\AWAVE1AUATIUSHHHHHt$L|$(DD$~IM9}_Ht$0H|$8LDT$Ht$HCHT$(Ht$0H|$8HD$躞HL$HtMtKLH,IMtLH@8(t$H#H5CFH:HH[]A\A]A^A_@tHHHH[]A\A]A^A_HW Hw1HJH+O0H=VLH 1HH5H=,HOHW1HwLG H=uHOHW1HwH=HO(HWHwHtH=1HO1H=PHl#xu11H={1ATUPH=T8&?ZH-@8&L%18&H=:8&U[YLHH=]1A\]H6#H=H81Hr+H#H=H81HrATLgMuH=#H5H?G <HEHc4HH=A\H=ECA\H=A\ҙH)CHH5ڱH=g1A\KHűH5B1A\H=g-H HB1A\H5H=L%#I$LA\þmHALD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ H$D$ HT$LD$DH5cD$ 0HD$H1ATIUSH蝡HH{(HHHxAuIauH#HHU =HCHHE a H{(H`gtu Hp#HHS HHU(H蘃IHL[]A\ATUSHLgMID$HH9Gt&L#H5|RE1I;虿HCHW It$ HnI|$(HnHN(AHtGH~(AH~AL9AENLLHkHIL+cH~(AH~AL9AENLHkILLAHrMuHHHHIHHK0H{fHnH;=#HS fI:"u HIH;=#uIMLc(HII<$u;I|$I\$ IL$MD$ I$膝H~I|$u=Lnh3)$NIHt( $HHCLE19HL[]A\H1HKAUATUSQHu#H9Gu HH9FtH-#HEAH9u&~u H-g#H-#HEpHO HW1HwطHHtPHK HS1Hs踷IHu H1v$DHHdHH[LHPZH[]A\A]ATSQIHt%HOHwH¿1MLHILZ[A\HHt H57#r]H#HHHt H5#R]H#HHHt H5#2]H#HH5#]Hw1黶ATSHQLgI|$urHPtkHXHHHLIHHSHsPH{XHBHJ HID$HIL$ HIt$(HtLH#IMD$0HI|$8I$HKHsLHt1H1HLIǚLZ[A\AWAVIAUIATMUSDHH#~$H|$fH:"$HT$@)L$ L8Hc$H${~T$HfH:")T$HLLR fInfH:")\$0HuH1eH|$@LEl$@$Ll$@Hc$ћ1IH$HcH莜E1HHD9~ ONIE1D9$~-GB4McALcKIcHKDIIJ19$~4LcO IMLHIM LE1E1Ll$(d$0MLc(l$(t$ Ht$PLHT$@AEpL\$H)d$P)D$`)l$p)$RYMHL$HIuME1LHL$HL$H#HL記HĘH[]A\A]A^A_ATUHSH(HHH} HHpUHu []A\bHXIHH[L[]A\HG Hu麫 HAPHu"H=;3HHtHPtHy(H=YٜZHuATIHWl[LA\HuATIR[LA\AUATL%#UHoHEL9tHH~CH}0HHEHt+I&Ht H}0LPHtH=HKI$LHI$]A\A]AWAVAUATUSHHG uH=`(HHIHb{IHt9Le L|$HLLHAT$IHtHtH|$u L@, iH}(t*HU HHr褏uHE LLLHPIH|$AƃtH} LL H1E~HL$LHH[]A\A]A^A_SHHu,H HA u=HOKH5`H=蟥HֹH=49u19HsHAHyHN #H:t=H #H[ATUH-#SHHl HtIH@ u2!uIHt%H{HHj\ Lt NE1DL[]A\H #H8AVIAUIATSHcAP@IHt9H|MtLLH5uB1 I L2 ILMԔZL[A\A]A^ù땹뎾 1Qs@Hu )1 H荔ZH #H9Gu PH='g1ZAWAVIAUATIUSQHtHL}HHA|$1HHAD$9~WIHt9LcIk LHQ yHHPHu Lғ IE NlH1蹓,Mt'HLLAyH1薓 HEZH[]A\A]A^A_WHF@tH1\HHt1YH| #HZWHN t Y\Ht1ZWH% t Y3Ht1ZHHHt$&t*H|$@H @0 ǃt HHt1HHHHt$t5H|$HH H% ǃt H韰ZHt1HH8^HH=(& bH=y(&HD$H bH=(&HHL$hJH=(&H5aaHT$HD$H=\(&cH=H(&cKH|$i^HGHc(H #HcxHD$ D$D$ L$D$OhHc|$HP% PRnZHcyPc]ZHcjATSHH= -&QWIHtuHc;GHc{ID$9Hc{ID$ +Hc{ID$({ID$0 y Hc{ID$8H{ID$@ID$HHt LE1誐LZ[A\H#H8HJHcxuQnHu^1ZV^HctYAHt1ZAUATUSQHuL%e#I$>HIH IHtsHc{0HHtZIHL6tH& IH%IuHH HHHHL9H{E1Ic}(HHHHLH{Ic},ĽHHHHLƿxhHj{Ic}0葽HHtWH8HL藿x9H;{Ic}4bHHt(H0HLhx H {H{MtLzE1[L]A\A]A^AUATUSQHuL%"I$HH(I IHIuH^HHHHLҾtuHvzIuH&HHtaHHL蠾tCHDzIuHHAHHt(HHLgt H zHzLE1yZL[]A\A]AUATUSQHuL%"I$HHPI IHtyIuH%HHtZHHL߽tHIH0 IHIuH/%HHpHHLIHxImHuH-"HEHHHLۼH{xIuHHxHHHHL蚼H:xIc} aHHHHLcHxIc}$*HHHHL,xhHwIc}(HHtWH8HLx9HwIc},ȹHHt(H0HLλx HrwHhwMtL[wE1ZL[]A\A]USQHtHGH u&1 H=yA1H;ktHwHkH3@Hu}LC AIPH~'AH~H9@@L L[(MuIѻM\8E1L9~IIHtL@HKIZ[]AWAVAUATUSHhH"H\$H8HHrH1n?IHt~L|$`L5L-H-iPLL aLsHH1LCZYHt0LHHD$H|$tuuHI9u LE1uHhL[]A\A]A^A_USHQwHHtWH*KH*C^2XHt%H*HEH*C^ XlHu H1=uHE HZ[]H"HH9WtGOHUHHuHHHHt H]1]HHpH8$UI1AHPH|$HT$ Ht$Hl$fHnLfH:"HHT$8DL$HD$(#HHP]ATI1ҾUgQ1F HuAD$Z]A\HHEHLH! XH]A\zAUAATAUHSHAPHHpHH9}HUHc Ht D&DnHmy1Z[]A\A]AW@AVAUATIUSHX_(1D$l#HD$H:IT$xAL$(E1Hl$ H=D$(HB HRHl$fHnH|$ H‰L$0fH:"D$8H|$Cl$09tDd$ L|$Dd$E)ALt$~01ɺLLuH|$r1AAA)A~>DLLtAE1ڹDLL|tAE1A|DDLLZtDl$%Hct$H|$ilHD$HX[]A\A]A^A_PHIHpHL9IL;lZAWAVAAUATIUSHAPHoH9HN}wtH;LHE1Hc{$AHtIHt.fnC$W1Lf8=f~HcHAFtL5"AML5"HHH{HHt-LHHHKLHLHS0{$LcALwZD[]A\A]A^A_ATW1USHP~4"fH:""D$@HD$0)$)L$ *:HD$8HAH5"zz($H5X"1LD$H="H )T$ HD$0HH=&(H=&CH=&HD$ )H|$ H=&(L%&gBHHt HH5CLAt H1$"H=}&Hl$()H|$(t[H5"H--&Ld$ H% H|$ LH5AÅuH|$(LH5AyA1Hf% uH|$8HtHD$8oH|$0Ht!H|$ Htu!H|$(Htf!HD$8HP[]A\UHSAPLG HuYH[L]銇HHLHx Ht.H01HHHH9}LKH<MT9LT9HlZ[]AWAVAUATUSQHuE1FL>HMtHw ILA1M! IHtL9}HtDLЏIDHZL[]A\A]A^A_H(HWO@wHH|$HT$L$1@t$HD$ H(AVAUL-"ATUHSA} HtHM8Mt<11H5\LM y%H."LH23 tYL7 1cE1IHuIIHHu|IEHuMtLHHhHX1[]A\A]A^H"ATUSH8HK0H{@Dc,)C,u 1H{8‰1EHs0Dc,.[]A\SHHu0HKH;HAu;H\H57H=I~|(HֹH=.~#u H[M1[AVAUIATIUHQHGL5$"L9t H;"u'I}uE1MmI}L-"IT$L9t H;"u!I|$tMd$I<$L%k"Ht1HML9t H; ~"uH}ktHmH}H-5"IEI$HtHEHLLLIkLkHtHkZL]A\A]A^HAUIATQH谐IHtNLH5|H y8H"H8Wu H"H:Wu LE1QkfLZA\A]HHH"H857UH5H6A1Eu H)"H]ARHk"IIIH8Ht%HVuUL"H LI0RHt*IH uH5"HBH6ٌ(Mu11LAYTMuLLLAX鏏1ZATIH=o<$*Ht[IT$HHtIL$H=`1A\üHj1D3IHt"H=5<$LH=mA\H1銼1A\SHH==$赙HSHHtHKHtH=Io1[QH= `1[BSHH=W=$rHSHHtHKH=_1[H=_1[Hw0HHuH5"Hz114 AUATUSHAQH;5b"tIHtHtHHlLoL;-v"HtAXH[H]LA\11A]޺ YH1Ht211LA8HtHSHfHnI$fI:"Hh @Z[]A\A]11\ ATUHQt"H "HWH5@1AH9,6iHL%#HHLt HPH913AUATUSQHnHIHGHWL@HtHJHDH="H D1E1H50H?x3:IHVH1%IHt!HUHs LHʢ LHeIZL[]A\A]ATHUfHnHSHHfH:"")$hHHPHI AExLe( $1HH]MH[]A\AWAVAUATUSHHGHHt>H:t8HNIHHt%H;tHl$PAH=t$H="H5=AH?JtILLAątHAIL|$L9|$`}L"H5p=I;CHitCLiu"FHit4FLsit#H4$H|$PLHyLqHc|$$HfIHt(LcL$$1LEII1E1HLT$0HALbE9~ KIHt6HT$0|$$LHHLIHL$LHLiHLHĨD[]A\A]A^A_AUATUSHHXHHuHu A5IH1LOAąuH $Ht$LHMH3@AHXD[]A\A]AT1UHQH"H0IHt0H@HpHH@`y LE17bLZ]A\AWAVAUATAUSQ} HHmLh8Au xXH5^;u#Lig@Au%H5a;L R"I9肂H1aHuH1xIHH脀 LIaMLu`Mt?L2Hx6dIHuYLQaLH:AOMgHU\1L LI aMtlHEPU\M|$81ID$P9~HMhMD$hH4I4HLAuNGID$xLƯ LL0y L`E1HL`ZH[]A\A]A^A_ATUHQHGH;"t H;"u"H}E1t)HmH}H-"HEH'HI<`LZ]A\ATUHQHGH;"t H;q"u"H}E1[t)HmH}H-%"HEHIHI_LZ]A\ATUHQHGH;D"t H;"u"H}E1t)HmH}H-"HEHBHI_LZ]A\ATUHQHGH;"t H;"u"H}E1t)HmH}H-i"HEHHHI"_LZ]A\ATUHQHGH;"t H;W"u"H}E1At)HmH}H- "HEHHI^LZ]A\ATUSHH "H5Q5AH9UDgEtH"H5AH:-gHHuH"H5oAH8 CH-"HuyHu$AHuH}H57A~ H~HCD[]A\ATIUHSHHHD$HwM-1ҹLH=luQH;Ht$蜷t@H}H\$*u.HE H+EHxH9~ 1HHIHHH[]A\|H1[]A\ATUHHQH"H0xIHu'HuHUHJhHu"IMyHHt HHxILZ]A\U1HSHHH5@HILD$u1EHt$HXHHtH$Hu 舩Ht|HuH"HH[]ATIUHSHHYu1CHsHHHt1HAu HtHuHD"H[]A\UHHSAPH~u/HvHHHHt YHH[]èHt 2YZ1[]SHHu.H`uH"H5lH:V|qHu+H{{L "H5"/H1I9e"1Ht$ HH|$ u)HulHJHxXƉH9uO:xKHYH<HtHx"H:@u;O˃t2H9u+HTA$8LB"H5 fI8tH=*"H5fH?tHS1H[]A\AWAVAUATUSHXHuL"H5!eAI;ctHH"HH9FtH "H5eAH91tRSl}4H5.t6NʀwGH "H5.AH9sH{Hu!H5/H_"1AH; Ht$J~|$uHH9vL ""H5EeAI9sHk ADE(A9~$H-"1AH5.H}S tLUxLM0D$(L=}IRMqMZ DD$0fInL|$ LIfH:"D4$D$8EIcHUHHDLl$ HHL"tLcD$ D$(IBDE1D9<$~FTE9A9|AIDT$ v,H"D1AH5-H;`HXyLc Ml$0AyHAWUMcIL0TIHtӰLLI IE1E1D9$$IcEt$MIADuf=fmw2fSIcwDf6lfD5f2+]nfPL DKcLf] ,WfIM&f=f=LcLcKH:u A9AEOIcLML2HcMI8u A9ĸDOMLILIcIDHHI4MLIٳMIcIDIHM$M^L贳DHMKA|Mt)NMLI至DHMIMIcM EtE1E1EHcs`1AIL aH=)M$Le*H5*A9$~QT$ 9TuBILHH9}Hu1I9}EIHtHHLH4$9UH1UH4$Ht0tJtMIM9}NDt'At܃uH5*L"I87oAWHsHiHJCdDk`.H5)^H57)IDLHIE@HXD[]A\A]A^A_AUATISLOHH5Z"LztID$pAIA`HtHtL~HuGH "IQH5G*1H9]5膚Hu+H=ҿ"LH5P*1H?6HxHAD[A\A]HHt$GtH|$Hd1HAUBATUSHvL%="I$HHHAH5h"苐tLML{AątE1HUH9SAL; "u>Ht$ HHu蟙Ht`E1|$ uQHxLE1H9CA?H1FUH{谊IHtNDHHLHOLI0AuAu AuAu L%"I$ L%6"I$HL[]A\A]UHHHu W1/HH|$sdAExH|$HvzH]AWIAVMAUAATUSLHt$ Ld$PCf.vz4u2uHt(IGH "H5v(E1HPH91yT$ A1ɉ)IHuE1fHtIMt8LHLIHu LnQ6HLLILVQHLLI>QL3MtHL[]A\A]A^A_HuՕAUATUHGHHPhHtHBHt]A\A]t?H$IHtRHH\LIQJL;-j"Mu+L=JHMH=Z"1E1H5V'HQH?L]A\A]Hu2AUATUHGHHHhHt HQHHt]A\A]HAHt]A\A]H tDH>$IHtWHH LIIL;-"Mu+LIHuH="1E1HVH?H5&L]A\A]HAWAVAUATUSHHH$H9v HSHHIEHKHHt6HI9v HEIkPE1KHEHuDH;FOѿHHuH LHIN6L9LUL O\2M\9M9tIwI*HHMH8L[]A\A]A^A_H cUHHSHHHvHuHt+QAL~#HHL$Q1jjB>H HtHH莚HtHHXH[]HHHHuH~ HHu/PAL>r#1HD$Pjj=H HHu1(H?ht Hc ̊HtHHHHHuH~ HHu/PALq#1HD$Pjjb=H HHu1%H?zhǃt  THtHHHHHuH~ HHu/PALp#1HD$Pjj<H HHu1(H?ht Hc  ىHtHHHHHuH~ HHu/PALp#1HD$Pjjo<H HHu1+H?gt1@ [HtHHHHHuH~ HHu/PALRo#1HD$Pjj;H HHu1/H? gt1@ وHtHHHHHuH~ HHu/PALPn#1HD$Pjjo;H HHu1.H?ft1@ XHtHHHHHuH~ HHu+PALog#1HD$Pjj:H HHtH? fǃt Ht1HAVAUATUHnH(LVHuIt1PHA1L#LHD$Pjjz:H HHt6LuH5"LeI~~uHVLH5MH=#MJ1H}[eAŃtH}Jeu ,Ht HuL;%T"t,IT$H;"t!H 5"HRH51H9E1DLL蕞 H(]A\A]A^HHHHuH~ HHu+PAL,#1HD$Pjjk9H HHtCH?dt*H"H8y&H5"H$LH6[ AHt1Hq"HHAUI1ATUHHHpLl$ LMuH~ HHu1PHALL#HT$R1jj8H HHtaH}IHtH}1L9t;莅Ht/CL >u"HMH H5KKH=VKH1+HL$0HT$ 1LH|$HD$ HH|$(tLHpH]A\A]AUIATAUHHTt,HmH}H-"HEHLHA7D]A\A]ATSQHuH"H5JAH8hX)HHA>HtH{E1HCHt}7DZ[A\H"H8Hu H=s%& AQH5}#X HHtHPtHP11AX;XATH5"UHHHT$׌yHD"E1H8A#t2H|$uH}1HwH=I IfHu(HuHT$H=I1HvZ HI(A~ HUH "H5+1HRH9%H|$[6HL]A\ÃyH=bI1 ATH5"E1UHHHT$H|$u=E@H5LHLD蝪uH=HL1 IH)uDE@HL HLDTHt$H=HL1N HI(A~ HEH "H5HPH91H|$O5HL]A\AUATUHSAPH_@H9u,kEIHHHLH 5HIHt^Hu^H[]A\A]H}u (_E(ID$HLIHt#LHuL4L41YL[]A\A]SZH[]A\A]SHHtHH_4H[AUL-1$ATIUHL9ul11IHIT$@I|$HP@uIL$It$(HHtOHLHHHt HL3L3uIL$@Hy LT HE1LH5g1;HHt@LMLL$wu/ID$H="H5IIHPH?1+Hc31H]A\A]AUATIUSAPHoHtHHt HQfI$UHHMD$(ML$@NlMxL9IOID$81HH9~zI|$0?u4Hu Il$E1MT$ LIID$ ID$0I۾?I+t$0I)L9IOHHrIL$0IT$ HAID$0IELlIl$I$H1HH9s Y[]A\A]HBIHteIL$@HxHHH9} HD)HHH1HH9~*LLHHu LE111HI$L1E1ZL[]A\A]ATUH1S`IHtHHOLH1IL[]A\SHH@ILHD$HtHLAH|$HHtU1Ht#H=y#$aHH=]4H1ЃHH@H[vAUATUHSQH9uHWH HzLNL"HM9tRH5"I9tFLL>u:LL=>u+H5""L:tuH5w"L'tuH#HEE1HtL`HvHtIL9~HcHHt4HӶIHtAHLLA50Au H'015EtH0H'"HH0|HuH"HZ[]A\A]wAUIATUSQHu zAVLGIXpHt6H{t/HHAԳHHt+L1HSHA/LH=AqZD[]A\A]AVAUIATUSHu |zAZLGIXpHt:H{t3HHIAUHHt,LLHSHA/LH=A[D]A\A]A^AUIATUHtHHu yA''AHHtLHgHA.D]A\A]AVWAUATUHRHGLgXLo`GXLwhHGhHXH͡"H9WuH"K HHt.>.'ggyH "HH1a tHe XL]LLA\A]A^?@ AVIAUIATAUHQH1tDHmH}H-"HEMuLHfALLH4AH-ZD]A\A]A^SH褑 A1ExHC8H[Q苑 yZ(XUHSHAPHt H;=d"t HsHu/HH=u)H=d[tHsHY[](! Z1[]AQHt%HGtIIHt"HN uH= R1HwQH1APIL8^_ZHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HL$ H$E1D$HL$HL$D$ 0HD$HHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HL$ H$AD$HL$HL$D$ 0HD$HH(E1LL$D$HALHD$aH(H(ALL$D$HALHD$4H(HILD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$ ID$ HD$LHT$1D$ 0PjLL$6HAUL-"ATIUHGHL9t H;Ğ"u&I|$谞uE1jMd$I<$L%t"HUL9t H;"uH}ytHmH}H-C"I$HLHE LI)H)L]A\A]AUL-["ATIUHGHL9t H;"u&I|$uE1jMd$I<$L%ʠ"HUL9t H;"uH}ϝtHmH}H-"I$HLHELIK)HC)L]A\A]AUL-"ATIUHGHL9t H;p"u&I|$\uE1jMd$I<$L% "HUL9t H;8"uH}%tHmH}H-"I$HLHE]LI(H(L]A\A]AUL-"ATIUHGHL9t H;Ɯ"u&I|$貜uE1jMd$I<$L%v"HUL9t H;"uH}{tHmH}H-E"I$HLHE2LI'H'L]A\A]ATIHUSH Ht|HH y H"H5:H8iHH'MHL$HT$HLLD$E H{'t%HL$HT$H=:1Ht$H []A\yH 1[]A\AUL-"ATIUHGHL9t H;}"u&I|$iuE1jMd$I<$L%-"HUL9t H;E"uH}2tHmH}H-"I$HLHEybLI&H&L]A\A]AVIAUIATE1USHG LHH0HHxHtHxt4EMI~E1I6MH=g"LH5H1H?GHxmOIEHt(H} AHHurE1HA rE1HtH%[D]A\A]A^AUL-B"ATIUHGHL9t H;"u&I|$uE1jMd$I<$L%"HUL9t H;ə"uH}趙tHmH}H-"I$HLHE]LI2%H*%L]A\A]AUL-"ATIUHGHL9t H;W"u&I|$CuE1jMd$I<$L%"HUL9t H;"uH} tHmH}H-֛"I$HLHELI$H$L]A\A]AUL-"ATIUHGHL9t H;"u&I|$虘uE1jMd$I<$L%]"HUL9t H;u"uH}btHmH}H-,"I$HLHEILI#H#L]A\A]AUL-D"ATIUHGHL9t H;"u&I|$uE1jMd$I<$L%"HUL9t H;˗"uH}踗tHmH}H-"I$HLHEoLI4#H,#L]A\A]AUL-"ATIUHGHL9t H;Y"u&I|$EuE1jMd$I<$L% "HUL9t H;!"uH}tHmH}H-ؙ"I$HLHE LI"H"L]A\A]AUL-"ATIUHGHL9t H;"u&I|$蛖uE1jMd$I<$L%_"HUL9t H;w"uH}dtHmH}H-."I$HLHEdLI!H!L]A\A]RIIHH5"HetMIIz7etMRLLXdAUL- "ATIUHGHL9t H;ɕ"u&I|$赕uE1jMd$I<$L%y"HUL9t H;"uH}~tHmH}H-H"I$HLHEELI H L]A\A]AUL-`"ATIUHGHL9t H;"u&I|$ uE1jMd$I<$L%ϗ"HUL9t H;"uH}ԔtHmH}H-"I$HLHEۦLIP HH L]A\A]AUL-"ATIUHGHL9t H;u"u&I|$auE1jMd$I<$L%%"HUL9t H;="uH}*tHmH}H-"I$HLHE聑LIHL]A\A]HwH(XAPHFH;s"t H;r"ut"Hc^a#HHtY1ZATIUHAPHFH;""t%H;!"tHHtvY]A\LHHt]t>HuL賐IHtEHu u H9t:Hu LLHIH "LH511H9VE1LZ]A\AUL-"ATIUHGHL9t H;"u&I|$譒uE1jMd$I<$L%q"HUL9t H;"uH}vtHmH}H-@"I$HLHE-LIHL]A\A]AUL-X"ATIUHGHL9t H;"u&I|$uE1jMd$I<$L%ǔ"HUL9t H;ߑ"uH}̑tHmH}H-"I$HLHE#LIHH@L]A\A]AUL-"ATIUHGHL9t H;m"u&I|$YuE1jMd$I<$L%"HUL9t H;5"uH}"tHmH}H-"I$HLHEILIHL]A\A]AUL-"ATIUHGHL9t H;Ð"u&I|$诐uE1jMd$I<$L%s"HUL9t H;"uH}xtHmH}H-B"I$HLHE/kLIHL]A\A]AUL-Z"ATIUHGHL9t H;"u&I|$uE1jMd$I<$L%ɒ"HUL9t H;"uH}ΏtHmH}H-"I$HLHE-LIJHBL]A\A]AUL-"ATIUHGHL9t H;o"u&I|$[uE1jMd$I<$L%"HUL9t H;7"uH}$tHmH}H-"I$HLHE[LIHL]A\A]AUL-"ATIUHGHL9t H;Ŏ"u&I|$豎uE1jMd$I<$L%u"HUL9t H;"uH}ztHmH}H-D"I$HLHE-LIHL]A\A]AUL-\"ATIUHGHL9t H;"u&I|$uE1jMd$I<$L%ː"HUL9t H;"uH}ЍtHmH}H-"I$HLHE0LILHDL]A\A]AUATUSHAQHw H(CHH{HI;LHHtpHsHK HH="HH IHuH{HH{ /LkH=#HAXL[H]LA\H=,1A]+kZ1[]A\A]UHSHAPHuHSHsYH[]_|HH= suZ1[]AUL-"ATIUHGHL9t H;|"u&I|$huE1jMd$I<$L%,"HUL9t H;D"uH}1tHmH}H-"I$HLHEU LIHL]A\A]AUL-"ATIUHGHL9t H;ҋ"u&I|$辋uE1jMd$I<$L%"HUL9t H;"uH}臋tHmH}H-Q"I$HLHE= LIHL]A\A]AUL-i"ATIUHGHL9t H;("u&I|$uE1jMd$I<$L%؍"HUL9t H;"uH}݊tHmH}H-"I$HLHEsLIYHQL]A\A]ù11zAWIAVAUATIUSHH(H<$ )L$LL$(L$AW 1AH AAAAAEAAE9I@MWL9|MyIľLHIHy HػHILH)L9l t@MXHt MX0MXH t@MgHt Mg0MgHE9tOLLDDDL$LD$L\$L$*L$L\$HLD$DL$Iu1xHAAI<A@ @tVAG @tOHMuHH9HE1HLLI1'HHIdHLLI"HGHHLLII<莒H#HI' HH=J%u0o H<%HuH "H5;&AH9}3( $Hl$1HIH5PH=8)L$˭ ($1IH H5H%H=)T$蜭 H%H%_H=|%H%tH=s%tH=%tHu AeH= H$%HtIH=%H %H=%%%Hާ%M,H%AH D[]A\AVH0H 0AUfHnfHnHATfH:"fH:"US_HP) $)T$v&L"H5v1AI;!AA H-`"DeEHcDmH=%Hn%Hk H%H%HuχAL1(\$H=1fInH5O%Lt$ fH:"1\$8D$(Ht$ ul L1l L1(,$HfInH\$ L 1fI:"l$8d$(1l Ll H5%Ht$ l LFl EE1HPD[]A\A]A^UHSHQHwH :1ҹHH=Yvu14H}:ǃu\HtxHņ"HZ[]AVAUIATIUHAPHw H~%Im&1ҹHH=0襲uH-u"Et$EyH|"H51H:/AD$uYH=]A\A]A^~WH;-+"u1ɺ1L HHujHEH貱I[Ht H1G褼IDLkLA`EtHH|"H8 1ZH]A\A]A^USHHH(U9t HH[ H0tH{c 1[I1MtHpH([]AVHBAUIATUHSHH@HwH;8Aău+HH=Q!u_ZHuUH{E1H~LsHt$I] Ix/LLxx Hl$ LDH]t H{萿 1H讗H@[]A\A]A^AVAUATIUHSHuH}*8Hc؃u+HֹH=WuYYHuOHp"HmMt$ L8I|$f u H3S?v H@L ~"LI1.1HuBIvAv u6I6HE1d u$H "H LH1.1_L-?LTuL HuL*~"I8R uHH5%H|HHEH/Hu H'"H[]A\A]A^AUATUSHAPɹILA藺Et-8u St1 H}"H8Y[]A\A]Ž H"HZ[]A\A]HHHHuH~ HHu/PAL<#1HD$Pjj H HHu1!H?Ht$HtH5]"|$)HHHHHuH~ HHu/PAL<#1HD$Pjj H HHu1!H?Ht$ԴtH5Q"|$HAVAUATUHHSHp5tIdWI1MtPLILAEt(~8u t1NH%|"H8M =t$PHt$Pt$Pt$Pt$Pt$PLL$PLD$HHL$@HT$8Ht$0TH0Hp[]A\A]A^AV1AUATUHHHHIH(LD$ HL$LL$3A1EtTHt$Ld$HDt$ LDl$@1t-LDDuHV{"H8~ Hu"HH(]A\A]A^AU1ATUHHHHHLD$H~2A1EtKHt$Ld$HD,$L贮1t*LDtHz"H8 H"HH]A\A]AT1E1SHHH5THHT$Lt\|$Ht$ tHoz"H:藺 I6HC HxdIHt!Hc|$ sJHu LE13ID$HL[A\AVAUATUHSH0MH|$ HuHy"H: HH*D$HHE H* 9"Ld$(H*T$Hx8Ll$ ^ $^fI~T$cHHt{D$eHt[HEfIneHtHHE I*^$yeHt0HE(I*^$aeHtHE0H*^$IeHu H1HE8H0H[]A\A]A^AW1E1AVAUATUSHHHHHHL$LL$LD$:0D|$Dt$Hl$ D$0Dl$葴DDHDHD$H|$ANEyF8u( tHC HxHbIHu/E1H@x"H:h Io|$0uL=U}"I\Hc|$0FH|$4IGI Hc|$ IG +HHc|$8IG(HHc|$(IG0HIG8RHt LuHĨL[]A\A]A^A_AVHAUATUSHMuLx"H5~I8>&1I HHxKE1IH=~%H=w"H5!H?&17II9t`LL4 HHu1sHPu"H ,x"H5H9%H1DHK4HuHLyHv"H8 H{"HH[]A\A]A^AVAUATUHHSHH@[yLpv"I:蘶 1HLt$TH1HH辊IHLLw/LIID$H?v9|$uIt L Ev"LH51I9PHu~DH]t8tHu"H: RLw"HT$ H516HI8L1`PHuHc HT1H@[]A\A]A^þ{ WH2.tHcu PHtOHuY!1ZUSHQHuH;-Ńu-!HֹH=u1;OHuH{-ƃu OHu1҉ xHy"HZ[]H1 AUIATAUVDLHHAEtHAt"AH8e D]A\A]Q11yHt"H:: ZWH,tHcu NHtNHuY1ZH1!THT$ D$ 1\A1EyHs"H:賳 HUSHQHuH;g,Ńu-!HֹH=X蕤u19(NHuH{*,ƃu NHu؉VxH7x"HZ[]WH+tHHtFLuMt HHu >L5zj"L} MtHu .L=cj"H}(Ht$u5L=Hj"ML=Ht1ZHcY4HHHHuH~ HHu/PAL#1HD$PjjH HHu1=H?ǃtyHc"H:訣 a>HtHc3HHHHHuH~ HHu/PAL0#1HD$PjjH HHu1=H?ǃtkyHb"H: =HtHc3HHHH5H1HT$ sA1Et&|$ yHb"H8轢 Hc2HH(HH51HT$ $u1`|$ Ht$tHCb"H8k &H*D$YrH*L$Xf.'zu<HuNH(USVߝH臾H譞yHa"H8Y[] Hf"HZ[]AWH1HAVH\AUATUSH(HL$LD$D$H|$D$stIH@mHHu PfHA@LuIH:IWu%H9b"H5H81LULˑLIMy);H/L a"H5I9wI~He"H5zH:SHcI9|nLcM9|?~A^LtIHu WeIw?H1LL$HL<HDLLMH=Hl$MIM9MADIIN \:HuCL|$HLZtH_"E1H: HHd"HHMtL1H([]A\A]A^A_AWH1H5^AVAUATUSHHT$ 8D|$ AA@IcH_??HHHHu dIHHDAŅtTH08tH^"H: IAuHd"H5E1H8v En1"bIHtqHH?AEtTIcHHH9v@HHLDMs..AIHt-LH/Lt?8AHKHAMtLE1HL[]A\A]A^A_ATE111HHt$ H|$D$D$ tH]"H8 =|$11 x,|$ 11 xT$ t$H=G1-I|$t|$ E1tHLA\HHHt$ Ut,|$ ZyH/]"H8HS HLb"H1HHHHt$ t,|$ 貴yH\"H8H Hb"H1HSHHHuH;Ht$ 軔u#HֹH=ލu1AH{Ht$膔tt$|$ yH\\"H8H[ Hxa"HH[HHHt$ Mt,|$ AyH\"H8H: H3a"H1HHHHt$ t,|$ IyH["H8H H`"H1HSHHHuH;Ht$ 賔u#HֹH=Ōu1AH{Ht$~tt$|$ nyHC["H8H[f H_`"HH[HH1HLD$ HH K#A1Et&|$ 胿yHZ"H8 Hc+HVkyHZ"H8Y H_"HZATUSHD$ Ld$ 聖LH&HLy(8u t12HZZ"H8肚 !Dd$ Hcs*H=HD1)H[]A\HHH521HT$ ̾A1Et&|$ 9yHY"H8 Hc *HVyHY"H8Y H^"HZHH1HLD$HL$ HA1Et,t$|$ ضyHmY"H8蕙 H^"HHWHKtyH5Y"H8^\ 4Ht1ZHcYE)HH1HLD$HL$ H&cA1Et,t$|$ ܸyHX"H8 H]"HHAVIAUATUHSH HtHYH~ H1Hu:1PHA1L#LHD$Pjj1H HHu1-H}EAŃtH}4Aău 3Ht 3HuLHtmH}Ņxual_"דDDIDL蚔y}=7_"u8&ʉ !_"=_"tW&脓DDIvLLyH5qW"H>虗 -u:11D y*D۰-^"tu%2HHcQ'H []A\A]A^AVAUATUHHHuH}Aău2"HֹH=$u1HH}Ht$t|H}AŃt-Hl$耒DDHIOLIDMy# X1Ht2HZV"H8肖 ItHL]A\A]A^i&$1HtH1]A\A]A^AWAVAUATUSHHHuH;AŃu2"HֹH=,/u0HLcL+uHV"H5H:b HHHt$HHLAxnAWL4$DDIL2LHHy}8u ӮÅt1Ht$DL_Hy!uH U"H81 /HuHHH[]A\A]A^A_]H1[]A\A]A^A_AWAVAUATUHSH(HuH} AŃu."HֹH=مuk/Hu|H}IHtH?LHRHu7/HHuDH}Ht$}t2L|$Hy ]wH1ۑHD$HLp Hu1.8u;脭Aąu2ȏDLHLHD$H|$I腐Mx-E1HEuHS"H8H([]A\A]A^A_鱓 L9t H|$LHD$H([]A\A]A^A_AWHBAVAUATIUHSH8HwH}4 AŃu2"LH=]auJ-H<H}Ht$Lu5"1I~H} Ãu-HLL|$(uH=S"H5H?S IHHt$(H|$ HLA x|ILt$ DALDHD$L H|$HHyd8u 身t1Ht$(DLD$\HT$y!uH Q"H9 ,HuHH8H[]A\A]A^A_>H81[]A\A]A^A_AWAVAUATUSHHHuH; AŃu2"HֹH=軂uM,HLcL'uHeR"H5H:d HHE1Ht$HHL謕xtAL4$DDIL!LH覍Hy 8u bÅt1Ht$DLq[HyuHP"H8 Huu+HuHHH[]A\A]A^A_H1[]A\A]A^A_AV1AUATUSHH`Hl$HHuH;' AŃu+HֹH=WTuK*HuAH{1Hvku/CHUu#HKHVH5TH=SE1vH{Ht$tH\$肋HT$ DHHt$IzLI?My襵8u:tIt LɷI /*HtH|$tHlHO"H:G H`L[]A\A]A^AWHBAVAUATIUHSH8HwH}AŃu2"LH= uG)H9H}Ht$Lu߂1I~H}yÃu])HLL|$$uH=tO"H5žH?s IHE1Ht$(H|$ HL蹒x|Lt$ DALDHD$L8H|$H諊Hy8u gt1Ht$(DLD$tXHT$y!uH M"H9迍 z(HuHH8H[]A\A]A^A_H81[]A\A]A^A_AWAVAUATUHHSH8HuH~ HHu2PHA1L #HD$PjjH HHH}ÃtH}Aău'Ht'HH}Lu!IHtH7LHHu{'HHL;5Q"u<`1҉HDI辶LI#Myy色8u^ߥtOL|$LLvt;HLDImLI҈My(88u 莥t1"HK"H: LH=,1TH8[]A\A]A^A_HHtH|$It"HK"H8趋 'o&I1MtT$ t$H=1HAVAUATUSHHHuH;;Ńu0$HֹH={i|u1%HuH{Ht$CtH{H3tL4$Ll$ĆLLIL芇u Pt땅u HO"H"հHJ"H8H[]A\A]A^騊 H[]A\A]A^AWAVAUATUSHHHuH;LŃu0$HֹH=z{u1 %HuH{Ht$T~tH{HD~tH{Aăt L<$Lt$$Htfu譅DLLILptЅu HN"H$ƯH}I"H8H[]A\A]A^A_闉 H[]A\A]A^A_SHHHuH;Ht$ Ku#HֹH=nzu1WH{Ht$tH{Ht$t؋T$t$|$ QyHH"H8H[ HM"HH[SHHHuH;Ht$ 轁u#HֹH= yu1WH{Ht$舁tH{Ht$vt؋T$t$|$ yH7H"H8H[Z HSM"HH[AUATIHU1SH(HtHiHHuH~ HMu2PLA1L#HD$PjjH IHI<$IHu"HH2LH~HtHt I|$iŃuM"Ht1Hy"臭H @G"H9b IH1HD$ILh Hu LwC8u)虠x/IT$L>1诨HHxHF"H: LE1(H9t H|$Ld$HNHH(L[]A\A]H L PK"HHHD$D$HH [#P1LD$-AX1ZEt/T$t$ yH%F"H:M HcCHAUATUHSHH(HtLaH~HE1Hu8E1PHA1L#HHD$PjjH HHu1zH}Ht$ ftLHtH}Ãui HtƻDl$ SDI膢LuH@E"H:h Hc^H([]A\A]ATHHUSH HuH~ HHu/PAL#1HD$PjjH HHu1TH?Ht$ |tDd$ 覀Ht$DH薩HluHD"H:蹄 H|$ H []A\AUATUHHH HuH~ HHu2PHA1L#HD$PjjH HHu1jH}Ht$/|tH}Ht$]^tLl$l$LInLA裀AuHC"H: HH"HH ]A\A]HC"HH8G WHt H!jHtCH;ztH:u蝝HHuH=1Y HC"H5H81ZATUHSpmIHtHHm LHIL[]A\ATUHS6mIHtHHl LHIL[]A\AUIATUHSAPlIHtLHH菌LHIZL[]A\A]AVAUATUSHHu `%HIlHŃHE AAA tLmH@t Lm0LmHIE1I9AuGLAuGL]GLAMCwH H"Dɀ< uDtA aD5lxDH0OAqvCH|$L ;LHHD$H5hH|$HtiHa EL$MI8AD$H>1H[]A\A]A^HHHHuH~ HHu/PALB"1HD$PjjH HHu1"H?ǃt HtH AVAUATIUVH#E"L8MuYHH=%]A\A]A^H88IH=L蛧HHuLHjH-C"IHE%HLL)HujH}HIejHMt>Ht4HLL:y LLZH]A\A]A^MuHtHXL]A\A]A^? H+D"H8HuHH=%UHiHHtHJH]m]AUATAUHSR:葦Ht AHxIckIHE1:H_HHu HH\HHH)HHiHu LRIL$IcՃ;Ht HkAHHC"LH8H~H5#输 t&H5fH=LH5=H=y9XL[]A\A]uAWH@AVAAUATUSH(HB"H$L8~IHuIHcH\HHtaE1KIP|$ IH%HH1;"H5H81PLLLHIyHHL[]A\A]A^A_ÿP ATIUHQHt HQ HL1H IHtHLZ]A\AUHATUAtHGIHuNHtE1cHxHHu ]A\A]=DLH%HAŅt!yD(H8"]A\A]H8x 5Q HIxL]A\A]UHHl$H迣HuHS8"H8{x HP H]ATUSr(H2IHu$H8";H8t6x H5 HP Iĉ+L[]A\AUATUSHHsH{ Ld$ItHL觘HLuHLZtHHs8yHz7"H:" $D,HFLHt uH[]A\A]AWAVAUATUSHHuE1HIAI1L|$D9}1LLƄ$nHuLQD9u$t< uLd$MLtH LLHpI膽IMu111H萓HL[]A\A]A^A_AUIATIUHHx$HuLHL]A\A] {H$y]1A\A]AUE1ATUSHQLgLHHtpM9}kJ|HGH;:9"uHJu(H 7"HP1H5֦H9膑H1#5HHu H1 J|IZH[]A\A]ATHGIH;8"u yI$=IuE1/tA\H q6"HPH5~1E1H9LA\USQHGu ~ HHyHyAAuYH9kH 7"H5߃H98C tHSH@t HS0HSHu*ujZ[]AVMAUAATUS^IHtLDHLHWI[L]A\A]A^ATSQ^IHtHLH$ILZ[A\ATSQ`^IHtHHLHILZ[A\HtHtP: Z1H9H!AWAVAUATUSHXLXMIE HhHT$ Lt$(HT$L|$0HthHD$0L%aHL$LLHFtAH|$(HOtLuH\$ HtH{H533"H9t u1Ht$8D$ E1HD$0Ht$HL$LLLFH|$(LGAtLL$ H54"Iy2tMQMtIz@tHtJHD$HHL$HT$@Ht$HHyh t&Ht$@L^AtH|$( uZ|$ tH5H5hHt$(ID$ MtC H5Q询LH5蒢H5bHX[]A\A]A^A_Ã=8"UAWHG"E1AVAUIATAUSH88D9tIHIuAE1A|$ -8"{IiϰHIt T$~tF|$ 1It EL5Lat!H5轡MiǰO|E1H|$)WL|$D$HLD躉+H5jLߏLHULF57"=H57"DL$DD H8[]A\A]A^A_ AVAUATIUHSHHh uGH{hHEHkhHtLk81MuL9}"I|Hj1"H9Gu HLH[]A\A]A^AUATUSQHtE1H>HHueH/"H5BH8Z1[NdHI4$p)t8It$HZ)t"It$1ɺH(t IL;+|1Z[]A\A]ATIUHQ)VUGwtHL(HEHpH;5^1"@H;53" H;52"AD H;510"ADu H;51"u L."H5'I:1H3thD]AAwYH}D'At"AuFHWHBH;0"tH;3"u, 1y3tHm}uHuH=/"H9~`H ."H5xH91Z]A\ATIU1SH1HtHH9}&HTHrHuH޺Lo'u[]A\UHSHQH6HsHHCHuHsHsu!HpHtH&uqHS(HuHs0E1Ht!LHrHtH&u;H E1HtL H{E1HtLMM9}H,"H5H;W1oL[ 1MtILC1MtIH9tH-,"H5H}131ɺH%tHs H%@@Z[]UH5CH\u H]&HD,"H5eH81談1]AUATUSQ;G~H-~+"H5H}~1HIɃH^Hc4HIt$UIt$H;50"u H=Z+"H9~tL+"H51I8It$gI|$E1HtLML$E1MtMM9tHE+"H5Ɲ1H:AI|$Hu Ml$1-uL9}AIt>u+HFH;/"uHE1MtM]H *"H9HtHQuIt$1HMD$E1MtMMT$ E1MtMM9tL%*"H5G1I<$It$H$eIL$D)At"AuHIH4*"H5EH81It$1HtHH9}H|$u-It$1HIt$ 1HH묅uH=)"H5H?-I|$H51ۅI|$HuIt$Hu tI|$uH^)"H5H;1]1H3It$HtH>L &)"H51I9%1+ÅyL?)"H5AI:h1MZ[]A\A]AUIATAU1SHQ1HtHH9}HtDLt HظZ[]A\A]ATIUHH5 {QH!tHL Z]A\AUATUH H=O("H5E1H?yHH=ѮHD$HYH+7Aąt+(HUH +"H5d1HRH9^HT$H5N"HU yH'"H8¡Ht$HuHT$H5oN"H y@H=1] H|$I#MH|$L-n H|$umHt$Hu.HU(Ht$H=1] H|$IմHM7TH=1}] H|$I谴MtH|$Lm H|$uH|$Ht致EuH6E1H L]A\A]AVAUIATUSHHFu%HHuH5EE1H= F~ yLHt$覐 IHuHE1uH]H;D$t H='&"H5_E11H?HHxH|$H9v*E11HfHHtɋHT$LHH` Hƅt"uIH;t$rVLvHJ4ǣIHu:*ELLHL;HtH5%"E1H>7e HMOIE11H[LSHL[]A\A]A^AUATUHHu3HMHAuAH$tH50}E1H=}7HֹH=_Uuay y1HMLeHQu*HsH5|H=$*Huy y1LHm誎 IHuE1NHuH1E1肎 HHtHLHcIL<HtH/L]A\A]A118AUIH5ATUH@Hl$H@H:A}(uH5OHyH58HyiI}IHtXHH(Lx0 LH=/1Y IHt(HHLyܰհH͖ H1H@]A\A]AUH5ATIUH@Hl$H?HJI|$(IHHHqLxyUI|$tA H5OHxjI|$IHtXHH(Lx0 LH=/1X IHt(HHLyܯկH͕ H1H@]A\A]UH5>#HHHT$nu HBHD$HD$H]AUATUHHHuLeHmIL$u'HֹH=VRuHEA|$ y} x#LuHuAD$ @t DU A@uH !"H5ՔH9GA HMM\$Hu0uHuHI|$0 uI|$HL!LT\u8HH\u,HuL !"1HQLFI9H5L |I1LL;|$$~#H=""H5H?L=Ld$P1HL;u L=m|$t~(H`""H5iH:La=LY=>HL$`HT$Ht$PH<$ L5=L-=HĠHc]A\A]IHĠ1]A\A]AVIAUIATIUHAQ@x2L4x&L(xAXLLLH]A\A]A^ MZ1]A\A]A^ATIHUSHHuAtHHCH;!"uCTf.v8 H;k "u-Hr%H5r%HH=HH蜬HtHLH虑HA~D[]A\AVH5""AUATIUHSH9FLnH1H5L5"UuHuItHxHL9|HLH‡uItHH5H複&HH5 H腇u[]A\A]A^[]A\A]A^AWAVAUIATUSHXL|$L:D$LHD$@HuLAjHHuGHHE1H$L94$~JtLT$ {T$ Au LSI΄u4HH5˔LĆAăt'HLDAHLAHͪHXD[]A\A]A^A_AUATIUt}t]A\A]H~Hqp%HH5np%IHtiHBp%H5Cp%HHLHLHt?LHLHA1+Hv]A\A]uH"H5ȐH:AD]A\A]ATUHSH~HHH5o%1HIA踕H5HHHHDHZu L莩HL莎Lu rhS H{uTrt"st&at*H "H5H9oH5XH5RH5CHH̄uDH5ɵH貄t,HsH"t[HH]H5A\還[]A\HAWAVL5AUE1ATUHSHHHH$L;,$|1NdHH5HA|$HEHuI4$1HtHH5HtIt$HtIL$HtIH1E1Ht$L9|$~7HLH蠃tI|$JtHUkII$H[]A\A]A^A_1UHHSHH5aAPDt;HsHt&HsHtYH[HH5]Z[]UHSHQH6=u;1H{t2HH5HȂtHsHZ[]USHHHuH;Ht$ Pu$HֹH=IunH{Ht$HL"WtP~t$|$ HwHHu;tHS"H8{X 6HuHH[]cH1[]IMQL;"uMIL;-"u Iy " QH5"Lt IAHIBZAWIAVIAUATIUSHpH[HE1LL$ M9~4KoHHuH _"H9T H1] H1]ATUSHHHuH H; V"u$zHֹH=pYEuHAt*Ht$HHHH"sH;D$t%vHjMH5ElH=O11HKHQuHcH5lH=1uHt$H*IHt%HrH;D$tH "H5ZMH917H{0AtLHDzy1H HtH[]A\ATIUHHuI $H; "u'HֹH=/DuHAtuHHHHuE1H lH;$tH "H5FE1H9\}I|$HD$uLE1 H5H8)xH;="t Ht$E1t t^H|$sJH1HTgLl$IHuMtLH "H:;L 1H{ IMtLHL]A\A]AUATIUHS1H(HtHYHD$HuM~ IHu9PHA1L6"LHD$PjjTH HHuE1H}Ht$s tLHtH}Au1HtAHT$HZ GHDImLGuH  "H9*K I HcIH|$HtۘH(L[]A\A]AUH5WATUHHHfHnfH:"HpH="HD$HLd$ H|$0HD$P)D$ L$8L$XuH~ HHu7PHA1LD$APL"jjH HHuE1H}Lp tH}Ht$ H"Ʌt0pl$ |$HIʼnt hH H|$@dvHHu6AMt uH5 "H>I H|$X~HZHILr} HpL]A\A]AUHHHATHfHnWUfH:"H`HHD$ Hl$D$8HD$@)D$L$(L$HuH~ HHu1PA1LD$APL"jj視H HHuE1UH?H*o tDH|$0IDpLAiEEyH "Ht$HH90w I L- "IEHh| H`L]A\A]AWAVAUATIUHS1HHtHYHʭHWHfHnL$HLl$0fH:"L$hHD$@D$XHD$`HD$D$)D$0uM~ IHu9PHA1L"Ht$VLjjsH HHuE1H}Lm tLIItYH}Ht$fAăt HIu>>HtAH}HHt$ltIAD|$Lt$BAH|$PHtHLDDc LDiHCt,m8u[`tH "H9F I(L% "I$H}Ht$CX fLnz HĈL[]A\A]A^A_AVAUATIUHS1HpHtHYHӫHWHfHnL$8Ll$ fH:"L$XHD$0D$HHD$PD$)D$ uM~ IHu9PHA1L"Ht$VLjjH HHuE1H}Lk tLHt2H}HpAăt HGHtA\$1AH|$@ItHDl DKoLAtHk8u^tRL% "I$5H "H9 E I!AH}Ht$V nLx HpL[]A\A]A^AUATE1UHSHHxHtLaHHWHfHnL$8Ll$ fH:"L$XHD$0D$HHD$PD$ )D$ uH~ HHu5PHA1L"Ht$VHjj‘H HHu1=H}LFj tIIut$ LHH}Ht$ kU uLw HxH[]A\A]ATUSHHHt$k AątAHl$HEL`L.HHtLHu HA=E1H2HD[]A\HAWAVAUIATUSQHHxH9wHHE1ÓIHuE1aܐAH McI9}3IuLHnhLUHHt$HK4Hu蝐 IL;LLE1ZL[]A\A]A^A_ATIHHD$HuI<$Ht$j u$HֹH=ߧ|3uE1HI|$Ht$3;H|$tt$H nYuH"H8B I L%"I$H|$Ht̏HLA\AWAVAUIATUSHXHFH<$u%HH QH5`E1H=> F~ yL k IHu+HE15u1Ht$H  =FIs^IHuA1LHAHHuHD$HݸLH|$Ht$ LHLD$it.HD$"uH?I9 MH1LD$ d=L|$L$ Mu(u}3H="LH5u1H? \H<$L_IE11H@LM5HXL[]A\A]A^A_AUIATAUHi Ht.1Ht$HH tH|$L_AHٍHD]A\A]AUAATUHSAP *IHtDHHLH蘍IZL[]A\A]11UHHH H]HAUAATUHSAP)IHtDHHLH/IZL[]A\A]11xUSHHH1HT$H5"k u1H|$H1HHu*XH|$H5pMHHtHp H@H${H$H H$dHtHH<$Hu uH"HfH[]UHSHQ蕿tvH{HHt HCH*H{`Ht HC`1HKPHSHHLK`LCXH5buHC`HCHHCHHS`H1HZ[]S1HHH5xHHT$ xA1EtD$ C0H"HH[S1HHH5DBt Hc{0[1[S1HHH5HHT$ A1EtD$ C(HZ"HH[S1HHH5ޢt Hc{([.1[UH1H5ĢHHT$ D$ A1EtA|$ t!8H aHw9 faH"HH]HHH5[1HT$ <u1D|$ 蛋tH=!%Hu H\!HHcD$ HiHHHc@&HUH1H5HHD$HT$A1EH|$yH"!H5cqH:苪1_kjH|$Hu!H !HT$H51H9SW1'uH!H54qH841HcH]HHH5l1HT$ D$ A1Et1|$ FtHj!H5wH8ө1 H8"HHH8HH51HL$HT$ tBHt$H|$x/H|$Ht$ kt|$ NctH!H8: 1 H!HH8ATH1HZJ$SH5HHLD$HD$(t'H<$11躪IHu/I|$0t,L-E1L{HHtHH9\$HL[A\ATH1HI$SH5 HHLD$HD$t%H<$1DIHu/I|$0t,L襇E1LDHHt苇HH9\$HL[A\QH!HH81HrLHHH5i A1Et H\!HZUH1HH W"HJHLL$ LD$D$ bt4Hg!H8H}gp uH=!HnH7H 1i|$t@Ht$-u|$jx؋L$tH5!HnH1H6!1 Hc=!T$L$ ! !}HĠ]SH1HH "HdHILD$HD$H${H<$H(!Hu H|$Hu.[3 L]Z[]A\A]AWIWAVAUATUHSLHHHBXHJ`HRhH|$Ht$HD$8HL$0HT$(HEhEXHuH5!HHt$0HL$(HT$0HHt$8nLd$(LMuH !Ll$0Lt$81LL袛IHt:PLHAASHt$ IH|$L\$(dH|$(A7ZYEuHHLLL[H]A\A]A^A_!OMtLMtLMtHHL[]A\A]A^A_HH[]A\A]A^A_Qw HtH>{1ZHXHt H5B PH!H5H8;1ZQAHtHdz1ZAUL-!ATIUHGHL9t H;!u&I|$vuE1jMd$I<$L%:!HUL9t H;R!uH}?tHmH}H- !I$HLHELI~H~L]A\A]AUIATUHSAPIHtLHHLHv~IZL[]A\A]HGt Ht1鏠PI1ZAVfHnfHnAUfH:"fH:"E1ATUHSHH0H!)$)L$L8LNHwI9tII`HtE1HH9QXAH~`HLL9GXEtZL.tNL5 #HLLEv1t-($LHT$ L)T$ H;!Hur_}E1(\$LHT$ H5#)\$ H;W!Hu@HuH9st6#}Et"($$LHT$ H5k#)d$ qH H=!HH0H[]A\A]A^AVfHnfHnAUfH:"fH:"E1ATUHSHH0H.!)$)L$L8LNHwI9tII`HtE1HH9Q`AH~`HLL9G`EtZLˉtNL5#HLLt1t-($LHT$ L)T$ }H;&!Hur{E1(\$LHT$ H5U#)\$ KH;!Hu@HuH9st6{Et"($$LHT$ H5(#)d$ H H=!HH0H[]A\A]A^HH!H5RH:1OtH!H5_H81/H8Hu H[!HH5g%HT$tHD$HQ A1Eu H!HZSH A1EuH;i!H!tH[AWIAVAUATUHSHHXHHHLt$HHT$HD$HLbLd$HMu!L5!H5WcAI>=L-mcLHt$@LL]D$D$HD$HLzHLHLd$HMtL;% !uHD$HLyHD$8FL&LHt$8LD$T$]HD$HLxyHLHfALd$HMu!L=u!H5bAI?LHt$4LD$mL$HD$HLxHLHLD$HMu!L!H5.bAI;pLLD$jH|$Ht$0GAEJHD$HH|$cxH8LHQ,Ht$HHtH;5h!uHD$HH%xD$,TLHt$~LL$Ht$,LLL$D$F|$HD$HH|$wH0LHHl$HHtH;-!uHwD$(,LuPHt$(H/u8H\wPAWDL$8DD$軕L=_LWHT$8LLHD$#D$]HD$HLtHLHALd$HMu!L!H5^AI;&LHt$4LD$T$HD$HLtHLH LD$HMu!L!H5^AI:螔LLD$<jH|$Ht$0uA EJHD$HH|$sH8LH,HL$HHtH; !uHD$HHSsD$,TLHL$LL$Ht$,LLL$D$tt$HD$HH|$rH0LHHl$HHtH;-!uHrD$(,LuPHt$(H]u8HrPAVH|$PDL$8DD$MLLD$pH|$Ht$($AEPHD$HH|$@oH8LH.2H|$HHtH;=E!uHD$HoD$$VH|$L^LL$Ht$$LLL$D$&DT$EHD$HH|$nH0LHHl$HHtH;-!uHpnD$ ,LuWHt$ H u?H:nAWD\$(ASDL$4DD$8L$PHD$xIH=G'HT$xLLHAdEHD$hLOHHHT$hL֥Lt$hMtL;5!uHD$hLOHD$pDH=(GHt$pLL諶tHD$hL[Ofn\$\fnd$d8Lf:"\$Xf:"d$`~l$xfH:"l$pfl)d$ )l$(t$(|$ HHt$px(HAHLUHHT$hL谤L|$hMu!H=!H5HFAH?BoIu%[uH !H5EFH1H9SMwLL H;HD$1Dd$ IL9MOH=0FI,HEsHT$xLHLD$0?HMDT$0EM9wtH!H5EH:mnL\$xHD$L\HmLHl$Dd$ HD$hvMfnL$\8Lf:"L$XfnD$df:"D$`fl)D$(T$HuLl$IE3LD$HhP(I0H=4!LH5E1H?H|$hHtLAHĈD[]A\A]A^A_VH!H5i#H:qm/tH!H5rH8SmH H5!Y`1ZÃ3QH!LtH5Lm!H5"LmHH5!1ZATUHSHuHd!H5"H:l@HIHHuHQ!H3H8lLH HHKHH[]A\UH-!1SHVHHyH;!uHKH{HY1[]WZ[]ATI1UH-c!HH(HHD$+HuHT$Ht$H|$9H7KI|$1HH|$IHtHT$Ht$L] Mt LE1JH(L]A\H1H5!H1H5!H1H5!HHH5]!yHHH5:!fHHH5!SHHH5!@HHH5!-HHH5n!US HHtCHxHt xH} Ht y H1 JHJH-,!HEH]U HHt1HxHtw y H1IHIH-!HEH]AVAUATSQ IHtOHx HX( I|$II|$IILLHH=b1LHNIIZL[A\A]A^AUATIH5#U HHt H@ u#H 7!H5xc1AH9HtdZML-#tLLHA A;LHYWuH!H51AH:iLH蜔 AHHD]A\A]H1MZQ跦 HtHC1ZAWIAVAUIH=ATU HHH5`Hd HIHM JIHuE11H@WLH@& IHHLJ HHtvH5n`H I$Ht^LbJID$HHu耾BM|$LLID$Ht&LZGMtLMGHtH@G1LE1"E1]LA\A]A^A_1AWAVAUIATUHH=ɖ\ HH5_HI! IHu IE116H?IHtH1L1蟘 IHHt HˣILFMtLFMtLvFHtHiF]LA\A]A^A_ATH5+_E1UHQHBuMHH5n Al HHt/H@tH5^HE1AHEADZ]A\AWIAVAUATUSHHHBHt$HL$(Hu#H!HH5d>H81jIH\$(HHSt LkH AH\$(L9t5LL!LN^HB^IMH5@^1I8I|HL$E1HyH|$GIHZL;d$OHt$NtI~t#1L9} L;tt HHL4IMNAtIHT$8H5.#LwLT$8MMZAMBMt}HELLD$ HD$PFH|$8HIt Ht$ E1#DD`H;TtsHH9L$HKTIL9~ JT1LLLL$ؓH|$ICIH|$8HtCMu LE1COtIHHHL[]A\A]A^A_AWAVAUATIUSH(LoLEHD$H_L1L|$E1L9$MLIyLL$LT$yH|$1H[H6H!LtH5LL_19H51L9_1&HGHt$1H=$HHD$/HAVH#AUATUHSHH9GuHHuHuHVHv5H=dۘuH=d<H}LuA Lm ~=H}(6ZHHu詊IHtHӚHI=ItH-#!LH@ HtpHL Ht`LL5z>L1LH=# HCHt9LLL1H=r#m E1HCHuH{Ht HC =A[D]A\A]A^HuHZ!H9GuH5H# AWAVAUATE1UHSH8Ht$腄H$HHxHH9v 萳E1HO?IHtHߡ IHH`IHIVtHHt Ld$1$LM!H5411I: Q<H;,$ HLHLHIHHHt$(H# Ht$ L H\$(u H;H{L|$ tH{!=Ht+L !H5I9#\H[;LS;IW Hs 1H=ET8oHHD$+;L#;H|$Ht]Ht$H}HD$H|$:6L:L:H\$IH++1LHE11L:MtL:H8L[]A\A]A^A_ATUSHH!S IHtXH;HtSZ3HHt.HLxtHHE:HLyL,:HtH:E1L[]A\USHQHHtQH{(Hu H !!H` HHu H19#HSHH=R1^HH9HHZ[]USHQHHHouHPtgHt H_ H*HHHSHHtH5n#HF2 xHSPHt/H5B#H*2 yH1,9OHuH-N!HEH;-C!HSHsu1-THH1THHH8HZ[]ATIUHH5#QHJ|uLHHLHJ u L%!I$BHp0HuH5!Hx1L1^ IHtHH{V t LE1L8LZ]A\UH1HH !HAQHHl$LL$HD$ID$vltEH Ņx7 HHt*|$t'1H‰_HHtH!H8}X1RHuHͮ!HH]AWE1AVAUATUHHHSHHHtLyIHu HxHu,PE1L2!1HD$ Pjj7H HHMHW!tOL/MtIuQILgMtIuLILwMtItFLOMt IIu9ILW 0IIE1IIIIE1IIIE1IIL}xMMt%I9uE1I9tJH=/ٔ1I9t2t.LLT$L $x IHtH L $LT$xuXLLT$uYH|$$4$D$ t$xH=e$Ht$1HHl$HHe5HDžMuI9uILH y5I9uMuL$1$HfEXHLm(I9u#LeHI9uH=O!IHLv IHLb H5^H# IHLHH t L 51QLLH+ uL4IEH}(I$Lm(4H}HLeH4HE ?HH[]A\A]A^A_HH !H5A H9IU1DtH!H5ZH:)U1$HG Ht$HH=!HD$1 HHH s!H5 H9T1DtHS!H5ZH:T1$HG Ht$HH=N!HD$ HHH !H5g H9oT1DtH!H5YH:OT1$HG Ht$HH=!HD$W HHH !H5 H9T1DtHy!H5BYH:S1$HG Ht$HH=!HD$ HATSHHfHnIfH:"Ht7H="H)$H HHu LE122HL[A\fHnfH:"Ht8HH=ԁ"HH)$N HǃHtN21HÃATUQHuA&I+HHtLHHA2DZ]A\AWWAVAUATIHUSHHHb!HL$Lt$'L8M}hIEhLIUXIM`AEXHT$HL$ HL$HLHžHL>tLŢ LLv+HH-JH tL HHT$Ht$LL2H[]A\A]A^A_HIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H5é!HT$ H$D$HT$HL$LH="H6D$ 0HD$gHHIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H5(!HT$ H$D$HT$HL$LH=~"H6D$ 0HD$HATUHSH HT$Ht$D (H|$H^H!H8 1H=( 1 HT$Ht$H|$*D#H 1[]A\HuH=1AW1L=lHAVL5AUL-SHATL%GHUH-!SHHQ3ta'uH=H1|FF^w L1h2w L1Tv L1@ L14HZH[1]A\A]A^A_AWWAVAUIHATIUSHHݤ!HL$H8H]hHEhHLuXL}`EXA Ht$LH$ Ht;H4$HI|t HP L| HHtLL-HHLL[H]A\A]A^A_HIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H5t!HT$ H$D$HT$HL$LH=C|"H6D$ 0HD$HHIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H5٤!HT$ H$D$HT$HL$LH={"H6D$ 0HD$HHHHGH=#Ht$HD$3 HATUHHHGH;!t H;x!u"H}E1btAHmH}H-,!HEHt$H=l"HHl$ HI+HL]A\ATUHHHGH;-!t H;!u"H}E1tAHmH}H-!HEHt$H="HHl$L HIQ+HL]A\AWIAVAUATUSHHXHH5!nH{nHCIyHD$'Q IH,1dHHu L*HD$ HT$8HD$(HD$0HT$LD$H|$HL$(HT$ Ht$0ܯLt$ L|$(LH\$8ILIHqnIHuDwHt9HLHGtHLLߢyH1LL4EHHHHD$mH|$y ))L)MtL)L)Ht$@H="HHD$(HD$ Ll$@o IHt1HH l y LE1])LS)LK)E1L;)H3)H|$ Ht$)MtL)H|$(HuILLfHnHfH:"Ht9H="Ht$@)D$@H HHu H(1(HXH[]A\A]A^A_AWAVAUIATUHSAQLOL=!LL luH5I!LkuIIE1HtHXHT!H9Uu/HmH9|"AXL[H1]H5F"A\1A]A^A_GZLULLkuH5ՠ!LktHM1HtHqH9}I1SIHH迬IHtlI}LL=I@4kH=LDLHHt*HLAׅx1ҹHH=6b/uI<$=CIHu6sHHt$H=K!Ll$H IH跃LH|&HtHxH1wyHHt\H5p$1HL1ɇ H;r!It^HtYHy!LH0ALI&IusHt H&E1'H}tH}(H=!LIH%HL]A\A]SH1H5?H HL$HT$D$ LD$ mu1FHL$ xH|$Ht$xHHtk%H)H*^ RoH [VHH!H5H:E1BItHc!H5H8E1"HPHu H(!H H54$YZHHt H5T$ϱPH!H5hH8xE1ZATIUHSHHHw M~"Hm#1ҹLH=Eu=H-!{8H5!{H>tH5E1 E&H5DE1H{8u{ u"0{,t HCxx>G0It 1< @$H1LHcu jHuYù1ZH= %SHtH{H5 %[逪H=H %Hu[AVAUIATUHAQLwMMtLLgIHu9Ly?H@HHtHUHAXL]A\A]A^I$H}LY]A\A]A^ZL]A\A]A^ATSHH=\u"Hc IHuiHuKH= Ht:IfInHHfH:"H=t")$d LHiIHL[A\AUH!ATL%I!UHLH;!yrH!L-!LHu!xLxLxLH5U@HH@!k xLH5K@HHÛ!N ]A\A]UH5/H yH55Hp xH54HX xȺH54H@ xH54H( x H54H x@H54H dH54H HH54H ,H54H 1H54H H5u4Ho H5d4HS H53H7 H584H H5,4H kH53H OH54H 3 H53H H53H ]AWAVAUATUSQ:Hn I)HHC H!H8HtIIHu" L-u!IEHLH5s3 L%yH1 H!Hc:3[IH HHH5 LAExH ^!H9HtIHu L-ݏ!IEHLH5G LdHc=$ZIHC HHH5  LAPE&H5!Hc>hZIH HHH5{2 LH=Ɍ!Hc?)ZIHHHH5H2 LAELx!Ic8YIHHHH52J LgL i!Ic9YIHCHHH51  LAPE&L(!Ic:hYIHHHH51 LL!Ic;)YIHHHH51 LAEH؉!Hc8XIHHHH5R1J LgH!Hc:XIHCHHH5#1  LAPE&H !Hc9hXIHHHH50 LH5!Hc>)XIHHHH50 LAEH=!Hc?WIHHHH50J LgL!!Ic8WIHCHHH5l0  LAPE&L @!Ic9hWIHHHH5D0 LL!Ic:)WIHHHH50 LAELP!Ic;VIHHHH5/J LgH!Hc8VIHCHHH5/  LAPE&HH5/L H%H-!H8LrI^HHHcP"VIHuH1HHH5y LAExHcTUIHtHHH5qC LAExHcXUIHtHHH5  LARE_Hc\mUIHGHHH5 LAE!Hc`/UIH HHH5p. LAEHcdTIHHHH5C.S LAEHchTIHHHH5. LAZEgHcluTIHOHHH5- LAE)Hcp7TIHHHH5Y LAEHctSIHHHH5z-[ LHH5c-L7 WHwI HH5HH5--L H=HHL=!I?Ht HdIHuH1L-&!IEHLH5, LAExIHtHHHu H݇!HHHH5"H HAExIHtH¬HHuYH!HHHH5 HA>E)IHtHsIHu L-?!IEHLH5+ LI HtH%IHuL-!IEHLH5|[ LAEI(HtHիIHulL=!IHLH5T  LR>HH5D+L x H,1L HtHE1ZL[]A\A]A^A_USHHHu,H HAu;HRH5^H=*h4HֹH=*uHt$HZHHu1CHH;D$tH!H5H:)/1HsH uH~!HH[]1 Pt$PD$PPt$Pt$Pt$Pt$Pt$Pt$Pt$PAQEAȉщ1DHXAWH$AVAUATUSHH9FtH !H5FE1H9.H!LnH!L9*H=$!Lv L~(Hn0s IHtH9uEH9u HEI_H5)Hk IHuE1@H9uHI H+HLH=[)y H$H9u H<$Hu/HH5!HbyQL s H<$yB5 H=H1芵 HHt)HǺLr Hy As $LH=(y xLH=x xLLLL4Ht$Ld$H=!H- HHt0 E1L% AHIHL[]A\A]A^A_AVIAUATIH5!UHAQH2HHp UHtlH=z!IHHtULtCu%HEH=!LH5HPH?1AAXLLLH]A\A]A^ePZ]A\A]A^ATH=K! IHty LE1* LA\ATIHULQH!H8f HuE101HI)LH HtHd HI LZ]A\AWAVIHAUIATIUSHH!!HL$L8Lm? HHMuMfhIWH5Hxh HHu H1O [PMLHjLL$H5c"1H[<HI ZYMtL LHLL@@ IHL HH[]A\A]A^A_AWIAVAUATIUHSHHtzIHtH_ HHuqE1E1/MtLB IHtMHLLLILILh HtH[ MLJ E1I1MuH!H8HJHuH5AH=LwHxH54g fHnIfH:"Hu kLH=a"H)$H LHHtIHL[]A\A]A^A_111QHGu"L JqAH 1HW Љ``uQt"L qAH ُ1Hp$L pA H 1Hc$ HLWHv't"L pAH s1Hw@t"L pAH L1H$Px"L [pAH &1H#*L9W8rL /pAH 1H#LWHCHt"L oAH Ŏ1H#Ht"L oAH 1H#@t"L oA H u1HA#yy"L oA!H O1Hn#St"L ]oA"H (1H_#,H(u"L 4oA#H 1HQ#Mt"L oA$H ؍1HE#H8L nA%H 1H,#D@Av't"L nA(H z1H~x"L nA,H T1H"XMu"L bnA-H -1H"1LO8@tSM9t"L 2nA/H 1H"L_L9_0tQL nA0H ь1HXM9u*L mA3H 1H!LG(uSM9t"L mA?H r1H:"vLOL9O@tIL {mA@H F1HJM9u"L TmABH 1H!#H8u)H0t"L $mAFH 1H!H(u)H@t"L lAHH 1H! tHwH@t Hw0HwHLGE11I9~(uDuDNDE9EBHӃ@uWAw"L `lA[H +1HO!/AL 1lA\H 1H/!AL lA_H Њ1H!uZAw"L kAbH 1H AL kAcH q1H uAw"L {kAfH F1H JAv5L PkAgH 1H B<t5fBA1LH LH HoH9Hy%L A1LH H HG HxL9~%L ؞A1LH HT HL9~%L A1LH H' Hu+H?t%L {A1LH H I~&I~I9@@H,I1I9~:QH|I9}%L A 1LH H_{ HL/1L9Ih0HHs!H9EuZHMHu%L A1LH H> I9H(tQL wA1LH H Ix(u%L KA1LH YH Hu1Ix8uVL A1LH (Ha Ht,Ix8t%L A$1LH HPe HIHt6M9~1J<u%L A+1LH H.# I[]A\ATAUHQ{t%L A*1HH HH}%L tA+1HH HH}HEHs DHBs DHZ]A\AUATPD$ u |$8u1Ht!Ll$0Ld$(H:PLLAH=qUH H(tG=H}Ht HE!H}Ht HE H} Ht HE HEH]H@H; USH(HoG HUuLq!H51I8mKHHtzl~H=cm!C 1H?} M}ht>HoH5q!G H>HuH5 H51}dtH m!G 1H9s}H;57r!tH.q!H5g1H;G HEhHu1H5 s!HE11EdH1HHHD$H58_HD$P1HL$QLL$LD$(腛ZYLD$HL$H1HT$袯H{HJHHr11HL H{HtH{H(H[]JHtELp!L9]HHSHp!H5 BhH8C z1YH{Lk!GhI8C tHkHuLLk!I:{L q!I9uH(H[]H5|p!lATSAP uL eo!H5E1I9HHH{ItH{HY[A\IHtCH o!I9D$u5H{GhLE1C Ln!H5 I8rzH p!H9uLZ[A\S uHn!H5H81$HHH{HHHuC [HPHn!H8HzHǠ H&o!HZQHin!IHLH8Ay1H=Z XQH7n!IHLH826y1H=Zߟ XHHu H=FjATSHQH`IHt|H{HHsPHSXH;w}HHFH9u?4H=3=v=H=VHHCHSPL1͟ HHLH=1负 HLILZ[A\HGHxu HxzU HG@Ht Hk!H9Pt: HHAVAUATUHH(Hk!H8u=Hk!H:u*H h!H9uH5i!H>HT$Ht$H|$Lt$L>IHu1YL;m!1HH=+1HIHtH¿1L LHMtH=lj!HH?b H|$HtMtLH|$HtMtLHtH(H]A\A]A^iH(]A\A]A^AUATUHSHQHאuCH;zHHt3H{IHt'HLxLI MyH1HAHuHl!HZ[]A\A]UHSQHFt H~H+HuL g!HH1HVI9H5tW1H8臐WHsHEHH[H{ HWu HRH5W^hQHu"AHuZH=if!H5jH?BHxHs(H0k!HEH9tHHN u HQH5WLg!1I81!H}(Ht  y HHu(HHZ[]H(D$HBHD$HWuH f!H5 H9-1HWHHwLD$AWH(1(AUIATIUHxLLH]A\A]x ]1A\A]AUIATUHSAPMIHtLHHG LHIZL[]A\A]ATUHSҒIHtHHLHIL[]A\ATIUS}HHt=LmIHu H1k!HHLHSHHHH[]A\AWIAVAUATUSHHHh!H4$L8H[j!:u1H=KHHt8tH5Hu XH- HUIHuL1h=.HjIHuH=tTLHI9HLL)GMIvHHtuHHt$nHISMHt$u%H=b!H7Lwb uyL1艣L\O LHHu H eh!LH1:b u<HuIt$H|$HL$`HT$XtgIt$ H|$HL$pHT$hu HD$PD$H$u5|$t.H$u#L@Y!LH5N1I;褴E1$LK u㋴$LV u΃AMLDEH$MLD]!H58H=bix`ۋ\$PIƒuBtBH$1҅ud$Xl$hHT$0)d$0)l$@Au|$t=H$1uDT$XD\$hHT$0D)T$0D)\$@蚼Ao$t-1uDD$XDL$hHt$0D)D$0D)L$@!A6H$1҅ut$X|$hHT$0)t$0)|$@1ɿ)AL.EyH5RW!E1H>w 8L%n\!I$+Ht$ BHL HL[]A\A]A^A_AWHAVAUATL%USHHL$LDHIHt$8H5HT$L|$,LD$ HtSH|$L HD$PH$LL%V!1E1H5eI<$"lH|$ sAu#LH5EH fW!1E1H9;H|$Ht$PRIH H:u HJV!LH5(H81讱H|$ Ht$HHD$HHH;-Z!1߬H$HH5HQIH»H|$`E1L$0H:t]H]U!H:腕 LMRD$0L$DHW H|$`t$@ZH$;HIIt$HM;l$Ht MD$K,KlLMHEAtH}uH U!H5.H9f`H}xHu}/H>Ht{HHHL$@HT$XAVHL(W!H51LT$LARL$3_ZYH<$H$@H$1HT$XLHH5^$0H|$`\G1H$MHHT$XH5^tZ$0$H|$`gLrS!I;蚓 'HT!H5H8LLd$`C*L9H1H|$`至,H$E1RH$0H貽EtLR!I; H$t@H$诃tH$0wEt-Ht1ۃ$tH$tˀH$t?L$H$LAH$0LH`EH$L$0t:L$H$LuLLHCEH$H$1H$HT$XH5;\H$H|$8HT$DHT$0[t{H|$XH;=V!L$0t-s ƃtLH Et5B,Ht8Ht$0LH蚫EuLyEt!LQ!I:C H$0Ht$LD$ 11HL$H=HV8H5SǁxeH|$|$,MLLL$LHw H$t蘷QtLD$L P!E1Ip8I90 Hc$ HMH$0t L蹰HtYH,O11MuH|$Ht$HpTLMMt4H$LE1Ht$PKTH<$tH<$ IE1HĈL[]A\A]A^A_AWAVIAUIATUS1HH|$HtHYHHCWHfHnL$8Hl$ fH:"L$XHD$0D$HHD$P)D$ uI~ IMu9PLA1L!Ht$xVLjjH IHuE1cI>H耵 tI~MFJ +IH|$LD$IMnMt HII^ Ht II~(Ht&Aăt Iu)HtoE1I~0Ht"ƃtIuz^)HtA1M^8MtItfMV@MtE1It[MNHUE1E1E11E11E1@E1E1E11E11.E1E1E11E1E1E1E11E1E1E1E1E1AQHMARASVATSLD$@HL$8Ht$HH0IH HL[]A\A]A^A_AWAVIAUIATUS1HH|$HtHYHH@WHfHnL$8Hl$ fH:"L$XHD$0D$HHD$P)D$ uI~ IMu9PLA1L`!Ht$xVLjjH IHuE1`I>H? tI~MFJ +IH|$LD$IMnMt HII^ Ht II~(Ht&rAăt IuK'HtoE1I~0Ht"@ƃtIuz'HtA1M^8MtItfMV@MtE1It[MNHUE1E1E11E11E1@E1E1E11E11.E1E1E11E1E1E1E11E1E1E1E1E1AQHM1ARASVATSLD$@HL$8Ht$HH0IHr HL[]A\A]A^A_AVH1H=sAUATUSHH5$*|x[11L5TVIHuAHH9k~;LlLְtIEHHtLLLЅtLE1[L]A\A]A^AWH1H=AVAUATUHH5SH{1ġIHtyHO!L=KH8LrIIHL$L+I9tJIuMuHL9tM9uMmHLLЅtLL6yLE1 HH9\$uHL[]A\A]A^A_AVAUIATAUSb HH N!HHA1H5gH=Hzy Hѯ8u/'u:nLI1?LA4Ex"HVI!1HH8 HA=.H31DH P!d y DA蝢[D]A\A]A^ATUHSHt2Aa HHup1DH^HHHH[]A\AWAWAVIAUAATAUSDH(HM!H8HUXHM`HEXHuhHEhHT$HT$HL$HL$Ht$Ht$IcwH$HHu11H?,H|$H512"%t111HH<$H$ExIcH$Hu111HH$HuHL!Ld$H51"LQ%t111H诤H<$HtH$ExIcH$Hu111HuH$HuHL!H5>1"L$t111HDH<$Ht&H$xHcBH$Hu111H H$HuHL!H50"L|$t111HڣH<$HtH$MtwLH5u0"L=$t111H蛣1DLN\H$HHt,H5+0"L$t111HaH<$H111HHH=H!Ll$L;/IL=/"LLL)xEH<$Hu5LH$HHt(LL#t111HݢH<$111HĢHM/"LLHo)x&H<$Ht$HJ!HL#t111HwHL$LLHdH([]A\A]A^A_AVAUAATAUHQHI!L8Ht] HHu111LADDDH6HtZH]A\A]A^X]A\A]A^ÃAUHH5cSHQHGPLt!H5stH5H HEH="G!H?2DE,U$M(u H;E@KH1Z[]AVAUIATIUS1ID$8H9X~eHHLH,H} uHH}8tH}0ItH}(ItH} HtI|$pSDEFH?HHG!H5H:x[1]A\A]A^AVAUATIUHH=.SHH5?HP Lt$PH$P fInfH:"1)$OtxZ1H|$( $Ll$H\$LLt$8l$HL$('l u"LLkH|$@Ht LkAHP []A\A]A^AUHBATIUHSHHwLmH]I~>"LH=suE1^H}ƃu {HuL~j fHnHfH:"HtH=%"H)$H= HIBHL[]A\A]AVH=zIAUIATUHS'd IHuH8F!H5GH8DHH5]1H=Brx%I$LLLH LHIE1[L]A\A]A^AUATUSQHoHuH=B!H5 H?>HFHu$H B!HPH51H9 L-kIIH1LH5^H=[ rxIH5B!Ht H~u/u tH B!H51H:萜6LHHttHI\$1tHZ[]A\A]ATUHSHtaH;5E!HtUHF uHA!H5AH: mIHH 1H5iH=fqyBAA1H HH5{H="px1H}@E1H]@Ht HD[]A\ATIUHSHDD!{ u Hxt911H=py{ tH@!H5H8@Lx1H[]A\ATUHQHu-HMHAu;Hy{H5ėH=XHֹH=cpu9HU H}IŃt"1H5iLH=boy1KHtLzAątH>!D H:~ 13uHC!HZ]A\ATSHHB!D$ H8HH(H9JtH=B!H5H?1x1H=1oA1Ex^P H|$ 111ИÅu~ uH5=!H>~ !Dd$ Hc H=xHD1W H[A\AWH'1AVE1AUL-YATfInUfH:"HSHHHtLqWH)D$@Ld$@HD$hHD$pHT$PD$ L$XL$xuH~ HHu8PHA1L!Ht$ VHjjH HHu1H}L\ tH}Ht$ttH}Ht$utIIu0H}HuH} bÅyHt$ P tIuɋl$ T$hLD|$Dt$ at$hL KAEDDEHT$xH5H=mx|$hIŃtDD[WH|$`AuEtDD3uEtEHDDA DD貣LhxtH ;!Ht$xH90 H H-@!HELh HĘH[]A\A]A^A_AWH.AVAUE1ATL%UfInfInHSHHyfH:"fH:"HHtLiWH)L$0Lt$0H5tT$HL$DŽ$H$HDŽ$HD$@D$XHD$`)$$$T$huH~ HHu5PAL!1HH|$ WHjj!H HHPH}L襠 <H}L葠 (IItH}Ņy $LHD$} HL$h1H$H5H=ojL-I]HH1]wHD$IHHH HL$^uHt$PHT$$H$x H-H$HمtPH<$HD$uLD$My+LI G8"ZH$H1L9t H|$LHl$Lά LƬ HH[]A\A]A^A_AWH,IAVAUIATUHHvSH8~1*!~ )*!HD$fH:"fH:"Ht HIHL$W1HML$DŽ$L$L)L$@L|$@T$XH$HDŽ$HD$PD$hHD$p)$$$T$xuH~ HMu4WALLL!1Ht$ VHjj[H IHtcI}L tSI}Lӝ tCI}1LRÅu/CLu%IMHqH5H=1Hl$Ht1I}H%Ãt H Ht뽽$H=_ uRH5H=SL$L$H$H$vgY^`gr$Ht$`H$H$IŅx A蜝Hc!H$A؅t 裗HcɓHcLrHtH$1a H-1;!HEL L H$t"LzSI} ŅH8H[]A\A]A^A_AWL=H )AVfInfInAUfH:"ATIHsUfH:"HS1HHtHYWH)D$pLt$pH5)L$ Ll$ DŽ$H$HDŽ$HD$0D$HHD$P$$T$8T$XuI~ IHu8PAL!1LH|$WHjjH HHu1H}L tH}L tLHtH}+Åy뿻$L uHL$XH$H5 H=exp$Ht$@Iąx LcH$t Lc訚LcLpMtH 3!H$H9q H H-8!HEL詧 L衧 HH[]A\A]A^A_AWH&AVAUL-pATfInUfH:"HHS1HhHtHYHWD$8HHD$@HT$ )D$L$(L$HHuHx HHu/PE1L!1H|$WHjjH HHHuA4H}HtHt$- HtH}gAąit$8DL- RHT$HHuH7!1H5PH=YOc$Ll$0MuL-L5oIHuH|$H1HHHu 7m|$8HHIDžx QHLEt ?HՌHLnHy*I8"u HkH|$HE1l1ĈIHt]HIHL9tOA}u?LH)IHtLH)LANEt LE1> I}I1 HLH|$ HhH[]A\A]A^A_AUATUHHSHHuH~ HHu2PHA1LO!HD$Pjj萾H HHH}ÃtH}Ńu y Htcm HuYA1H5H=:Kay6萖8u0u#-l߉I衔LAlEu1H0!H:

f HLh H`H]A\A]AVHWAUATUHHSHkfHnfH:"HĀHHD$XLt$0HT$@HD$`)D$0L$HL$huH~ HHu2PALW!1H|$ WHjj蓳H HHQH}L =LmH]IMHuL&!H5I;0 L裠 HD$HL%!H5I:HVuL S&!H5I9Ht$L!HHH0>uL7%!H5I8oHt$HuIHtZHT$h1ILH5,hH=Ux)|$XLHx貈 H|$PƈH|$hHt$L(Ht$H(LZ H1[]A\A]A^UH1HSHpHHL$LD$ u1OH\$l$1H5lH=DHىTxՉމ蟆uH#!H8 d H)!HH[]ATH1HUHHHL$ LD$ u1PDd$l$ 1H5NH=DiTxD;uH`#!H8c H(!HH]A\AVAUATUSHHHuH;'Ńu0$HֹH=kUTu1HuH{Aău HuH{Ht$WtLt$1DH5 H=MSx^LDILN_yHs"!H8H[]A\A]A^b H'!HH[]A\A]A^AUH1ATUHH5SH=APSx5^HIۅLA^Et-68u {t1 H!!H8Y[]A\A]a H&!HZ[]A\A]USHHHuH;Ńu+HֹH=Ru.hHu$H{Ht$UtHt$H[]H1[]UHHHHuH~ HHu0APAL!1HD$Pjj֮H HHu1>H?Ht$ Ytl$1H5UH=5QxH5!!͢H]AUH1HATUSHHtHAH$H0HuHx HHu,PE1L!HT$R1jj*H HHHu7H $!H$1H5H=L8HImQyH?Hu1#wIHHteH~"L !L1HI0k eHyH=!H&H7LEHHHkH5h(t5(HHHL(u HH9u LLE1HL[]A\A]AWAVAUATUHSHXHt H;= !tHuHFHw6HH=u3H=.PH}AŃuHH} D$uHH}(D$ urHH}0pD$ uSHH}8QD$$u4HzH}@2D$@uH[H]HHSu%HHֵE1H5H=苻(HMPHqHL$u'HL$HE1H5UH=hNL}XIu%LHqE1H5*H=2Le`MD$Au%LH9E1H5H=}HMhLIAu"HlH5E1H=ƌ謺Iy y=HMpLUhLYLT$0Au3HVlH5E1H=iHuy yLupH}xLt$8D$Du!HiukHHHPHD$u'HL$H"E1H5H=׹tHMH~xHHwu%HHH5E1H=蔹1Ht@LInu/LHE1H5H=oUE11E1H|$(HH5H=PDD$HAPDL$4AQDT$8EARD\$,ASD$0PLD$h1HL$`JLH0EHT$(yH=!H5ޱH?h|$yL5c!H5I>F|$ yHA!H5H;$|$ yL-!H5I}LHT$HHD$(HLwIHL|$HMt LYH'HHtuMt L:IIE1MtYt$L$LDQt$Ht$HAWUATt$`t$PSD$DD$tL$pT$\t$XM\HPIE11E1E1E1H|$(MtLݧHtHЧMt LçE1HXL[]A\A]A^A_AUH WATIHHUfHnfH:"HpH=HD$HHl$ H|$0HD$P)D$ L$8L$XuH~ HMu7PLA1LD$APL!jjH IHuE1I<$Hf tI|$Ht$0MtՋ|$HLd$t LIjHT$X1LH5̧H=IxTH|$@LIqLASUEyH w!Ht$XH9 I L-!IEHR HpL]A\A]1AWAVAUATUS1H8HnHtHZHELVHwHt1PLAHL}"HL$Q1jj蹥H IHt2M"H5S!I|$Yu"HVLH5$H=|KE1WMzIW u%LHZE1H5wH=|!H4+H!HHMjMtHHuIMrMt HHuIIj I9t-MEAuL%/!H5XI<$E1I9t5MNAu'L!H5NE1I;rHIIID$PLUHHAuOHt#H9u'L!H5E1I8;*H9L5!H5E1I>H9tvLEL9t&H-!IT$pH51H}qI1MtHI9~CHTHrH;5!t$H=!HV1H5H?qIHE1Hu1LH50H=FL1L?IHI9tIEHx Lh }I9tIMt$8H9tHEIl$HHII95H8L[]A\A]A^A_UIIAIHuLQ!H!DLLH8HHHu11H1]ATSHHLgMuL!H57I8wHFHuH=!H5E1H?IlHHT$1E1H5ntOL$K LcDƒIL$ L;%v!K t"HL$LHm1H5i;!T II$HL[A\ATH%L!H_USHHNH5L!HD1 HHPHu H¡L !H50eI9lRL`HSL9}%L!LH5|71I8BoHz H;Hp LHd[L]A\{[1]A\AU1IATIUHPHHHL.y'誜LE1HMH5rH=e蚰FCHku"LHmME1H5qH=2gLHIH|$tHB0HPL]A\A]AU1IATIUHPHHHL-y'LE1HLH5RqH=VޯCCH该u"LHLE1H5qH=V諯L1HIH|$tH/HPL]A\A]A1Hy1H5W! AWAVAUIATUHSHH(HD$HwH!51ҹHH=ʪBuxH}Ht$UbH57$HT$LH\$DA11L=<Ld$HHuNMLH;]MLHv IHuIq HyH@u)L=!HP1H5I?alL虞IVH~.1HxH9t"HA| tH9H9~ HA| uLHL$KHL$LH5U!L1[ IHup EHpu*L-!HV1H5I}kLߝHpHu Hɝ}H}HH|$H6LD$y L袝H}INIv tLM(L 9!MLLqLUMt L](I L!IC< yHuHtH}(H=!LH|$HHtHHMtLH1H(H[]A\A]A^A_AWAVAUATU1SH1QfHIL5DL-fT! LLH1ю HHuo uH;!u I|$uCH@u*L`H1VHw!H5_H:VH}uH/H=3$L@H+LHHAEFL1LZH[]A\A]A^A_ATWH@H<$H)D$)D$ 9 H|$(AHtH@DA\ATUHHJu H(!H5.H81y:LcHL aHHtIL1L1LB$ H]A\ATWH@H<$H)D$)D$ JH|$(IHtaH@LA\ATWH@H<$1D$)D$)D$ cHD$8IHt$HH|$8I蟚H|$(HtH@LA\AUIATIUHNdHouLl$0IEH=wLHHuHĐL]A\A]DLLHqHHHIrHĐL]A\A]ATIUWHFu!HHK[H5jH=a1O~ yH0!LH8y Hsu1u H!HYLH]A\Z]A\AT1H1SHH5!HHHu IHH@u H M !HPH5 11H9fh1H\$D$H$HD$ HD$HD$(bHD$8HHt$HH|$8H賘H|$(HtLI虘HHL[A\AWMAVMAUAH=ZZATUSHVd IHtS|$Hu Hk !H !PDLAt$HIH1AWH57x"AVP LH IMZL[]A\A]A^A_ATSQIHtH薉 LHۗILZ[A\AVIAUATUHSHHaH}HAbHuH !11H:@HHH~Hp1DFsHtH=MYc IHu15h !ALDHo!L zHH5:#PP1AVO H LIMtLH5##LIMtH L HtԖH~LHHY豖[]A\A]A^HH>DFu,Eu'H|$Ht$1H=.$HQAHH ,zH1H5/!耈 HǃHt@1HAWAVAUATUSHHD$xHDŽ$DŽ$Ƅ$H;!H5lE1H:衶HtL=!H5ݻE1I?zH#H9GumHHtzx={]u|H= f1 HHtWH+HA`Ex?tH!H5ZXE1H8-H5 !DHu H0y-E1{_uL%!H5HI<$E1贵Ll$`H=3-!H\$`ILLg HHt輔HK LLH=,!HL$`g IHyH{8|HnHT7LHD$xgRIH:H1HL$@H$H5Uh4Ht$@HH~H)|$xHuH|$x%ILC8H=M,$1LHLD$`>HD$HH*YLL$@MAII LMLL$ L,L\$xMH{8L\$EHt$H{8HL$ 1MH:H5w+!肅 HHD$ H|$HGHD$*L;d$HS8H=l+$1LHT$`H=HHiHHu MIHHL$<1LH5(uHM诒.Ht$`H~u MIH~H|$(H|LD$(MuDL$訰j~K8H=)!LfH:"L$H)L$`b H|$H譏HH蜏H|$$!IxMLd$HT$XHt$PH|$H8}~S8LfH:"T$HH=(!)T$`,b H|$HHT$XHt$PIe H|$MtLHĘL[]A\A]A^A_AUIATUSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H!H8HtHu HIXIHtKHL$ E1HHH$HL$HL$HT$LD$D$ 0LH%IHL[]A\A]AUIATIUSHQH&HuE1FHHL1LHIDHIɍMuH H8ztH{({ZL[]A\A]HH5HH55qHH5bHG(Hp H8/SHH6 HtLH(HT$H=x4HT$HsHtHH=1[HH=1[H1[AWAVIAUATAUHSHH(轭 HHPH{HxeL,$MtLy IHuIE1L9e~IH{IH5H-IpHEiL LH5HI1I9ZA1E1Ht$H9u~DLGIHtHT$HHHTjLAEHL$HqMHD$L|$HT$Ht$LLtHt$LnQ]Ht$uCLiHBH9E~+HCHL$AH5`H= HP1H?+YHT$Ht$HAąhH<$Ht>H(D[]A\A]A^A_AWHBAVAUIATUHSHH8Hw IL#$BLH=)8.u3H{ֵAŃuHtE1}H H5XaE1H9]DuEtH H5E1H:6H#H9Uu~HHt!yxMI$}]u{H=a 1H} IHuH٘L[tL%F H5MI<$E1諪=H5w HHu!IAtAAEL 1D1AAH5I:CWHL~QuH=m LKHt$Hl$HH=`!!\ IHTnHLQNuH=1T ;Lt$H=3!!Hl$HL[ HH 軈H}xHExHt襈HHDžHtHDž~Hu8Ht/Ht$LH=v !HG[ HHFH} 11AHaH5* !Uz LIMeH}0MZLLPƅyLE14HH$1LLOu H LH5$H81WUH=$L|$1HLHl$M2HH\L{IHHHE1HM L@H<$LD$DL$DT$H|$LD$ DL$(DT$,qaIH1~E H=$1HHfH:")$1LH识HH螆H}xHExHt舆HHDžHtHDžaH}8HuLc|$(Eu5LyH} L$$H1H5!Kx IH[Hxu*H-# HWH51H}SL݅$t$ HH=D1SHHHHt袅|$,u H H # H}8E11LH5!裷HH8 H}xH]xHtNHDžH}x L9}L. H5I;ߥiL6t$ 1HhH=HtBHHHtބH}0t.H|$u E1|$ ADHEy L謄E1H8L[]A\A]A^A_ATUHQHGH; t H; u"H}E1 t)HmH}H- HEHxHIALZ]A\USHQ_HHtaH{hHu LF I<IHu H13HSXHKHuH HH=z1cHHȃHHZ[]UHHL H5UZ1I8[IHtH= H5XF1H?5+'H|!H9EuHH=HHuanH=I$Ht$1HHl$-HHtDHPu(H  HRH571H9PH1H}u H҂1HH]ATIUHSHHHD$HwH.1ҹHH=؍%urI<$Ht$ft`}HLd$H H5 YH:=}ItH H5EH8H%xHLH[]A\H1[]A\AUATUSQItH; H5DH8褢1HFHHtH~,L]HH1H5H- ISH}^O1J1HHIH H1HLy c1WLkLkIHMmHL yL蔇1H}J LLtH{(Lm HWu HRH5$_ Hu"Hu[L  H5I9wCHxHs0H HEH9tILFA u IPH5L 1I:2N1!H}hHt 耞y HHuhHHZ[]A\A]AUATUSQHxt Hh Hu# H HuZ1H=c[]A\A]Lh(LhHcWXtHH)E1H^ H WIcH9}HtHpL9wAHHu HQHH)HHHX[]A\A]"ATAUHHSHugHtUE`1JHAHL%HLEHcK$HcS HH5 LcK,LcC(P1ATH6 ZY[]A\PHL١IL H HcLc1VAPI3IL HAUATUHGu GH IHIH5HH9k2xHuH-< LHL]A\A]h]1A\A]AUATUSAPHGu F H HIIH52H91xkMuL%LLHHHtIHPu-HsH= L1HNH?H5TKH}YH[]A\A].Z1[]A\A]AUATUHGu GH IHIH5܋H9G1xHuH-LHL]A\A]t]1A\A]AVAUATHGu $ E1H m IIIH5H90xVMuL-LLL IHt4HPu*H= HJH5 L1H?fJL|E1LA\A]A^H SHH5:H8R0y1" H?[HZ كt HZ [PH H5=H80ZAWAAVIHAUATIULSLARtLI IMteHt[HtHtHHuA1LIIDLLjmAL{HtH{MtL{ MuAZD[]A\A]A^A_ATIHUSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$ D$Ht$D$ 0HD$HT$JH1HtjIL$8I$E1E1Hd HH;gly2H;ft&vHLH1Hyz1 HmzH[]A\ATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$ D$Ht$H=MHD$D$ 0HT$IHHtfL% E1E1HƋH I<$Uky(I<$et'uHH1H5W Hey1HYyC@H[]A\AWAAVIHAUATUHSLHLL$t:)D$`)L$p)$)$)$)$)$)$ AIHHtHqHHH|$HT$0H$ D$0Ht$D$0HD$ HT$(|HIHuA8jLLIjIDHi LIHxXZMtLE16xHtH)xL!xHD[]A\A]A^A_n UHi H] i fg AUIH=nATU2D HtgHH5ILHwHu6sY1HH5H=|x"HHIuwMt LhwH=1F]LA\A] ]1A\A]USHHl$H|$tt$ t$ t$ t$ kzH x u#LT$(LLH\$8|$uHĸ[]ÿATIH Hm<$t$L$A$AL$H LH8H LA\AWAVAUATUSHXLt$0LDD$0Et(L$0(T$@)L$)T$ JL= A u9L H5DfInH|$AfH:"D$ALJ0E1'%HHH(IHu H H*IHt H@H IW(H°HLT$0u?0LL^*T$0u&LL+T$0uLL(T$0tc1T$ d L)L LHe DD$ (d$@DD$0(\$0)d$ )\$DD$t$(t$(t$(t$(9xHXL[]A\A]A^A_1CUSRH: HoH8H9tH5H=lLqHHtH5H=O/qE8>m HKH r H9]uH{tH5H=pHƀ H^ H{X[] ATUSHH0],HC H{0HhHk x-Hu={(t7Hf LCL0LL`-LHHL[]A\F-[]A\UHH'Ht Hu oHEH]H@AUAATIHUSHQHHu4EuE18nLxIHuHtHHXHvyZL[]A\A]UL%HH H"HHHHHHD$ D$ P1LL$E^_A1EtT$Ht$H9H]HH= 1"UHfuHjfHHxH= 1]1]ATUSHP=pu G`H {`t 1wLHDc贘HHt$H蟘HHtHH1B Dc1q[]A\G` LDML$AMHxC`  M9u[MHHL$J4aHL$HIu3HwC`V E1HJLDcIGC`E1 |E1kUSHQP=pu G` {`t 1w<Hߋk9Hu{`ku HHukqZ[]jG`b kfDAaDFRD1EA@USHQP=pu G` {`t 1w< HߋkjHu{`ku HOHukqZ[]G` yD1Ax ATUSHP=pu G`J {`t 1wGHDcHHt$H覕HHtHH1? Dc1q[]A\ATUSHP=pu G` {`u<HDc5HHtHeHHtHH1? Dcɉ[]A\AWAVAUATUSHHH|$H==!Ht$HT$ D$<9HD$HgH HL$H9tE1E1KH=!D HHtH;$ tH5!IHu iiE1HIHtH=}!H}QD HHt@H]HHu$i)HPtH蝻HHu iH0QH=!=D L QIHtOHLL$(a]LL$(HIu hLL$()HptH3IHu hL PLL$(u LL$(HIu/HtHlMtLlMtLlPLIعAUH|$LWt$8Ht$8H|$0肕 H IHtH~lMtLqlMtLdlMuL l$< ugbH|$HHu Lj CSLD$ LMHt$HH. LI= M3L1k HH[]A\A]A^A_ATfAu<[ DA\AUIATIHUN HuA [ LHLHHAmkD]A\A]1AWAVAUIATUHSHH͖H\$HD$HtHL5!LB Hu'H=dLIH1 MtLjL=!LA Hu'H=TcLIH1 MtLjE1HLHEAăuE菷HtH H:VAƅtEwAufEY q 륃 uE1HD[]A\A]A^A_AUIATIHU HuAY LHLHHAjD]A\A]1AWIAVAAUIHATAU HtHLLDH HAi]DA\A]A^A_111AVIAUAATIUHAPHt H) HHuAX !LLDHp AHtH@iZD]A\A]A^111H1AWAVAUATUSHH|$(Ht$H<$|$(tt$@t$@t$@t$@=l~UHcHHHIIMtHu4H- H=AHM1 F_E1E1L|$HLH- DŽ$0DuEu#H=[@Ht E18Aƃ}tNE1IH=j?Ht88t3H 1H8 ?H 1H:>H  1H9>1EHHHu+H= AHH=('EyH5bKQEE1DT$ D9~YLL$1LT$K<LT$KDEZKIHuHv DH5w1AH;4E\$ HDHv~ I}oH<$LL|$(H5 >t'ـL H H5OH1I8DL訛H=#uH5^wH=?cAy AEt6L5 I>C02tI>11H5%E1A\ 1AxEILE1~MtD9~K H5E1H?褄iHL|$LLD$LH57Ll$HD$HT$H@ IHtlH5L{`DctDE1Az 8H,|{`H|HHH{HHH H{{`H{Ht{ H{HtiH{HtW1HftDH5 MH1HfH6IHu%跡HtDC`AyDcE1yL[]A\ATUSHP=pu G`g {`8HDcz{`u|HzHtjHHt]HzHtKHM!Ht>HzHt,H HH1H1 IH{`DctDE1EK8H0z{`HzHHHHHyHH Ht{ HyHtiHyHtW1H膨tDH5 MH1HdH6$IHu%ןHtDC`EJDcE1DODL[]A\ATUSHP=pu G` {`ukHDcxHtKHqHt>HxHt,H HH1H1_IH{`DctDE1EKHxHHHHt{ H^xHtiHLxHtW1HtDH55 MH1HcH6IHu%iHtDC`EJDcE1DODL[]A\ATUSHP=pu G` {`ukHDcwHtKHHt>HqwHt,H } HH1H1IH{`DctDE1EKHwHHH肈Ht{ HvHtiHvHtW1H誥tDH5 MH1HbH6HIHu%HtDC`EJDcE1DODL[]A\USHRP=pu G` {`uNHߋk$vHt6H{`u(HvHtH=?$uH1 kɉX[]H H8:H H8Hz8 Hc AWAVAUATAUxtEAIIP H=I#-LLDkH=(#A@I( ]DA\A]A^A_H zt7ATIUPH=#LH=#Z1]A\øAPTKHt H1YHt HZf.DH/H"H)L"H9uHHDHL@HHEff.@H=$."HD$HD$Hff.HH="%0"HH8H"H)L"H9uHHD*HHLHHҾHE*ff.HATLfUHSH7H=HGCSKsH{DCH DKHH HH KHH LHI LIM IL H[H}LU(]A\AAWAVAUATUHSHhHNH_HRaHHSH+#IHHD(`H HM`LEhfHEhL}XEXHL$LD$ H?#HIHpHD$Hƿ1fL\$II+H HSHHfEH LE111HLfHnIfI:")T$Hf_H +HHq_LE0LL$HLT$PE,LL$0ALT$(HCHIHH=`eE_fo\$IL$)\$P(LA8KHL L9MH= It$H8IT$0D\$]H D[]A\A]A^u]At\E1AE!E{ntAt\HLN|\Ht$He fQ\XHGHw AWAVAUATIUSHHzH HËD$ HJHt I9]Il$LuMIXLH4$#E]ApMp MLX#"AdžpIhI9IILy$A…X]L= IOHt I9 ]EH\DEHEXEpDMXE1E8]D E\E E DEDI$\L$\Dd$ D#HH[]A\A]A^A_MhIIx>\MD$$MLD$H\$LEEt\H`LxAHL\$LEH=#\Lt$0LLic H|$LLYnt-t\IH\$ML!lW\A?mLT$L9x[L MCMt M9\[EHEDD$$'HDD$D$U- UXE1D$DD$AÅr[Z[fHSHH9KfHH<hHfHX HXHPuH qu*HH[@H=q HDGEteef.UH@HeHS!HHH=:!H9 HuH}L !D?OMZM9tYIBAH(IjHtH@]ÐAR(A;R,vIzI{L_H@]@LIJAz(HMHuH!H5"H=!H9u1HHEHuH $hH@H]HHD$HD$1HD$HD$ HD$(HD$0HD$8HH H=H3HHT$HL$ fUHH@= = HuHwx}L g!D?OMZM9tPIBAH(IjHtH@]AR(A;R,vIzI{L_LIJAz(HHuHqHD$HD$1HD$HD$ HD$(HD$0HD$8HH H=H3HHT$HL$ f.HxRHH!H9L!H9u#HHD HtH7 $HHLHu11fDATUSH$HCH5$HH;uHL[DA,EJMt_MKL!DCDD-fInLKO$DfInAsED$AA9k$McI<$I{L[]A\IL+%Q$L[HILI@AC$Ec HCDCEt-H $!fInHfHnAKSAA9k$mEfDnMc0@0)fD:"LAk,ISfEK$H7M6MKDCLKEeH{ H=I$HQHG(D=h =[  aL% $LMLS H=;!L$1!IH`H`L$H$L#IL;$L$vLs$DHCLc?u3C@{fH5$Hh$C {HH@C?)ILc뽋=$AH=E$Ik0HK`D $H%$DCMMk0L'HAt$E9s2Lk0ILT AH0A9rLȉ$H$HE1H :t 1ۉ̶ eH=OHt_?9C_DHwuH PuHH Hyt``fHi x`HATIUHH=PYLH1]A\YfHI 0tLHtBUHSHH8H_H@_LH9_H[]fH 0tI1H|$X HT$Ld$PL|$PLLd$OHt$HD$(HD$ L)fHnfH:"D$h)D$pL|$Ll$@MM9lDL$`LD$XAxHL$pH|$PLG @@E7AKAA3LL)HBAGDHA?AIB0L)L|$HL$pDFA:L"]IIFLuHMHMwM9sM9Avy@XMM)IEOEqA?GXIA+@1HM9^AwAlIH؃%Lt$L+t$HL=NMnLt$8Ll$0u H<$- ŃHt$(PLHATLD$(APLt$8AVL\$PASLT$`ARH|$0LL$pLD$x H0H|$(Ht/H|$ Ht/H|$PHGVHD$PE1/HGH|$(HJH|$ H&H|$aIL+LD$M9tL|$HHM)M)L= MM&HIjLD$L+D$HL=MMl0ALL)HAGEOP?AAu =EYA?A IC1AH|$pHL=x=7LL)HEWAWEJA?==u A|DrA? AIHDfGM9AbAfIHIHALHAIHHADADHI fAnH0H(HAA@H8fAnہfAfAnfAfnfAfIffbfbflgIOI9MM9A*}=HLL)H^EWAR?]IHEfDOASLD$HdA8ZM)IMEhAM`;L+D$HL11L)L|$HH|$pALL)HADWA?AAu EOAA?EAWDZA?#A IB27ADA9HIHD2M911LbL\$0L+\$8L\$|$`w1L 0Ll$8LT$0LI9#M)LT$WH|$HDL$`Ht$XHL$pA+QA|f-$fNHD$pHM)Ll$nLHADWA?nAUHEwAƀA@փ=<LL)H1HEwE^A?AOO=1H|Awƀ@փeMfLt$HLd$@bIHP11) IGI9OM9OE7AIIA>1NMM)I~]AwEwF?N]Nu dPE^A?N IA Aw~?NN1@@(I*(yMEwAwE_EVA?wd=tO=u ANDNA?7NAS? NA IA7DAw8OoLHL$pH|$LTI>E_As?w?Aw$1=@AV1=@=dADWA?hv1A@L1A@.@Mff.@HI@HGH9SHH?H=LII8MPL9LYIHAMXMPH9HyHLI IxMPL9LYIHA(MXMP H9HHQ H|LY0IP I(L9MKICIICMIH9IMKICIt`DIH11H9rPH€:QHBH9uHz H9rML#uHH9HH9uHH)H@MIHr2IL IIsMAHIAM9OI1@t A A @tE1fE3Ht E 1E 3@H)MIHr.IH1AIIQI0HM9VO IE1t A AA tC4fC4ItGGHH9DEHxEH9PHxAPH9v~DHExtHxEHH9vgDXEx]LPEXL9DHEHEHIPH9vDExHHDBH9uH)MCHH)fML(DML#PHHH9LH#ztDLLHH)HMIthItVItDIt2It ItHQAIPJ4 K4IN OIJ KIJ4 K4IN OIJ KIM9J4 K4NT OTJT KTJt KtNT OT JT (KT(Jt 0Kt0NT 8OT8I@M95HHthHtVHtDHt2Ht HtHyAIxNOIJKIJ4K4IJ<K<INOIJKIM9J4K4J|K|N\O\JTKTJt Kt J|(K|(N\0O\0JT8KT8I@M9USHHHtHCtH;F uC t H[]DHHH=>#HtbHHHHHH9t-H}HHHEH/uHwLF0H[]AK HHK {H#HHu;HfDUH-!H $fHnfH:"H H Hb!H8Hq@,t]H=V @,HDGH)EGHL ( $H@@ MQL $LPH ]H= )$@HGfo$ATfHnfH:"H H H8HJ@,tWL @,HEQH)EGHL}$H@@ ISHf$HPH A\IH=q Ht$)$Ht$H#Gfo$ff.AWAVAUATUSHHG GH^HIIL= L9u LnIu LkxMGLAIHH] H!H9zH}(%GHL$LLHSHHH}(GHt HD$HGH[]A\A]A^A_H] H{Lt$[M9|$LHHS Hs(IHCH RH=HH=fB~L4AIH|$I$HH}HMfLe(M.Lm ME MEH $IIFHEHHMH $ImME H[]A\A]A^A_L4BT;(ItLa?L9[L[ fDMD$A@uaLWA@HMHMHx HH9WHHD$H9rEH] IHHuL - M9L$uI|$uIEH= PH9A$%uH|$HJLOM9uaHI|AL9UL4BIEHLLLoLDLAH|$kDDDvEfDUHSHH_HCxHFH[]ff.ATSHLgItHL[A\@G HE@Hw t1@tH{02HCIHL[A\H{HHCIEfHt;HHo!HHH5CH9u!H=/ HwH?KHtH1HHuE}EH HHH8Hp f.ATIHIUHHIHuespemosSH8ImodnarodHarenegylL1I1HsetybdetI1H1HE1IH-lJc\Hf.EZI0HARL!H H IEL[IM!]M I L1I ILH IH1I1H HHLH1II1H HH LIH1I1H HHLH1IH I1L1A\H4H IH1H MIM1IHLL1II1I HH MIH1M1H IHLL1II1I HH MH1IM1H IHLIL1I1I HH MH1IJ<M1HH1IL1H H1EZIfEL H1LI IHI1L1H HKIHI1HH1H LI HHI1H1H LIHI1HH H1H14I9I HHI1HH1H LHIHI1H H1LI HHI1H1H LHIHI1H H1LI HHI1H1H LHIHI1H H1LI HHI1HN IH1M1I [H]A\L1L1MLLZI3I IHI1L1H MIHM1HH1I LI IHI1L1H MIHM1HH1MI I3:Iw:LHMTHM$fEZI fEL DLI3BI HZII1HIjL1H MIHHM1H1I LI II1HL1H MIHHM1H1I I3zMHIM$H]LI HI1H LH1H)IHL1MIHHM1H1I LII HI1H L1MIHHM1H1I H1Hff.@AVfHnIAUfH:"ATIUHSHH) $.H@IHc H9Et Hn7IUH-B!u H=9!Lk HC(HEI$H{u$H}@MT$A@LC LMPMH(IMA1fo$1M2L5#ARIHCLsH[ L5#o[f!=[H[]A\A]A^HHHH;= L HKLI8LC LeMH(M$IUfInH HCH fH:"CIMMPI*>fMHMuTL;e wI|$kfDH59GH9u\%H}(L GM9u3A$%|MT$H}RHLA>@HVUUUUUUUH ?AUHATH?HUHSHH)HL$[IHL9 M8IKH<.LA.HLH,IMH(I@IXMXI@ I@(MIxIyI1HIApI)AIxHHL[]A\A]f.I|$0IH<HIMH(I@IXIPI@ IIH^H0=HIIxN@IM]AT@IK|%([IH LI8I0;fH/t鴪@[ff.HHG;HH= !%!@AVAUIATUSHp HHWHH m#IHH&H%HH*HL MIAIAEGG9d_$I9wJ<H[IH9LIMHNFA}L!D?OIKI9McAM,$MkMLHHr HHHE1HLy HpL[]A\A]A^fE9 EfM9Hh!L5H=B!L9MHIEHp[]A\A]A^9fBHBL nFfFIEDADfImHA}H C!4?L MAM9MaAM,$MiMEQ(E;Q,v4IyIxLGAC(A;C,v6I{HyHOMDLAIYEQ(HifLISAC(HjIHLIH7@IH LIHpLH[]A\A]A^HD$@HD$@1HD$HHD$PHD$XHD$`HD$hHH H=H3HHT$Ht$MM5̅ IA4HD$HD$1HD$HD$ HD$(HD$0HD$8HH H=H3HH$L$MeDO IE@AWIAVAUIATUHSHHH H9FHW HZHJ(IHH}HLe0MLCH|$Ld$MM!HZN$9ItiKdM4II~H9uInI+HHL[]A\A]A^A_@M9.tcIOf.HWH;U5Hdu G @t$1ƃ5@Ht$@ 5@Ht$ ]5@H0L\$8LD$0LL$(LT$ HL$HL$LT$ LL$(LD$0L\$855AL9 5Nc$ILH9D4HH[]A\A]A^A_8+HH\Ht$>DHOHILB(HyI!LHoB| (yfDIKIIDH!|(xH LJDH!|(xAHHHDH!HgMMyDH^fCIH IDL!L90Ic HL90A4HHI9tH0M,@MIkIHH(o IHqAKLQMSL9HHyuHHHytoIH0A[HyI{I9u`IHIDL!L9Ic E1E1M9}?JTHJJTK>HtEto[9uL !LRL[!M9 H-#[^$H !H+HMHbH;}HuH}HHZH]A\A +ATSHHHIHt_H~HHx1HQt MD$H8ML$HJAHHwfHnI LfI:"AD$LGHL[A\fDLs M8I[LH&I$HL[A\Hs H8HJHH&HfUH@H".Hð!HHH=!H9 ;w HuH}L !D?OMZM9tYIBAH(IjHtH@]ÐAR(A;R,vIzI{L_H@]@LIJAz(H}HuHH@H]HD$HD$1HD$HD$ HD$(HD$0HD$8HH H=H3HHT$HL$ $v ff.@IIH,HH0tH1HI9,H=2!LL%6!fDUHHSHHHX u [H{H)!{L {!D?OMZM9MBAI0IrHt_H0u!fAA@A@ HXL[]DLHr H1HHuVu9tHXL[]Aj(A;j,vFIBICLXE1HfDOtDHtLIRAz(H0Ht$UHt$HIH茬IHH@# HD$ HD$ 1HD$(HD$0HD$8HD$@HD$HHH H=H3HHT$HL$ s @ff.HH=&!%@!AVAUATUSH HD$H~*HGH;o t6H;>l u6h*HwHRIH L[]A\A]A^HIH|$ ~IHtH|$ 5=HHHE1Lt$HD$Hu!fI9}[HL$JlIIl$LHHuR}EHuPI9}H|$L8u:LjLd$1H HHH)HL7tz)H|$Ht)LE1fHh)HGW)HwH ff.HUHHSHHHH~eHUHHPHtSHMHHH HtAHuHHp(Ht/H}HHx0HtANLINLIL9uLm HpM8HPIkHHKfHnH H1fH:"@HsH[]Hym H8LGIH&HfHHJ(HLm H8HrHAHH&HtGL@LH&&H=h DOE(HHHH9(HH=%l H@AUATUHSHHWH~H_HrHOHH HHrHGHgH=H9y0tL%tl M$8M'A1=HuAHH]II JHLH]A\@HHt$HHt$H5!H9u Ht$uHLH]A\H]A\AUIATUHSH^HH_(H_ HH@H1IHHrH1LHHH}(HIl$uwH\ rI$@tFLa IL$M8ID$IkLI}fInH HfH:"AD$IMHL[]A\A]@Ly\ HEEHEt<fDHIH$1Ml$HL臭@Rff.H1fDAVIAUATIUHSHHHHH(eLk HL$LHHAUIH~H{WLK(MILk I}9Hr^ H9E8LLUM] MUIu(K<[IHE\(Lk MIM] M0Ls(IhMM`L%#I1HCILcImL%#M] H[]A\A]A^DMH|$HL9kO$H|$HMH #HCHH #HKHmoH1[]A\A]A^Ha] H9FPf.Hu@ML$A@MHML; ] 1L8^ HKM8ICHHrfHnHLCAI fI:"CHJ ITH|$I9H/H_S0fHHHH;5\ dH}Y$H5Y#HHsH/H5F#fDHA I9UIUfDLEHAP01fDHI NWfDFII|$&DH 1H9z%fHu@H=I9A$%ML$MLk I} H9{I}@LK@HOIIIIMI?D)HLk H-#O$I1HCHHkH-#ImM] H(Lk `LA1H|$I9Ls M^MV(I9OlmKMdL%t#IL%i#LcHIMH2ff.@SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HH$HT$ H$D$0HD$HT$ZHHD$L@A/vzH|$LL_L\$ILHHJHkZ HpH8HPLQMMYfInL I3fH:"HIqH[H|$DAK $H4HHpHt/LEKD $ILP HfA/L\$M IKHL$ILH(H9|@H Y LHH8LPHsALIxfInI LfI:"@MHH[@LT$I2IRHT$HHp HLT$HqH<IHIH9WfDJAD$HHP(HhLL$1ҹA/w+D޺AL7ILTHH9uD$+I9IqHH|HH9u u tD$Ht$>fDff.ATUSHHw0H9X HcH8HJH H[]A\HHuHt>XIIM9uL;|$ |$h|Ht$LHL$pL$fHnHL$)D$pL#LLGIIxLMLH9uLt$pLl$L=QM9A$xfHnL$)$I9LL 0L LL MWMMM~ M}MuKI9tMMnM6MOM9tLL'L; L LyL @L; Q @@utLG ILKL tAGuIIHB L+L sD$(L$L9.fHnLct$()$dDHL@HQIIL HQLhL$AM LhIH$LPHAuHxHH0H$H9uHHH$H9t@HbHH9uHH L$I9tI HI IH9uHt$HaH$1HH9tH6HH9uAI4>H\$(IfInHt$8Ll$L5uyfH:")t$@HcHt$H L$A$xL9|$(:MI_ IGHHIGHI}XIoH$L9tA$xH;\$(L{ 2HKHHHCLI}XHkH;$"L$A$xLL;|$(toIH] gIwHHt9IGHI}X IoL$LL9ILIWHR0 Hl$p1H5wL=wH;l$ H|$8L4;oLl$pL;l$(Ht$H|$O|$hL\$I{X2 LD$XMtHT$8IHL$`HtHLkL$ L|$PKo}f|$@}K L%i#fA<$ HL[]A\A]A^A_HLAHGLKLAQ0eHt$L~I.HLڙI8&HSLoLH$LHM$L\$M9tlHD$ Lt$L|$M}(MuLL|7HH LL;$w D$(}M_HAS0HD$ Hkt$ M4@M9I}LF M9EI9L/L9GM9I}IM9EI9L/L9G|M9I}M9EtyI9L/L9GtWM9I}IM9EtqI9|L/L9Gt/M9tnI}IM9EuKLI9tTL/L9GuH藒fILHM~fLMHaHk|$ E1IDŽ$PM<M9tf.MIM9uM$HI$1I9tHHI9uI$PTILJ8&ALJ0&A)HI8'FA)uLc L L zLWM.A.LxIH@LLPLcff.AVAUIATUHSHHH9tTHBHJHH HHBHI9uL%LsH{LHAHI9ufHnML%d EI]I9u?fDHCLH{LHKHL IHHKI9tPHH{HHuLMILIIIIfInML MfH:"H]II9uLI][He]A\A]A^DAWIAVL5AUIATIUSHH_Hx(M9u;IGH,HtHU@uFHs1H[]A\A]A^A_IwHH([]A\A]A^A_nsHULZL]HUHzH}LMMQLULUIRHUHD]I $$A/w:DAH]D]H3MHL- IEDH]LcLeI$;}6HI$LuM~L}HuLFLEH]LcLeL]I{H}A/wf.@tDMeLHIHHuHI9~yI HyM,H9H;= tH ' H9>6A} 1ۃ@HL9|1DLL$t yf1H5WH$^H|$8K \$TH$HDŽ$HDŽ$HD$xH$DŽ$HDŽ$HD$8Ht$(H?Ht$XHt$HLt$pL%Lt$HK,MwL9H$I7IL97LWMLND_MVMqMG1D9MoHwL9&L$IwIL$HHIOH9kIwIL$HHHI H9IwI L$HHvMw(L9IvI>L$HHBoIHL9w]1HL91H  H9H;5r /LL0L OML$MDL$L%)L9H9#L$H$@L9 H$IwIL9vLWM LNWM NM M?9?H,M4/M9r H|$@H;\$X7 LL$HHt$XI,I9INIHt$@H\$0H9xL$L|$ Lt$DHMH\$ IIHL$H)HL4I6M9MCM2HFA{HADNM H A9~6LML9s>LIUH)HLMH-I^H9LMH9v&HEHH)HHHH)H|bqH|$L+HH9l$0Lc$L|$ H|$@MKlmHAL,EHDŽ,H,D$AM HԸH\$8HmHt$`L=! 1HLd$(LIL$M8AME LL$MQAMZ8H|$JHH$1HHt$L1H$IH|$8L/M'H;l$(MHT$`H H$M8MuHt$LFAXMH8Ll$KD HALH$1HL1LHq#ILT$8M,MHH;l$(Ll$`Ld$Lt$IO\L$I8HI|$sHW8IHbH$1HL1LHH"HL$8JH InItIH$M8M MD$AMP8KHH$1HLLL$H|$1LHV"L\$8IH1 LuL;t$(Lt$H|$(]Ld$`L|$8Ld$Ht$(AAH$HL$xLVH$DŽ$LHDŽ$HIIIMÃ|$TLİH$L$H|$(LD$8L,LK,(Mu\HH}HHHxHMH9r;L- E1Ht$8JH8MHc$HkIAD$EL HDŽ H AH\$@M< A1M+E1LLH$CE1LHH$E11HT$HHHT$HM*H~E11HT^E1@Ht$LE1H$mIH\$(1IHAL H?HHt$(H\$XH9SHJHD$(AL$DŽ$Ll$xHL$HDŽ$HIH|$8HİH$H$H|$(Ht$E1LH$IH;5 H=H$L$1MAICHIH9LNMN1HHI9-HM1AtIcLkN,N9,H$H HD$AYH|$8L-z L\$LI9I;LEIHMCH}Iz[IrLT$(E1Hv7McLHIHHIM9K HyO L9FIy;MYI;sust.H;5 u@uH;5 utAC <IM9|H-EH$LL$ A11M11AtIcLkJJ9RHG H$a1tHcHkH H9 H HyE1"19A1HLWL$HD$8Hl$(L,LD$`MMM]IIMXMMM9raLL$`L|$(O\II+IIIiICM9rF2M~Ht$(HDŽ$HT$`LT$hI^IvIVMV MHOHL$(H<CHD$8IHH|$8ÏH\$@Y11H+I9uvHH9E1H0HHH{@ffo̪HC H{(HHHǃS[0uqHH[]A\1HHL[]A\]HI9u1H0HHtfo VfHs@HC Hs(HǃCK0H13HEHvsff.@AWAVAUATUHSHH(HFH H9H=H9HXHELRMLZI9IH9J It4H9J(It$AJ9LIM9uf.I9H9z uIt/H9z(eItAJ9|NIM9uDH;HIH0Ml$LAIHtaLxL;=H$IGxHgLHHgLHTH<$H/uHOQ0HL8I}XH$I,$t8L8MZXIH([]A\A]A^A_ÐIVH}YDIt$LV0L8IxXHH([]A\A]A^A_fDI9H9t HUHu1H([]A\A]A^A_HCHks H LI9Lu(Lk(LU MHutL]L{ fInM9HmfHnfI:"I9My fDHIIL9I$HtHM|$IUM}E1L%)!My9IL;} (Lu(LHLH7L9tHtHWH+tǃHSHH4/uHCC1KIZHIAItGIt IHtH n(!H9HMfI$HtLM(!L9HII$HtH5,(!H9IHu\:IT$HMt$Ht L'!L9ufIVHt L%'!L9ufIV Ht H='!H9ufMf0HI$HtH'!H9tHIL$LLԙ{HINLL輙HINLL觙HIN(LL蒙HD$LMM?LsLkc MO(H&HHs HooNHoV P o^0X0of@`@onPhPov`p`o~pxpDoDDoDLLL@LH(MIHH H'K4H~HqL^HIHK\HSHt LCHIHKl0HuHt H}HHHO\HI[Ht ISHHHOD`IhHt IpHEHHtsO\xI{Ht I[HHHtSOIQHt MAHIHt0I½IHtMHIHIH9uH[]HHr HHHE1@t DAD@tBfBI@gBBYHAHȺLJl(H$HźIO骺fAWAVAUATUHSHHWLo(Lg H H_HrLHH HHrHGHgHL9G0L5I8H]DA1[ADMMtI,$uL_M8MeIc$@,OH H9MxA$@,I)Ht!HtH[]A\A]A^A_f.HOHH9A0L5$1MFfLN#M92IT$ H~E1K|HtH/t@IL9uH=!L!fHuH@H0LDL_HT$AS0HT$HH[]A\A]A^A_ H[]A\A]A^A_铚 AUATIUSHH_HMl$ L1M~+H{0HtH/tdH{8HtH/teHHI9uH5H8I|$LGuNMc.AOAEQE.OH,H[]A\A]HWR0HOQ0H=y!HL[]A\A]%!HH/HHuHHHYHff.ATUHHSHu HHHHL$J\%H9v'H1fH9vH9v=1+(IHP u[ @HH0IHJT%II9E $HIDHA|$@xET$DPE\$DXʀ @HHHLIHHHI9 HLeE1H)HHL9H4IBHHL9IBHH9v{(HHfiILM1I)III9NLGIII9LGIL9v2A2IIAs @H@HHHL[L]A\JH2-H,DEA.[D]A\m訽HI[L]A\HHHxEZ E HIEbArIM II IM L_H1H5H;.E1HHGHt|Ht HHDO Hu W@tAHw0LSM8DMQKHt/H9tHHD$`HD$HwH袼H9tHKjHAUIHATUHHIHwHNpHHAHLL9uK PLOM9\$u@IT$Ht5H.+!LLHH9E t?]A\A]%vD]LLA\A]L(DHHu]A\A]fD]A\A]6JH~hHtMD$MH`Mt IuH(u=H=/b! H5QLH6zHH\LH]A\A]~ Zff.HtVsAWAVAUATUSHH_HIgV/'HE1IO'=I녱y7NDIPHBxHֶLHt\IILHIIL9uHc/'K*\H1LHHEH[]A\A]A^A_fIgV/'Hff.ATIHUHH{/E111HH*HHID$ ƶH<H9UuVHUHtLID$ HL$HLPHyHmAtHL]A\@Ld$HmuHMHQ0HBHHuDAUATIUHSH_ ;@t@LmL.L9t 1H[]A\A]À H}0LL71ff.HIIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H-H$HL$ LH8HT$LHL$H$D$0Hf.AWAVIAUATUSHxHGH\H;G OHpHwyA~a ÃD@؃〉ASL ȰOcMAfDI^HMN I)ILSMVD;MAIM  In8L9ELeOV<]1LHD$hI腌IMt HL|$hMHD$HD$H9D$LuIH'HL^ƵLXHD$L HD$XH*HD$hL D$@cH˵LD$DIHLD$H/HLD$LH}LHD$0HbLHD$8ߤHGL~HD$H1LhHD$(HLRHD$HLHpIDžLLZIL=3IL=ILZ f.z²IDžZLHIGLOI觠IH{McI$H9,LHIHHHŃHD$HUEEHHHT$DL$IHMLT$MUE1ۉ\$LML9&HeAHAH?AןHADDCLIL=I-L5H荟IH.HHgI~8L;mLH胆HD$hI"LLkII^8Ht$XLCM I9HIRgHHx HLL8Il$HHfUSHHHHH9H!ui HbHHXHPu-H quWHH@uD H[]H=Ht/HfHuHARH-HHփuAY$uAX uY ޲ATSHHHIHu?H[A\u DH7HHDtt8LP-LH9wLRHtEx @ @_LH0IA2MtDEAH[A\HxH9HH#LPL9IL#@HxH9IL#Hu}LP L9r^IL#XukL@(L9HH#x uUHx0H9HH#H(u?LX8L9r IL#H0t +IM#Cu"LIL9sH9?LWND#IL$HLHOD!HH[A\LB\#fC\!HLDEBT#CT!HHHHHLާHDAWfnAVf:"AUATUHcSfnf:"foH8flȉT$ L$DD$L$L$L$) $9  E DH|$pHT$pHJΰH|$x°Ht$xH~MMGAMMMAvMmMT$AZMQM^A?H$0H$HPH$H$HqHHHH$AD@|$/ϯL$MQAL$A{ H$x LLiLYLIH|$x15HT$pHzAMFMFI|$:@fn\$I}f:"f\$H9ɮHct$ H9HHHH9MH=-HE1H|$pfo$$fHT$H$`H$HP HHx0H|$xHHx8ILx@IELhHI$L`PILpXLX`HHXhHHppH$$h(HHHxHǀǀƀH8[]A\A]A^A_ÃHI9uJ<LD$ JHZL$1L$L$IL$E1MdIL9~4KtL |t tI臔HtM4D$/HH9l$ |$/ML$L$L$t$H=кLT$ vL\$ HG駬LMȬff.AV1AUATUSHoHHL4HIFHL-"L9hL$J<'%HINHL9iJ|#t%HI6HL9nJ|#J%HtdI~HnL9odJ|#Lu%Ht9Jl#LEM>M9h4HIH$Iu1[]A\A]A^DAWAVAUATUSH(H_HL=IILl$fIlHEHl$L9E @u LULM0MM9AA9L.Au @_=MAM9AQAu _IAI9AyAu @_MAM9AQAu _IAI9AyAu @_MAM9AQAu _IAI9tpAyAu@_uvMAM9tUAQAu_u\IAI9t;AyAu@_uAI M9t ECuA_u'IM9ufDH|$#LL$L9HV1H([]A\A]A^A_DH;tPH;uHfJHLHHD$D$HL$|$uNIIMI9dN,O4I>2NIIMI9:N,O4I>xJI9LDK`JDHK`II9uDLuHAV0k C@HT$HrHt$HNDL$81LT$(LD$HH\$0HLL$LD$(I|MHHOML$HMcD$L9D$J It H9'HT$I@HD$@H9~fHAI;| I@H9~NHAI;| (I@H9~6HAI;| 0I@H9~HI;|fHH9D$L\$hHL$`LT$XH|$PLD$xLL$pH|$PLT$XHL$`L\$hnHt$@H9t$H|$HHH|$HLL\$@NL\$@HH9\$DL$8H\$0HLH9IHLH9\$^II9oMT$`MI:HM4DL$I>L\$I>L\$IDL$IHt H/3MMcD$KH8L(H}I|$XHcIL$`H"HQHM4DL$I>L\$I>L\$IDL$IHt H/4M_Ict$MTI:M*HˠI|$XHDL$AMI|$`HNIKH8HD$HL$H9HHt H/pHIct$LMI:IHI|$XIL;o|DL$M@II9H1LD$ E1J`/IL9ML93I)M'HL$0DL$(L\$wIH%AT$$HL$L\$DL$(HI4HL$0H>HHMct$M9MOMe+E1H9T$ZL\$IDL$MILMK`uBHUHI|$0JtHn͓HYK`HK`HIL9t$LL\$IDL$LIMII9H}%HtHEH/YIOIwIW B%wH=?HH|IMH ɬL]H8HELVILfHnL MfH:"EL_x1DL$L\$hL\$DL$I_LJLH+$ILP"ID[`I@ffA8D{`D$0raL?AKcLHT$IcH4HEMLH+<$HIHMFL "$0AI4$fAE9E:fE0LcLx{`KMHt$(IcD$0MILdI$M!EEHH"LMFH+<$HAfAf8ELcLw{`KMIcLd$IMIM I9I Ht H/QAH="MMV$0L+$fDIDGfE=LcH5wDC`N MAIcLD$0L$L)L~MEkLHH M8MEIBRHx8I:HrRLLT$01Ht$0L1HIM9KI}IUH/tJL9tKI}IUH/t3L9]KI}IUH/tI9FKHzHH/uDLOIAQ0H{0H H9ORLC(I9HDHL$LMXMHLH+$H8MHHIA$MLWM9WMMXM9_MMELM^L "$0IILAfAE9E_fEUS`H'uHcMH4II}H;=D&KH;=OH/RLt$McL$$MAK :H5Q"LrD$0@fDDEbyfE]IHcHtDC`$HL$8IcH4LFMlAMLH+$IIHMVL=Ѿ"D$0fM$DEEGfE=LcH=tC`J4MMmD$0ClCPL$EL=h"L$8fA?Lm0EEH[m 1HH$H H]$HH[]A\A]A^A_LL$ IcMeH$HDŽ$ItLEH$HL0DLMI}IM#E>H"LMN$0H+$AfADHEfELcLrS`K4MD)HI|KAL$LD$0LcN$L)L~ME?iHL LM8MMJAQIy8I:HQLLT$01Ht$0L1H輷IM9GI}IUH/tEL9GI}IUH/t.L9GI}IUH/tI9~GHzHH/uHOIQ0L|$ HD$IcItLM}M_MHHML+$IJ ~HHHIAdHEL$EGM9$eEE9D$eML$IrLM OM4HI9@#IHDŽ$INIH L;I NHQLY(HQK"LMFD$0H+<$fEHDEfELcHro{`NLE"MM~$0L+$@fAIDfLcL{jD[`K4MM}IH GMeI9OkOLLI/I:OI,$OM]M)'EL "LM~D$0H+$AfAA9HEE fLcH5iC`JMM}MeILLKUH;dIfI/OI,$NMMM&EH="LIv$0H+$AfADHEdfEZLcL=,iC`OIAMMIMcMQL;q;IM9YbEIAT$IIHcA|$LIMEteHcE|$LIM]tMIcAD$LIMEEt4HcM} ALIM]tIcILIMGAsI)MlNIAL%ײ"MM^$0L+$fE $IDDfE:LcH= hDS`NEęLcH=gDC`B$EAIAfAEE MHcChL+$MIL+{@IEԃ&L@A6H$0NKhMNE`tL%"@fA@pzA$ExxD5f,LcL=fDS`OMAKh(ELH+$H5Z"KhHM~D$0AfA>EEfL5fLcɉC`KMIMD$0LIHHEEH5"LIVH+$HAfAf>EWLcL )fC`OH=H"MMN$0L+$AfAIEfLcL~eDC`K4MM}IIMIHWhHjHB8HjHL$0HLLD$0AI(KI/qKEjE9IL%ALH+<$MFLy"$0HfI$E;MeDfELcL d{`K4MM}McMMMN,M)IL$L)M2RD$0LEARHL LsM8MԌI}?NL_8KDH-NLHL$@LLL$01LLH莩HL$0Ll$@IM9*AIIwH/yIL9 AIIwH/^IL9@IIWH/tI9KKHzHH/uILOHL$0AQ0HL$0IcIHj DGI}HIUI|AD$AtvM}HIuM|AD$AHMMHIUMLAD$A]JIuMmHET$MlAIHIIcHvMeMdAsHE$0LML8"L+$IVAfAEIEfELcL=vbDS`O IAMuH|$IL$G%L+k@ClIDkPD$0EMH}@Ht2HuPAPAH$HL$TAYAZ5H}8HD$0MeIHM}I9D$GKLLLI,$HII/sIIUHEL "MIvD$0L+$AfAA9IEEkfbLcH4aDS`NIAMeI}IH ۿH܍LH|$0_H|$0IH/HI,$HM}MA6H=T"MMVD$0L+$@fDIDEfELcH`D[`NH=O"MM^L+ $IAfAf?ELcL_DK`KMIEM}IHLHD$0KH;!LL$0III/=II)IMeM:A6H="MIV$0L+$@fDIDfELcL=^DC`O IAMcAKIIHMEIELILEJHLjLH AL"LI~$0H+$fE8HD|fErLcL D^C`OIAM}MehILLIH;ԆHYI,${GI/XGI}HAL h"LMVD$0H+$fEHDEfELcL=]S`K4MAo]$0f:A]E&H="MM^L+<$IAfAf?EdLcH6]D{`MNAAOJM1IIL$I|$HH|$0HL$@ٵH|$0LD$@IH/II(IM|$MEH=I"MMF$0L+<$AfADIEfELcH5}\D{`JMIc8HgDMCIAILI~H"D$0H+4$fDHDE4fE*LcL=[s`O IADIM}HLI|UI/AAKEAL <"MMF$0L+$fEIDfELcH5r[DS`NEI,$"EH|$0I}HEL"MIV$0L+$AfAA3IEdf[LcL=-WDS`O IAIcLd$ M}1IItLPI/AYEA>Li"LMF$0H+$@fEHDfELcH5VS`NL_"LM~$0H+$@fEHDfELcLPS`K4MHL$ H{8McNdHxL=wyLL9-AbH LHLLH+4$IHAHM~H="D$0fDDE)fELcLOs`OMAMcLd$8IMIOH5*"MIV$0L+$@fDIDfELcL _MDC`OIAMeM}ILL <I/D$0{PI,$_P|$0 AH"MM^$0L+ $fDIDfELcL=LDK`OMAM}L%wM9{IL;=Ywt L;=hy;I/OEML+$I~L "$0IAfAI$EMeEjfE`LcH2LDS`J4IM}MeILL'I/HD$0-MI,$MLD$0MEMA>Ha"MMV$0L+$@fD IDfELcL=KD[`KMM}I}ILH|$0W H|$0ILMeMVH ѕ"AMMVL+$D If$0DI/HD$0MI,$MLL$0MMMA>L2"MIVD$0L+$@fA3IDEfLcL=fJDS`KIEoE$0IfM:fM~I$IEEJEH"LMVH+<$HAfAf8EHcH5I{`ML ADIMM}IHHLHL$0I|H|$0AJLBEEL"MIVL+ $IAfAA3$0Ef|L5QIHcDK`MIAM}I}ILH|$0: H|$0ILMeM H "A>MIVL+$D I@f$0DfEHcLHD[`IMAM}MeILL[I/HD$0r=I,$W=LL$0MMMqEH="LMF$0H+4$AfADHETfEJLcL=Hs`KME1MAAMMOMoAMAMAMH=rI9yEMMHLALH+4$MgL-+"HIVf$0EEDLfEplLcLhGs`MO IAA3M}M]L%OpL\$@M9guuMcIKIIT$H;rHL$03LL$0IAH;tA3H;u43H;;u<LrLLI8Ht$0!IHt$0LLL$XIL<I,$5<Mt I/<L|$@MWM~H|$DEtAH"MMFD$0L+ $f2IDEQfHLcL=FDK`KETLcL=&EDS`IOAL|$ H{8McOdHL3H q"EMI~L+$1IAfA$0EfHcHDDS`IL AM}I}ILH|$0 H|$0ILMeMcH ގ"ELM^H+$DHAfA$0EGfE=HcLDS`MI4M}I}ILH|$0H|$0I}LuMeMH K"A>MMVL+$D I@f$0DfELcH5}CD[`MJA_BLE1LaLiMBMT$MAAA@A}IMMM;ALLHXLLH}Xv|HUH}@HIClChLcChOdNML+$MIIIM~H g"1@f$0DfHcL@DS`MM AM}I}ILH|$0 H|$0ILMeMlA>L "LMVH+4$H@fE$0DQfEGLcL@s`KMM}LE LIMeMA>Lh"MIVL+$I@fE$0DfELcH?DS`J4IM}HVlII}LH|$0!:H|$0ILMeMWEHΉ"MIVL+$IAfAD$0E;fE1LcH=?D[`IJ4M}IOH; hrcH; Rft LpyLIeMeMA6L7"LMNH+$H@fE$0DfEL5p>HcS`IH5\T HD$0H1hHD$@HztH=%gxIH]t1IHtHD$`H\$XH\$`H9\$p=Ht$`L\$hH|$@I\HOsH|$@H*6sH|$0H1L1^DHHCI9R<HLQHFHD$`pIMLIA 9LgALH+4$MIIHI~L="f$0M$DE]fESL5(<Hcs`MIAIMMMH$HMeI}HDŽ$H$1L$L$k)HLML+$IHAIM~L)"f$0A2DfLcLo;D[`KMLD$McH{8LL\dMHXI@PI+QHtL9Ww|MHwH}X H|$8J4HFHwHMML+ $II$AIIVLd"f$0E8DfELcL:DK`OIADAM}MeHD LHM,M LqML+$IvI$0iELĄ"AfAfA:EFHcL:DC`IIE>LcH=9DC`INAMUH _dI9JqMcM9zqLLT$0L|$@CHLD$0H\$0IHH\$@ILH/9HKHuH|$@HLkKTaH|$@yHIMLIA@/LcALH+4$MIIHI~L="f$0M$DE0fE&L57Hcs`MIAM}L IHoLkH aI9L$uLHHoA>LH+$MeL"HMN@f$0EDfELcHZ7S`NMAH=M M}IHHtLbLIMLLH+<$IVH$0EL l"AfAfA9EHcL6{`II4EtChHHk DT tDS`IuHNHVIH6H/I}1HHmH_E&LH+$MHIIM^H "1AfA$0E:f1LcH6S`N MADM}HILAD$HHHL$0HD)HI|kH|$0$0L?ɼE&H5$"MMFL+$IAfAf>EL5n5HcD[`MMAM}I}ILH|$0D H|$0ILMeM*H "A>LMNH+$DH@f$0DfELcH54S`MNAIcIELd$ IH{(H5oK M|MeHD$0-IHbtHuH;PaLAaHS8HuH+aHs0HL$0LILH|$0M}M0AH=~"LMNH+$HfD$0DfE LcH53S`NMAIcLd$MI8HwZIMJL+<$MVI$0EH=~"AfAf?EHcHe3D{`MH41q^IHMDDd$@HHHD$01|$@f#HT$0MLuLLLL$XE,LL$XLωD$Xl$@D$XHD$0I}MeH|$0aH|$0IdMxcAML+$M}H /}"IIVDf$0DfEHcH5m2D[`ILAM}I}ILH|$07H|$0ILMeM,H |"A>LMVH+4$DH@f$0DfELcH1s`MJDIM}HLI|HHj)@L8ML+ $MVI$0E&L{"AfAfA;E}LcHO1DK`J_*H6uHL$8McN IyHaIAML+<$MVI$0sE&Ly"AfAfA;EPLcH="/D{`JMHt$ M}IcH$HtLHt$@: 'L$MIM MA>L Ky"MIVL+$I@fA1$0DfLcH.DS`NIAH{8HSL%pWL9gSL%D L'Hu?H}X?IH.H{8LHLAE ALx"LI~H+$HfE$0DfELcH5-S`N IA113HHIcLHD$0H H)RH|$0IMnAz$I}IM}MEMcII}LT$@IOLD$hH|$X`H|$XL-1XHD$`H1蹫IH_UH|$@NH5wL@HD$0HrHPH;XHD$0E1L@L9D$@H\$pLH9\$@Ht$0HLLYL;LW#]LD$`Ht$XLHH=3HLHD$xH@H|$xIcLd$ M}IH{0ItLLAEAL jv"MI~L+$IfE$0DٲfEϲLcH+D[`IJ4MMk IEMxLH+s@HAy9U,LIFMnI;M{IINMcIKMVMSHtMtLMNLChFLH+S@HMI}IHtLL"LjMHL$1MA>L=u"LM^$0H+$@fEHDfELcL=r*C`O MADLL"LjMULL$EEQA>Lt"LIVD$0H+$@fEHDE&fELcH5)C`N IAH/ H Yt"E>LIv$0H+<$DAfAHEfELcH){`NIA@H=!UI9 ILT$XLHt$@L\$0L/)LD$0Ht$@HLT$X-H UH9Hz AD$Ld$M$CALkH$I/ IEHA>HQs"MIVD$0L+<$@fDIDEfELcL (D{`OIAE1LL$ McH LSOTI9JbIRHbHG L$LD$XLHT$@LLT$0PL\$0HT$@HLD$X*HI@ L\$0LLLPL\$0H*H$H*M~*A>MML+$HIIMFL)r"$0@fI7DEfELcD[`Le'K4MI/ H q"EMIv$0L+$D AfAIE=fE3LcL'DC`KIIEI,$8 H$IIu颳McM鋼$0J4I)MyLM&HL LRM8MOIB LX8KH LLT$01Ht$0L1HkIIMM9v`I}H/tDIUI9sGI}H/ IMI9I}H/tIHIM9sI}H/uIHwV0IHL!M}DL%qPLAW0ML;=pRuI/ A>Lp"LIvD$0H+$@fE8HDEzLIfE[gLcL=<%C`C$H;=Q*H/n Ht$H $McMDJ E:HD:H=~o"ILr$0AfADE+fE cHcL$DK`A$IKH$H!HIEI/: AH=o"M^D$0fDE}ftLcL F$DS`KMH$H\#HLE1H!HL9I鉭I H)MM(H=LI9{(HVILT$`HDŽ$HGIC Ht$@LH$LD$XL\$0PLL$0Ht$@H|$XLT$`HL$MNGII) I/ M]A|$ DEI<$I~IT$D$0E|$L%m"AfAA4$EEf LcL="DS`OIAIwLV0IM'MoH) MH|$DEGA6Hm"LMND$0H+$@fDHDE}fEsLcLE"S`KEEh9FHLE1H!HL6IaMQLAR0=IOLL$0LQ0LL$0LgM~AT$0A>H5j"MD$0L+$@fDIDE=fL_AS0E&LH+<$L j"D$0HIvAfAEEE0L;QHM9YMyEET$ED$IcI4HIuEteIcAD$IHIUEtLLcAt$K HIMt4LcIU AKD3fE)HcLDS`MM AL%GܶIOLQ0]E&MEM}ML-Ff"D$0IVL+$AfAEMIEME骢fDE&He"MLD$0L+ $IAfADIEEuY@DMOLAQ0YIpLV0@IT$L\$0LR0L\$0ѰIwHD$0LV0L\$0魰I9L$MHLLH~I醰HLE1H!HL0IZIȷM\$LL$0LAS0LL$0IOLL$0LQ0LL$0̰I˶IhLT$0LAS0H d"E&M^Ht$0D$0AfAAEE(@LID$0HAQ0I,$DT$0M\$DT$0LAS0DT$0IwDT$0LV0DT$0۳IwDT$0LV0DT$0vMHD$0LAQ0DT$0SIqLT$XHT$@H|$0LV0I/L$H|$0HT$@LT$XIOLT$XHT$@H|$0LQ0L$LT$XHT$@H|$0LAHAP0OIOLQ0Huc"AMND8LH+$Hf$0DX۟LwAV0IյLXIuHcMUA|$I4A-MMMmLcE|$O,MAYMIMWLAR0طIL$LQ0FHGP0/MGHT$0LAP0HT$0sIL$HT$0LQ0HT$0OMO$dNHD$0UHKLlLHD$XHt$XH9IMXLAS0AE1HwLT$@LD$0V0LT$@LD$0I(MI*IJLQ0MMIEMeII|$LHLL$XH|$0HD$@kH|$0LD$@LT$XIH/umIL$H|$0LQ0H|$0鲷ML$LAQ0ͺIOLQ0鳺IAM+ALLHH)ƃ$0L$HL$@LHHLLL$0cHL$0Ll$@IIUHD$XLHt$@R0Ht$@HD$XH.?LNHD$@HAQ0HD$@%CPClfL'L$IcHM4 ȻLI/LL= <EMMFL%["L+ $IIAfAE$M}$0E8fE.HcH=DK`MHIGLP0齶MGHt$0LAP0Ht$0馸MT$Ht$0LAR0Ht$0選I|$t H9?LL HLIOLQ0鰴MGH|$0LAP0H|$0鯵II/ EHZ"LMND$0H+$AfAD:HEE7fE-LcH=C`NMAIT$LR0ȴIOLT$0LQ0L$LT$0MeDHMdBEM<$MMl$L+$L=Z"MVIAfA$0A7EfL5VLcDC`KMIOLL$0LQ0LL$0@H׾L H8HI15 H5H{0LA!HH}XH{(LL95A!HrH}XL;LHmHI3 H\$pH|$0#E1H\$0LH|$hH;_LH\$0LHD$0H|$`H|$hLd$0MH|$XLd$0Ld$0MeLLd$0L|$01MIvM@_L+$I$0IEAHTX"ff8DٔLcH= D[`NIAL ^6LBH1IOHJaI1 H|$0H|$`LH|$hLeXM2JH5;:HH64tH4oHD$0A@iH|$@Ht$XLc!H|$0Z_L5IIOH=L ,VH`t$HLEI2H1 _AX<$hLD$`LHHt$XILQH\HLHD$@H H|$@MGD$0LAP0D$0L 6Hl$0H\$@I1H3@H3E1H$D\$0t$0t$0H12LD|$0EAL%SV"LM^H+$HfE$$0DfELcL S`O MAD$XAEL$EAD$9:RIE1HLL$HLI鳔IT$LR0IOLQ0H$McMN48黸IL$LQ0&`IO1H9aM\Is2A@2HHWD$0R0D$0BH|$0LT$XHGP0I,$LT$XMD$LT$0LAP0LT$0I|$H|$`H~$0;LC6LLI8Ht$0IHH|$0蚿H$ML+ $I$0M^I}HDŽ$E&HET"AfAf8EȐLcH5 DK`NMAMgLT$0LAT$0LT$0LH Ch`LH鐮HE1LHL$LIAD$EIT$HS"AfA$0I<$I~AD$2EMAML+$M<$IMmM^L=HS"f$0DEŏfEHcH=DS`MH4H$HE1LHHIL 3Ht$DHCCL50HI6 /t>IGHu0Lu$H.IOI6HHY1HI7 LH5 LKJIH[EHxBEHT$@HH=Fg1eHHEHD$0fH|$0H$H$DH}XDLfLd$XHD$0H|$0YH .Ht$@L1H=_\zeHt$X1IHgM"L藼L菼E1O|LDMHLL$09 LL$0tYMI}H/t]IyAIH/t%EI}H/t/I}IAH/uLWAR0L§LbHwV0HwLL$0V0LL$0It$LL$0LV0LL$0-H dxLLͦIL}@Mf},\Ls@Hs D\$0L$LLT$hLePM)IDkP-T$0H$Ht$X<T$`s`D$0<6t$@Ht$XHc|$@LD$ht{TtL$`9<9D$0u6{U1CPMcHH<$O,LwfD靌L-1QLLAHHAULD$@{U^_t LD$00LcKPHc{`CPL[@HH<$O,˅tEAzA֋A4̋AH‹L 0AXtH L}EWXEJ E_HEK+LMr+IeH}X99̹I|$IwHbS HLoHT$0AAU0H|$0LoHH/pM LT$0IRALH5 :FHI迶L8QHQLDMtLL\$`)L\$`Ht$@HL$0LL1aHT$0Ht$XIHhcM) LL߸H|$0E1ҸNI/IOD$0LQ0D$0H蟸IwI|$HmQ IGHOQ0ˮL-LID$LP0@L_AS0MgLAT$0NH $McLM"MN49AEMFAfA$0Ef{HcLMIMI4D{`ItL@0CHM_H|$0LAS0H|$0鵫AD$|LH `L裢H颩IwLA`*A@uL;=.|*LE1BLL|A$@MLKIH_*L@A@>M;Et8H7 H0H;5 .HPHH;H:HHtHHHAuM}IM锽H}@Ht.HuPAUE1H5-HL$A^A_K&H}8H,RA騽IL$H|$0LQ0H|$0,LH P_L/HLH\$XLL-IH|$0LD$XصH|$@εLƵHD$XH EML+$IEH J"IMIVD$0D9AfAH;,EH+IHIBEچfEІLcH5D[`JML+ $MIM<$MmMVH6H"@f$0D0fLcL=|DK`OMAIPLT$0LR0LT$0dMOLAQ0RAGLK0HS(E~QfL:"RI7EWZH}XL%C*LH\\HI4$ ID$LP0IOLQ0IOLQ0EMT$LAR0鐯IOLQ0v1}IwLV0L_AS0L(M8Mz$MoAMMVL+$Lh8IfIGHF"DM$00CLHOLHH@鵢IMLxpIAH Y#HH1"޸H}@H H"/LkL$McMO4A>L%F"MIVL+$I@fA4$$0Df{LcLMDS`KII\HLHL$0蓋IOLQ0IAD$Ld$M$CALL$AD$IFBM߁LHLL$@HL$0FH|$@I9L\$0L,M̲醷LHHL$@LL$0 H|$0IL\$@MtL%#HL$@LLL$0AH|$0I̯MHL$@$MBL%'L%(IIMWH|$0LAR0H|$0JIL$H|$0LQ0H|$0&LH XXLmHMt< LcHL$HHH|$DEslH|$HcHD$fLIծH\$X0 H\$0Hl$0H\$@H\$pIH\$0-+2n!6 78ff.AWAVIAUATIUHSHXH$HH8HOpHHHT$HL$8HsH1M;LG8fHnI$fI:"Ix) $Ix~MhMUAuL-$IEH= yHHfM^HPA g;M~ HL$HLAWH_;H\$HHQ;HH= xHHt.INHV ;M~ HL$HLAWHHHr;H|$LGMv:H\$0Mx(MN;H&IfIn1fI:"Hs H\$()T$tHt$(HHHsHL5EfEYHk0fo\$fH{fo$$Hl$0LkPH"L-"HHCHHCXHC`HkhHCpLkx[c C8H8LCLyAIHrfHnI H>fI:"{HzHXH[]A\A]A^A_ÐL|$HMIH;=uH\$0MH5+uH$IfIn1fI:"Hr HT$()l$sH8H\$0Ht$(HLHA{9#989T8HG9HGf.QHG9Hx H9w~HDZHH5PUH:1ZfHu`AUIH?ATIUHSHH!!H8s HKs ;q@2HHGHtFG W9H}LLЃk H[]A\A]H5'JHHT$2*HT$.91АATIUHHHkuHD;HLHH]A\ATUSHFHLg&;I$H;Hu@1>HHt []A\fH ) H8[]A\H~XH@H:HHuH H:辕t 1몃ff.AWAVAUATUSHHFLw:LIIM:L_HHHMHEHHt>HLLHHmIHL[]A\A]A^A_DLLIHIt$I$LHmtyMt1LLAI,$trIDLLIHuHLLHI7kfLLuIHtPHPHL@LEHAP0wML$HD$LAQ0HD$sLUHAR0H&IWL1H5IH;nuIHGHff.fIAQLWHw9IIQH9LLɴ\9I{(1LGAXIE1WAWIHLAVAUIATI?IUHSH(HFHX8L<MMudH=KI9UL5=HuI8L}0AG$91E1MLgH1H(HL[]A\A]A^A_e6DIxtLD$LL話IH39LHL$HHH?AH\$ILkMI>H/ItI~H/ItkI~H/ItWI~H/ItCI~ H/It/I~(H/tYItIdAXAYH|$P AXH|$uBHdzHȭHELAA9tALAJ.H 5zL=~mH Ht$H;LT$ ADULMSHHHLL$8HD$8(\.Ht$HAQLL$@&ZYHuHT$HH[]EAWAVAUIATMUSHXL6L$EAC<8 7HAH\HHc4MFHAv;@!@&a /w0ALK;M!M,$LE1HX[]A\A]A^A_L{IWHSM7M.@/AƃLsLHt$HLD$M>LD\$HLD$IE II^ I5 E/]AV*;1# /xAƒLSIAz0MuH=UAHt$HLLL$LD$ Ht$LL$HIWHHt$|eH;D$H[6LD$L;LL$1A˾L U H;LD$D\$I9X sDT$LD$LL$/ЃHCA~#LAZ5M}A#/LHt$HL\$LD$U Ll$HIEH^H;D$HB4LD$fDLsI~H{3/ HS3MUL2A A} H5M.DA/DAHSDLLD$L:/LD$HIHLD$LI薒ILD$M7"3/ALK3LLD$I踊f.`LD$zu2H /HA˃L[ LLD$M34LD$H HH=A;/AL[;IEM3-A} -I}V AU  -@I0EeE&3/HK3LLD$L14LD$HHH=wH=PfA>D A/SEAL[D LLD$M; LD$HIlM/hD;A/0DAHCD;LLD$Hf.LD$zGZ;/AL[;LLD$I13LD$HIL DA/EAL{DA~*I`,LMvHLT$LL$Lt${H|$T2H|$CHLHt$0Ll$H LD$MceE\$IMeE]I$IL$.D3A/EAL{D3LLD$I LD$U;/(HC;I]H/L);/AL[;A~*I 'HT$HHLLL$LD$HL$V LL$HIr'A~#Ll$LD$4'I}HD$LD$_Lt$L9t*LD$/KуHKLD$MEL1A'LS LD$I /AʃLS LD$MEM:Ay'LM LD$I/HSDGDLA/L‰;I]MFH2LXM~MVM~9M9^tZIt-M9^ tNIt!M9^(tBItM9\t0HI9uI{LLLHX[]A\A]A^A_w L.HKHQHSLLzL{P@HSLzL{HSHBHCLKIQHSuL[IsHsL[M{L{HKLQLS]L[ICHCL[IsHs'HCLXL[bHVL LHHHH]fATUSHFH_HIHHH H9u11Ht[]A\fHuHL]1f.AWAVAUIATUHSH(Lw MHFH~ MXMI\$HIUI9T$I$AKLLIp ]H=>H9} HUHI@ HL$HLPHy'H @H8H~X,IL9H|$HtLLOHHMMtIuLL9tZH|$AH|$H/tlI,$t)H([]A\A]A^A_H=L8IxXtIT$HD$LR0HD$1HAI9T$ ujI$L_HD$AS0HD$HLD$CULD$HHH5uHu,MXMVII9tK9Ttff.UHOHHWHAHH H HAHGHgHHt H/H}Ht H/H} Ht H/H}LnL@M9HEHuHuiH-JL8MHA~AH=# ]%# H=" ]%# HwV0cLGAP0iLOAQ0oHMHPHH HHPHEqH]Aff.ATIIUHHH8HuII?Mu{M HUM ;J@QIt$HFHt?F I|$1Ѓm H]A\HT$HHHԻLD$\1H5tH uSLLD$ IHtH=LD$H1H6H7H LKn1u@HLGHAsH1HHIH9HOH9HLL;AH@At H9NH)H|HuH~t5QHOHH9(AE1H5(H98DZE1HuDHB tHzufSHOHHWHAHH H HAHgH`HGuwH{HsHuALM8I[~H=c [%v H=O [%h LCLOIAM I8LOHCϭH|SHH0HtHC0H/H{HtHCH/H{HtHCH/H{ HtHC H/H{(HtHC(H/H{hHtHChH/H{8HH{@HH{PHtHCPH/H{XHH{HHuH{pH1[fDHCHH/uL_AS0HGP0HWR0HOQ0HwV0 LGAP0.LOAQ0MWE1rL-pH nLLD$LD$@ATIUHHHHGHvH9uIt$(FuuHH]A\HXHLBM~9H;BtIt-H;B tIt!H9B(tItH;DtHI9uL覷yZH1HH5H= 7It$(^HHH"H97HLZ]A\fDATLFI~EFH_Hc Hf.M MtqI$LA\DM M}LI$A\ÐAA\A8A\隄I8A\鐄Ic8A\醨I8A\kI8A\@I8A\gHL 1HH5HWI93lL%8w11ATIUHHHHGHvH9u%I|$(G1HH1]A\wHXHLIM~?H;AtIt3H;A tIt'H;A(tItAJ;DtIM9uDLHT$裵HT$ijHHL]A\HRLAIL$DHHHH9fATIIUSHHHHH8HuLI?IuyM HUM ;J@OI|$HGHt=H3G I|$Ѓm H[]A\HT$HHH}LD$t1H5!H1 uLLD$˻ HHtH5DLD$HHHZ1H6谒 Hc1xAWAVIAUATUSHhHoHE1HIHD$HIAHL$ /LT$LMZL\$I:sL|$0MMYM,$AI9}k J4I<4/>AʃMiLS MLI9}9MD4/7HKIHqHsLMI9f.H]LK8Nl M1LHA1HLHM9IHhL[]A\A]A^A_Íp‰t$H< IP/v4LL$MYL\$I9IPIKHL$I;x|$H<1IP/H|$L_L\$H?IPL[IMkLkMLI9ǃMQH{HII9D+M\4A/EAIyLCD+IIH9 It4/$LSIMZL[M*L.I9rVDHDL$H<9IPA/w@ D$J< IPDT$A/wdEZD\$J<tnHHHt$L^L\$H>lIPLCII@HCI8I;I9Ld$M|$L|$I<$HH<HT$dcIHHT$L|$0E1MAʃLSI MLI9ND+A/wJEALCD+IKII9#E1H?E1HLHLP9H{HwHsHK II9IL$HHL$I|$ HLAHLD$H9QLHD$fLd$Lff.ATUHHHL8HOALA rHtAHHL]H1A\ HuAHHL]H1A\Hzt6ff.fUSHHHLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HCHkH$LD$ $ Ht$HD$0LD$t@H~6D$HsA/v5LT$HCI MBLD$HHuwH[]L\$DH{AR$M I9Ht΃/wjMHK AB$IHt/vvLT$HK(MIRHT$IHtL\$L LBNT I;LL90_HD$LK H8LXL\$LH=ILK(AD$L HH|$1A/w'DHLHAMIH9LLL_H?HLH9tD$L\$)ff.HH9|jH9~Hu HH LJ@HL sPMDL H9VHH=MD1IH5nH?L*ZY1H?H HL TsAPILDH9H VHDH+HH5H81)AY1AZL@HUHHHOHvH9uBHw(HFHHaHv H9uHEHH]HH]fDHXHtmLHM~;H;HtHIt/H;H tHvHFt?HT$Юx-H|$HuHHH[XH=H1c fDUHBHSHHHg H>HvHVtEH~4HT$RuHCHH[]HD$H[]@H[]H=>H5H?x1ATIUHSLNHHwLs Hs(L[H]A\ ff.AUATUSHH^DnHADfHHAYHpDHc H@H;HEH+Hu{HD[]A\A]H=CH9} H;-H H HHH9v Ak AA H;HHtV{L4H5AI;w\ff.AWIAVAUATIUSHHLwHI9HVI=L誠HHHuHEIT$3L MtqHD$AMO,MtGIELLDL$衲DL$HImHQH8H~XEH+H[]A\A]A^A_LLH1H[]A\A]A^A_fIT$L MHD$1E10HHImH1H|$uyHH+1fHHL$Ht/Ht9LHHHmEHm18L MtE1L MuIT$LHLd$AHH1Lm@HIVL1H5H;"LLT?1LDL$PmLI8HxX DL$N AWH?AVIAUATUSHHHcH8HQ IIHwIIULJL9IwI}[HHM K HsK 9N@MV(IBHLI}L9  HWH|$ LD$HH|$ HD$HT$0LHD$(ēk HmtPMHH[]A\A]A^A_Li`uLL:xIwI}ZHH!1LuHD$HAV0MHD$t LHyH5^Hn 1_ f.AVAUATIUHSHH>t(H|$LHl$HD$H[]A\A]A^@Af<}tcf fZuLY DMk@OtLi8MtHMI9EuHLLyH9u@LL)i} H`H9)PHHQLPE1LM9MBLM9IBE1HN8L9BB<8B<~ID~MIHfE83EVHDHHfD[DhfDkDPfDSDHfDKI9w~HrHHD*HA@9AL1HHILL"LOH@KEA@SLb0Ll*0IMHOLL)HILI9rEImE1L4H9MBIBE1N 3IK\I9 C|CLHuAH;H5+1MtL@HE1@[L]HA\A]A^,H;H51fHhHGH@HH?AVAUATUHSH8HIHILGIHrI9uxHOI@s L[s A;s@HE(HhHH~KI}H9uKk []A\A]A^1Ճk []A\A]A^LXMtfMQM~CM9AtIIt7M;A t=It+M;A(t1ItM;DtHI9uf.HxXM$HHHI9t IHt#H pH1H5H9 L,?1H5H u"H5ѷSHHHCH j IHtHHHX L[ff.fHH H5 f.ATUH1SHHv IHHXHPI$HuHEH;\@H;Il$AIt$AIt$0zH;6mID$ H;tWID$(LNIL$M8IkHHSfHnH ID$H fH:"AD$HKL[]A\H51HXID$(Hu!H HyUHIHHt)=H]aHGH-USHHHHH9OHp(HW H<Hh LMH} LU(ILROMH9MZM;IzHs0fHnfI:"H_HC(HHHS Hs0HIH8HXHh HxLX HH+tPHmtbHxH[]IJMHkIMH9WHCH<1H$HCHP0HmH$uHUH$HR0H$늿)$=Htfo $HtH9~LP AIJMZ(H}LkIMJ|LHjMJH9PMZ(MtFIyHH uH5H9[HC1HH$H$HjMJ0H9MYMuHIH9DSHHH6HHHSH8H;VuHHH[f.{xuHH[1[@HIH8I;puHL;ff.HGHPhHt HB8HtPZff.AVAUATIUHSHHBH;KtYHO HWO ;J@2LmMHUI9T$u.k H[]A\A]A^DHLH[]A\A]A^1LHeuIt]HU I;T$tLH@uIt8AJTI;T$u |LHiIM9u1YH5м HIHH5H]piLLRk LI8Mt1L~GLD$ 8D$ H5-pff.fAVAUATIUHS1H9]~aH|L9tOLIHtQH<I9FE1L;5ȭAI.t"HEt[D]A\A]A^AE1LQA@ATUHH9tDoHHtaHȩH9EE1H;-TAHmt1HD]A\fDuAHD]A\ÃuE1HPAAWAVAUATUSHHۭL8H6HH*AL$ LcIT$HAL$ ;J@ LSLMM9MMt?DHHAH;tAl$ H[]A\A]A^A_H(LSMMt*L?IcHAHAH;uH(AuH9HHAt=L[H}HHHuJ 1LGMKLH3d 1AH9oHMXMtWMXMM;Ht\IM;H tLIM;H(tELA%u]%tKHuHL)uƄ$H|$`L 9D;EILA%uAFI^<0H5DE1BI<.SH{HK0LcH\@IHgfffffff0LcM)LI?HHL)I9OHk 11끺ff.UHw H/Ht-5Hu@HH;ut8HHU]馸HtHHuHHH]ÐAUATUHSHHO Lo(Ή@ @%Le00HH%HH9HS`HH`HH=xHHLOEHE HH HXM9Hx(H ʉ u+@@D0H[]A\A]fu}@@L`HfA\H}8L9t HMH2LeHHHHHHLhHADj@@L@HAGʃ@ HhHHh(HX@y /@LP0L9HD$HD$H H@(@HHHH=%@AWAVAUIATIUHSHHHF@H)MH+I$IH9tHu IpH$MpI9tMuCMtIL$@1HHEHLH[L]A\A]A^A_IM?IT$@u0111LrLHLILMMEM97D$MLHIHLLIt$1@ALH1fDMHIHH9H>HtH9u LFMuIMMt I9MPMMLL\$jHD$I9RI9>|$u-t$H111LA1HILHD$HIHD$ff.AUIATIUSH(H-9HRHuH8HxX.H8fHQXHq`AXHyhHAhHL$HT$HT$Ht$Ht$H|$H8HuH|${Hl$H}HuxH}@uqH=HHtRLHqXuCH=Ll$\HHt*LLIXuH8HL$HT$Ht$H([]A\A]H8HL$HHt$@H)HH8HzX fH:AUATUSHHHHFHHHMH@i@\P@CLXMMHM~:I;XtGIt.I;X t;It"I;X(t/ItAK;\tIM9uH1[]A\A]fDH[]A\A]HqHPHE1IphH2I@hA@Xff.HiIHHLH8@AWIAVIAUIATUSHHG$$M'MI.HID$A$@HM@u=HLHHmtsM'{$I{$H[]A\A]A^A_@HHH8LHL$:xSHt$tL9T{$M'I.H-HEDLEHH$AP0H,${$M'I.uLH$D $A 1LSXI}fML[`MHChIEHChCXHJ<$"ff.@AUIATHHH;5UHFHHt$L8M HOt Hq8H7HuGLHT$E1LpIMtI|$@tMHLA\A]LfIHt$1HL1LH^I1r4IL~HOL1H5NI8LE13뇐ATIUSHHHHHD$H$HsHt H/HH:HI1LLD$H i H-HmtLHL$Hu`H{HHKHHH4$HuAH{@Hs@H1H[]A\HGP0qHUHR0HL$Htsi@HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HXHGGHuJH9HtaL$LT$ I$ LL$AD$0LT$3HLFA HHuAWAVAUATIUHSHH<$H$HHt$(:HT$XLD$DL$ HD$pHD$x>HD$0HLMHHD$@HD$0MA9E1A9kEeMcJLLHtv9NEeMcJ\LHtY;1EeMcJtLHt<>EeMcNDLMtA8AMcNDLMuASL$H|$(MZ{M9HD$EHt$XDl$$1MHt$H1AD$Hl$8Dd$ALL$XLcEA|A$JAx@jEaEI9rL$I|HFLD$XLD$hA8(cHt$hHALl$xAUL$0HT$(L$Wu_AXHH|$hE1H|$XDuH9\$8DDDl$$Dd$Hl$8MHT$X2@;@|H|$7D\$|E@AEMi|$Ll$XaEAA$AD|$\ILL$X9\$$EL9EAB<EDt$H|$At9\$$~^E9H|$)\$|$HĈ[]A\A]A^A_fDILL$X9\$$:AfDHT$8H|$(H4UHHH H8H~XA9vT$ Ht$H|$HHE1%HH\';LCLMHHHD$@ME1E1Hl$lH HD$pHD$|McH|$p$$L|$(IGM4HD$M9|HLAH-HDL MLEH|$0L-E uLiILT$0Hk{AVELUHT$@H5H81H$Gk ]A\/H|$pu9\$$=Hl$8H|$0ENH NDuL=H L|$0LzHT$0H51I:dH|$pj MDMHcL9iMcH\$`HD$`NLHl$hL $H|$(1HH芌jH|$hLwARL<$EE9I7I菩uH|$hAILl$pHt$hLD$hL$LD$PAUhL$0HT$(L$2 AYAZHLt$hE1ILt$XEAL SHIDLAH-H O LDH|$0uL-iLLl$0LkyAWE1SHT$@H5I:A[[H|$pJi 5L$DŽ$Ld$PENLD$@HL$0HHT$PIcg Li LMAMA9HUAH:ttIcLLMEAMcAH|$0HLL!LT$0HvxHL$0H5H81H|$p^h IAIcHTHrLtH|$(I6H]QH@ZAAAAL^3Dl$$DM[ff.H {IHHLH8ATfUHHzH8HzXHj`BXLbhHBhHuHu%Mu3H]A\H/uHOQ0אHmuHuHV0XL]A\UHOHHWHAHH H HAHGHgH@HtHE@H/H}HHtHEHH/tH(EH}L'L@M9L]HuMu\H-yH8L@A~AH=]%H=]%HwV0jLGAP0tHMISHH LISHEH]Af.UHH@Ht HE@H}HHt HEHH]7DUHHtdHH= HHtMHgHHt=H;wtQH;gwt H;vyu1Hmt"H]HHmt y1HUD$ HR0D$ ߸ff.HixIHLH8AVAUATIUHSHHRH;wH9uH[]A\A]A^fDnHN]HXHH~H~=H;ntHt1H;n tHt%H;n(HtH;ltyHH9u1rHtgH5ְm8LmE1M9JTLHt k %IM$ML9uH5k HsIHH5TH7rLLuk LHVHWHHD$ 9D$ AWfIAVAUATUSHHHvH8LhXLp`@XHhhH@hGdHW Dg`B(ExEHJxL*DD$Hq HILD$fHnΉD$ HHt$fH:"L$(efAnf:"fT$HLqM9WL vIs 1L$IHH$HPH5|qN I$HID$II|$M|$L|$M|$ L8ID$IT$LLMHMMZfInL IfH:"A\$IRH8LHuG1HH[]A\A]A^A_LuL9]HvpI9GHEIl$AH@1H=pHDO`G$ bff.GduYH`HJ A(xHH8HqxL(D$HNLF HL$fInD$LfH:"D$uH8ff.@G(HxJH8HJxL (HD$LA HIL $fInD$LfH:"D$H8ff.USHDFD9|JHn fAHFH9snDHD‰VHHFt"NNND9t 9~ŋ>9|1FH[]FD9uHHt$,aHt$V9uŐHGXfHHw`H2HWhHHGhGXf.HH{H;5|st)HrH9FLG HHw Mu1HLG H1Hw MtL1fHHWH;5stHrH9F[LG H1Hw MuHLljD$ D$ ff.@AUATUHSHHWH=H_HrLHH HHrHGHgHL9G0]HqL8ME$A1LUAE$MH}Ht H/HEHuHH8H}DE~NADH=6Mt&A$I$A$tH[]A\A]H=٭MuL_AS0iMMLMN@HOHH9A0HMHPHH HHPHE$ZH[]A\A]. X[]A\A]/ fAWAVAUIATUHSHLvIiIHM~\1L=ID$HtIL SHnH9VuCLHH Ir8LDHt#AA 4MHIL 8LDHuIJ|-:t=MmBL-HHIND8eHMC4UMu5IHHLIrfIkHKHL1LHIH CHEATHGtHILA\HP`Ht HHu!H=tVHPH5y1E1H?IHtHpH;5ZtHVu(L /VH5p1I9趰LE1uL7XH1HnI8 M|fHxH9w~ HDHPHWH5H8D1ZUSHHkHHOHWHAHH H HAHGHgHHuFH{(HuKL XM8MZA~ AH=iHH[]%zH{(HtHsHtH{LFHAI H7LFHCf.HHHHHŹHWHHHff.ATUHSHHH;5XHL%W1It$ iHL`A$HfSJLWH=HH@ HEHhHHXHXHx(M8L`MQAMIkfInI H]fI:"@I[H[]A\HEHH5RI$~h騸飸fATUSHHL%VHH1It$ fHL`A$HcRJLVH=HH@ HEHhHHXHXHx(M8L`MQAMIkfInI H]fI:"@I[H[]A\H5QI$~r޷ٷAWIIIAVM!AUATUSHHhL5UM8HGHoHD$(HH}LnL^HFIHw8HD5HHH9I8Lu0HuM!AF$HL1.H1HLnLkHh[]A\A]A^A_HMLH_L|$0HHD$0MHLMEL]MBAI[8HDHHXH9I8Lu0HuI?AF$L1fH1HLmM93LHD$@HD$LII6fLMAMi8N|-MH I9I8LU0HuHL$(AB$1E1A轝H1HL-mLMLHH?Lo=lH<LL$LT$HL$IHHL$HT$(L|$0LT$LL$HHHjI}HMBL]AhLLMHH?LfDIEL{LXMMYMM;QIM;Q IM;Q(IM;THI9uL-;<DImeE1IELP02L-;DL-;HtL-;E1L-u;I9tHF`HtHcL4MtL-O;L-C;L-7;L-+;HHI9uLHAL-;L9(HBL-:E1Jff.HGHVItHwMHHNHwMMQIwCHtUHt ItMtAxHc~ fD1IuA+xHcd @Hx+LMx3NfDːH):H@MxHL9 9PLHtHXH@UHIHHwHHFpHH@H1L]AVHBAUATIUHSHHHL6HL-=HD$I^H;;HCxHLHHH] HL$LHSHHuIEHL[]A\A]A^fHT$HtHIH[L]A\A]A^Ml$UfDIVHzVHE1H= /hx% *HGÐHGff.HGff.USHHGH-=H1Hu 4HHhunH77JuwH=Y;HH@HHXL8HXHhMHMMZfInL IfH:"@IZH[]H56HE~t|w@LGMt5HGI;@}IHH4HHGHHDHGI(t 1H@HIPLR01HAWAVAUATUHSHH_@UHWHHOHBL-HH HHBHGHgL9k0NH5:L8M+A$1A$L9k0LM9n0u MM9n0tH&E1HxAHIHHxEL{0M9nH{LM~0M9uI~MM~0M9tH Lmt2I u(I HtH\H;HDI@AmdL M9QHUHH@H9H=ouHuImMt&A$I$A$tH[]A\A]A^A_LMMIMHMU(MU IIIJ\H;H&H/HLmI@IHxN邾DHLpHH=ImLU0L-L9k0U銾f.HADHI7LEH8LMHAAHHwfHnI LfI:"ELGAI)HcL_AS0LmHxQHQICLEMII?H)饽HB)HHtAL-}M9L}L"M@M9H= sH"sAXH[]A\A]A^A_y HHxHugL hLC0M9t(LuAt tJZH[]A\A]A^A_AH^[]A\A]A^A_ HAHA -Cv3@AWAVAUATUSH8HHGHHL'MHH:HuH8[]A\A]A^A_HHT$uHL$H9HttHH1Hv0HHuHT$Ht$ H|$(#HuUH]HEHHtH}~ HH2iHHT$Ht$ H|$(H8[]A\A]A^A_hH<E1ܿHT$Ht$ H|$(IHI9}OH}LEfHnL}0fH:"MzLIHLEAD=HEHILMuI9}IvHtI>shIILQ2ff.SHHsHHOHWHAHH H HAHGHgHHuYLz3M8I[~%H=;pH[%Jpf.H=pH[%.pfDH/uHt$HwV0H{Ht$HtLCLOIAM I8LOHC`ATIUHSLOL; S1uIH]H1H9t*HCxHHHHtM[HL]A\oCHUHuHH51LquH5.I9I<$t閻[]A\fATUHSHHHGHPhHHHpHHH5 ? eBHHuhHmHH[]A\HIHIPMtkL;%d.EMD$ABLSLHD$HD$HyKH:\HHyZH9uLLY1I8H-H0H,H,H<HGHPhHuHHpE1HuDH:AuE1H9AHHGHPhHt HHt ff.HGff.SHHHHGH9CHK Hw LG(H9IHQIKHt LdL9utH9KDLdHQL9tHuQH9|jKD HQL9tHu9H9|RKD0HQL9tHu!H9|:HHHIL9ufDH{(fHnLGfI:"C H[HHHCHK "1[ff.USHO DF D w@:LO0A A@tGHoH^LV0H9ILNÀuG<LLLYƸH[]LVHHoH^H9ILNŀtM<K<E1K4H9tZCC I9t<1I9t/E9A zHA9tr@t H[]1H9UD?F<K4I9tEAA9LOHA 選1I9tAHA;TtLOH<tq<tMOM9kAA9N1ML9EA<HA;|RtLLL7ƃpȷK I9EE9G鼷ff.AVAUIATIUSHHH0HH{hHLAԅ#H{8HH{@HH{PHfĵDMHMHGHHGHHHHGLsHHGM-f.HHHIFH{XHIFH?DHHHHGLs HHGMZfIHH@IF"H{8HIFHj DHHHIFHIFLshMfHHH`IFeHIFLsM]bf.LAkDHIH9 %]LsM鞳I9u31I9u+vfLALAH=H9uA% H H9O%%LYM9%=H5)H9A%|LL9A%LL9u\A%H-I9u,hlf.LA DLALH|$AH|$ L1LWLH|$H|$H|$H|$=qAUATUHSHHHIHt!HH9HW@0H`HHXHLL9utLOA@LPMM]A@0LMtIM@HpH1H[]A\A]LӅuHPHnLӅuHHtLӅtHӅ렐IHHHG2LPHHGM*驱LHMHGHHGHHHIEHIEIHHuTIEHIELMLL9%NHH9~A%uKH I9ur% @H5iH9A% HLH[]A\A]LH|$H|$MH|$AH|$LPMH=H9LLӅLxff.ATIUHSHHHHtHH9ujHW@H{HubH{ HH{(H8L_L9uJLOA@u^H{0HtzH[]A\fDHՅu`H{HtLՅtLLՅu@H{0Ht5HLH[]A\IHHuIHGtHHGH{0Hu1H[]A\HHHu9HGHHGLL9uC%u-H rH9u1%uLՅH|$H|$H|$H|$fHHtHHH H9uHO@u1DfDHHHuHGtHHG1H5H9uDAEuHH|$H|$tHGtHHG1Hff.fAWAVIAUIATIHUSHLILH9u'H 8HkHHHH9tL M9 t5I}L Mt%K|HtHI9u\Wu:It#HH I9ubMWA@u4H1H[]A\A]A^A_f.LAօt@MHMulIGtHIGfLLAօt먐IuHHHHHG(HG MHHI<H>H I9%|@HI9%w2fDHLLL[H]A\A]A^A_HCL@ IHaI9Axu1IpI|5Ht#L$L$HH SHAx0u1Ix8I|=Ht#L$L$HH pHAxXu1MH`K| Ht#L$aL$HfH .HAu4MK|Ht#L$L$HH HJAu4MK|Ht#L$L$HH ?HAu4II|Ht#L$L$HH VIHAxu;IxI|=Ht-LD$H4$6H4$LD$H6H HI(H9uZDE1BLD$LL $AօL $LD$HH JII(L9AxuMPK|HuII(L9uLA$AUATIUHSHHHH̩HH9u4HO@uiH[Ht H{@u51H[]A\A]@LՅuH{HtHLH[]A\A]HHHu3HCtHHCLHMu5HGtHHGvL6L9u4%ulH5I9u%u6HH|$AH|$ATUHSH  שHGH97HKH H)IH!O  @DLNd0<ĩEI#O HM9A84$IID$L92A:t$ID$I9&A:t$ID$I9A:t$ID$I9A:t$ID$L9A:t$tuID$I9:tcHI9uHH []A\H_HHL$;< <LLE$ Ff.L)HtH H[]A\LL]oHHHtHL)HdH H[]A\HO1HBH9H0H'HLLG롉DLLuDܧ˧fH9H8HBHtH@0@ATUHSHGHHP`Ht LMu!L%HHfL9t[]A\AL%rL9uLEL;HuH{HX[]A\s; HGHVIHwMHHNHwcMQIwYHt)HtDIt+Mt*A+xHcf.IuDAxHc@1IuHx LMxMx%QLmHtHXZmHoHHL_ff.@HGHtSHwHH 4HC[ff.HHHH=ff.AUIATIUHSHHHw 1hH)L`A$HJI} fHLhIEXHHxH@ @8@HHHX(HHtwHh0HpHEH-H8LHHJALIxfInI H7fI:"PIpH[]A\A]H5>I$~NɧħoAWHAVAUATUSH($HIH@L-Lt$LM9E111LLHl$HH;-HjH9H;-ru(HmtwL1HHH([]A\A]A^A_HHmtVbLAHHLݞHH`HHMHQ0zHUD$ HR0D$ y鞦H+UHsHV0FHmLEHAP0H\$H;tH΋ HHD$H40f.HHUE111HHT$Jt HD$H]Hl$H;-t HU HtHD$H违ff.fAWIщAVAUIATUSHHHL8HoIHL=L9H@@t }`s}lMgLcUPL]@IOXLaIDH H8%H-H9ku AMt ʢHCH;mҢH;HyaH aHDH=/H5w1L $H? L $HSH;5H;>H5g`L`IDL I9eff.fHHBHFHHPhHt#HHtHHxHsHHy1Zff.@AVAUATUSHOHHWHAHH H HAHgH HGL%iHkI$8H~LHMHfInI)LSAM fI:"CIhLkL[HMuIM+AM MuHCHcH9SDH{HH{G$HCH/H{(HtHC(H/H{0HtHC0H/H{8fLs@LkHK8HCHHu}MMH{HulI$8LcE$E~ AE$[HH=J]A\A]A^%KHGP0EHwV0TLGAP0bZyLKLWIAM I9LWHCmHKXHH{XHH{HƟ[]A\A]A^LLՖ锟ff.UHSHH?ğH_HHHt<@tGu-H@t)HMHMHYH]Hu&1H[]HEHU1HZH]HtHZH]ff.USRHoHHt%H@tGuH@tHKX[]@HGHuÀxlAUATUHH H5 H9Wt_HT$Ht$H|$sHMHt A$ɞH1HHuHT$Ht$H|$H ]A\A]ȐLOXMt f.AVAUATUHHSH HVHB`HtyHtoL- Iu臰Ht1L]HL9HMHHH []A\A]A^fHI H8HxXEL]ICDH; Ll$Ld$HL$LLa;Lt$H}LLL=HH~%IuLHT$Ht$H^LA1^]JH=)!t]H5 !I}O1)H@"HL@Ht$H|$LM1MHIMHH9uHXH=Q覌H!Hu3H HRH5\1H9Ia1fH;ws HGHHQH=l!tHSH5\!H:1ZH=Q,H=!HuZff.ATUHSHHH˝HHH?HHtH3HH[]A\H[]A\|ff.AUATUSHHHH;quHtpH[]A\A]H=THHLhHL01IHufHLHILHI9H=ZL[]A\A]Y[]A\A]֔fDff.ATIHH5OUHWHtKHH@HUt1HuLHmtH]A\HUHD$HR0HD$Hu1HAUATUSHHGH;rt H;AuHIHL[]A\A]IZIHtH芡LH?IHH8HMH3HZtH3LHXfDAWAVAUATUSH(H|$HIHHH|$HD$HPvH\${ HHt$F Lf@Hl$HEHGLl$A11I`AD9ABHMLI)L9HHMEA2E E1AHH9II,LMA#E  H}@uAAAAAAEED9ABHVMI)I9Y霛@HH9uH $ZTIHEH<$AU w@ME0MuHHH|$t H|$H(L[]A\A]A^A_L.L<M9EIEHt$F @aLV0H~DIMMI~IwIIt"M;J(t2ItAO;LtIM9uLHL$HL$x tS@tBH}0@ t>@@t,Hp0IWE1ɅAzH9HtE1lHpHH}HHpHH}HAWIAVAUATUHS1HLgDD$ MgAM1111Ml$DDCEIL L9fDQI9xHLZLFAIM9ZLAJE8ISIpHI92A@AJLISIpHvrI9 A@AJLISIpHvMI9A@AJLISIpH v(I9HHHwfHI9XL9HHcHL9HHA?DQEEA?EAIL L9A?ErEDQAteEDQAtXEDQAtKEDQAt>EDQAt1EDQAt$AtAu1H[]A\A]A^A_DуI9HHHIAIIIܻEHqH5DH:녽1M|$ ADL9H)69JH-H58H}蕚-IIL ]JtAM11Ml$1DDEIL L9I9vHLZLFDyIM9tLAOEISIpHI9LA@AOLISIpHviI9'A@AOLISIpHvDI9A@AOLISIpH vI9HHHwHI9HA?EEA?EAIL L9A?EtA˃AuvI9bAKHHHvIAIIfDATUHSHHHWHD$pHD$ HHIHH=L%L9LE HNfHfInL QHDŽ$fH:"$)D$`$HHEH|$pHD$xL$HHHL9L[ LSfHfInH͠H|$pHD$(fH:"LT$ HT$0HD$X)T$\$8\$HHHt$ HHH)H9H1&HHL$pHt$`L@ HDDL\$ L`!LT$DH II:LH)IHx!KtKtM)MM)LHHr"MHJIHMH9H|$pt>H|$hHt4LGMMMaMnHD$hH/H|$ t>H|$Ht4L_IHHVHaHD$H/vHİ[]A\DAlMPAA$A>GDfGD-LHt$HL$ 1Ht$HЅH|$pH5H kH9K.H|$hHHH1Ht$`ЅȄHKHHtL%HQH5?1I<$uBHELSH52I<$HHIR1SB1_HU,I9u|Ho0HD$hH/LGH$AP0H$lH ,H9ubHo0HD$H/L_H$AS0H$yAA$ClClHD$Ht$`H<$AHD$H<$jHD$Ht$H<$HD$H<$HH9]HEH,H|$hHH~L%HHtgHtUHtCHt1HtHt IjIiMMHI<I<HI4I4HIIHI I HMMHL9I,I,MDMDI|I|ItItIT IT IL(IL(M\0M\0Il8Il8H@L9uL%HRH5~=1I<$C@fHHOHHHHLL9LOLW H[H~HLLNF HFu;HF(F$uCHF0HF8tCf1F@HH=F$H~(tDL^HF8L^0uHVHV8fDHLHQH5X<1I8?H H5/H9rff.IAHAIJIR L@ARHSHAuAutHpHtHHHH51AHDHxAHHDAD@ H@Hp(@$Hx0H@8At f@@1ZL@L@8HH5.H:,ZSHHHHt'HWHHtYL@MuHCH/t'H[fH 'I9uHo0HCH/uHr0H[H|$HAH|$HCH/uHWfAWAVAUIATUHHSH(HH]HvHmH]L}HCy{ /E1H5?HAąu{H5?Hx"LHIHIwI DDI/Ht(HL;-H(H[]A\A]A^A_IwLV0LIHtyALaIPHAL>HT$R1jjknH HHtH}H/tLH@&uLH@&H[]@LOAQ0H}H/ufDLWAR0H}H/ufDL_AS0XH[]yff.AVIAUATIHUSHH HHT$L8I<$HD$3Hl$HtRHMH?HtRHq8H\5HtDLLH1HLHHmtBH []A\A]A^HMIHSuHMLHH?L衴HmuHUHD$HR0HD$1AWAVAUATUSH(HRiHIH8HZHL>%L`LVHHLHLhHLHIZLt$MhH|$u2Hl$HH1IHtHHmSH(L[]A\A]A^A_FHHAHD$HAEhHL8HHHTIHH;!tFHp1hHx&hHLHggHMRH [ËCHDHuDNAIcHH [~fHyHH|$誷 HD$AWIAVAUATUSHHxLgHFHD$XHD$PLHHD$HHHD$@LIHHHMI9yH9HFHIHHkIIIIIIILHH $N49M9dJ<LD${IHdH5hLD$LpHpoL EQE JIEMeH|HtA$L9H<$#LsLD$HK,LD$H XHHH)HHHH9ݻL LBE1C\H8D HGEcHt$hLT$hL;QHuH;A(c yI9rAE$MIT$II~HIIALAHA?DZH9MIt\It,EVI~LLHIT$AHA?E\$DDHHLMLAHA?DRDDHHLMLDDHHLMDZIDI%?BGHLDZLAHA?DRDWLMDZIDI%?BGHLLAHA?DRH9iK Ht%?IIL9<$+MuLHIHH~EdHhEdHxL[]A\A]A^A_IDHHL1HHL9}H<$~L$$1Ll$L=MuHINdHMD$HDNI8H) HG`Hl$`LT$`M9WHuI;G(uD EMA~LMMIDI?ANI9vEDDHHILLAHA?DRII9wLH)HITMnIIHL9,$,Ll$HLIH9tAIHwHtE|HPEH9|HHMHIIMfLH;Ht-L9MHL$PHT$XLIL$Lۀ _L $L9HL$@HT$HLHL $譀 L $^I<.LL$IH^Ht$HH|$XH4$H|$/HH^L]LHMt$LD$JJM<HHt DUEL]MkIT$LL)tJ@;InH|$LHT$($H|YLPHHHT$(I)HD$ IuH$L)IH<L< H|$ "5M~eHl$L\$JL9ItIOHH`HLHHLHHHHSDD DDDD>L4LIEL$ADH<$HDHHH1HXATUSHHѪH8=; LeYHD$HD$H9CHuL;c(u  u H1[]A\HH[]A\fz Y1ff.@AWIAVAUATIUSHHGHVHHHHHHHHH9HLmI9GH<sIHYH=`LhHxLEHEIHoE_E\$DA%?AFHAWAT$ADA?ANHAw At$ ADA?A~ HtzEG$ED$$EEAA?EN$HtVEW(ET$(EDA%?AF(Ht4ALALADA?AtHH9uH9L<LKK<QGHHHH#H9+HGE1HuDH?AAAVAUATIUSHWHoHH_HrLHH HHrHGHgHL9G0zL M8MHEA1sAI$ELI\$(HH~;L-CH;L9HHH/HHuIt$(Il$@H9t H=IT$H\AH@H9$I|$It$HL%2M$8IZDE~gAH=DMt#AIAt|[]A\A]A^ÐHL_AS0&H=HOH9H9A0M$ME1L][L]A\A]A^P []A\A]A^Q MD$LOIAM I8LOID$Lff.ATIUHSHH^H;tEHCxHFHHHt6HLHt&H8H[]A\HVHuH}H5!H9t(uH 'H9Gt~H=H7HHtH5H9ptCH2HHt>HL>Ht.H8@DHDD$ D$ GHPHuADAWAVAUATUHSHH(L] IIM!MI} ILe(L9ID$M$LGMD$MI9uyM4$I9HMI9VHM(ILLL$Ht$H $I.Ht$LL$tmL$L9U(VM94$Lu7L] IM9gIOdOl'M!.DI<$OH(L[]A\A]A^A_Ht$IvLD$LL$V0Ht$D$LL$hH9V+LLL$H4$H4$LL$uE1ff.H;u2zHBDff.@AWAVAUATUHSHH( t$DB  U @L$ E@LuL{Lm0 @rDLC0<O 8E1M9t{AMPIIM9tcAHIIPIM I9tLAHHMPHI M9t5AHIHI M9t!AIIIM M9ufD|$gM|$CAuLH1ALHQrHeIgAuLHR1ALHrH6I`AuLHK1ALHqH/IAuLH1ALHqHAICtLH1ALHLT$YqLT$HxoIM9ud@<K4E1AYCE1IM9||$Ct5IrIvHHt$HH>EHEHH|$tLu0HE8EA\$ H ?@t9It$0HLIE1E1AAEKLSIt$HLjIPLE1L1HHD$(Pjj H IHHMQL@I|$Lt$HWi>Lu@HE(.W>A>@AUATUHSHL%LM$8 I]S> H$H$I9T$H&I;\$(5 H7LUL;I=M$8A} MMDGEE E;A@ML% M9IBXH>H<H9ufE111HHt$SHl$Am HtLHU=} =HH[]A\A]À} =HEHHAm Hu1HAHL8uH)=Am 1H5^LEuLU Ht HHuHuH5yI1@ATUSHHL'ID$CHHCIT$H9tzHCI<$CHtfHH!CH=LHHCH wDAECHHhD( H@HD[]A\E1HHL'E1fAUATUSHHH8HVHB`HtSHtIL%yI4$i HHPHH;C&| H8[]A\A]FDH;|(Ld$ Hl$(HL$LHijEL\$LkHLLL藭HH~)H|$(Hu5IuAI9t|H{ H8[]A\A]1H= fDIu H|; 1H Ht$γHDLD$(Ht$E1FFT ILD$L9uHzH9SuHHtHCHx H9I<$H5 S$1KwPHt1:H vHRH591H91AVAUATAUHSHGHHVH9|AL$LoLvM9u)~ @8{ t;At,HwH[]A\A]A^DE1E1AAE9tHNxHv H{ LdAEA'ANEtIE\$AH xHAtPCbJCHguH`HOwHPM9LINH~G v )u3Hu H u"AtD;EuDM9!HwHAt<4Eu)yH`wHM9~M9}M9}뺅~봅y뮅BHGff.HHH3??9HDFA?DAA?DIHDVA?DAA?DYH~ ?AA?DA HDNA?DAA?DQHttD^A?Dډ?AЉyHtOV?DAA?DIHt,AFA?Dډ?BdY^HDŽ$HGHHH@P@CuPHt L_8Mu HËG$HWLcIxHO0J4 H~K9 uHփI@Fu X鿉 1@APHtHw8HtG$HOPLcIxLG0OI~J9 u IʃI] @@Hff.ATSHuH9tnL%lI$HL[A\ÃuHGHH3RIHtFH;YltHL%x'tL%0nI$L%nI$L%nE1DH\SHHWHZhHHCHHxVL 8eL9uH;wsHHHH[H[H= LtmH5} I:e1LMtHt$H<$AH[Ht$H<$HHCxHBpH TkHRH9Ht Hx[H511_H=Ե H Ha[ff.@AWIAVAUATUSHxBphO`XEwA=phEoE9^IwIcMcH,}EO`EgEE9gbMcNA;1CA_`EglE9gaIwJqEo`EwElAQAAplA_A9IMcJ,ׁ}-McAw`EgE9g[J 91AAW`EwAFGApgEoE95MGIcI 9McAo`E_!E9_q OA:8AAW`EwAGAphkEgE9mMGIcI 9McEW`E_EmE9_H K؃;8WA_`AEwfE;w MOMcO$A<$ AG`EwjE;w IoIcELlA} EG`EwEeA{AApjEgE9jEMWIcM,A]AmM A9tAEgEAEEw1DrEHxH[]A\A]A^A_IyVHHjH5'uLoHtLuHD$XHw LjHaLTHKL>H5EECEApZA`ZA|$89IHTZ1A`HD$PE'ZD4$\$ Dd$MAHErE$ApaA|$`daA$A\$AH5N LfHL HHkL* fLnA|$`fL:"D)d$@ LHfL~IH6I|$ #yHHAjfDol$@LpD(A$H9l$PA|$ITHE$|$8LhMcMcoIwNA8AqEwA`kLA_荶IH A`A_eLHHA3L/aIcMgEMA:EiEwEApfA`xdA_A;_bIoHcAHLDADiD$"LwHtCL(HHt3 LUHt!LIHtLHg A`A_jLHWL(HHV LHVLHIHVL4A`HVAwIHjDH@ Aw DLHHPDD$^_HHR WLl_IcWIOHу81L~gIcoMgM,A}8LiLcIc_IH߁8AqEwKA`_LEoHH A`Eo_LKHHqj_LrgMcGM_O A91uL^McMcoMGO A9AqEwA`cgEgE;g gIGIcALApAX4$LHtLHA`EgtfLHL蜝HHr LsH\:L]A`IAL跾fHnfH:")T$HAwIpHefDn,$Io LLfDn`fD:"` fD:"fElD),$3HHItHH]efDo|$fDo4$ LhDxDp8LcMcMcgMGO A9AqEwGA`cEgE;g4fIWIcALApAX4$LHLHHLH{L苹IH c LH c:LA`HD$bLIHbLA`HD$ bAwIHbI Ht$D@DP H|$8LDD$@DT$P肧AHIHD$8PT$XRt$PLVL$LQHL$@H HHeLgZMcgI_J:8xL=eMcoMGOA: AEwGApgA`TA_A;_nTIWHcAH iDYl$PD\$@n[L,Ht1LHt$L肻IHtLIHA`A_RLHQLHQL(HD$hHQADKEpRRA`:REGDD$8HR1A`HD$XAQD4$IIƍsApQA`QA_A;_LTMOLcAAw`OEPAxDT$|$ ]YA`9Y LHL(HD$`HLRA`I LwHLֹHHkAwIH)QfDn@fDnL$fD:"@ I fD:"L$ fElMD~T$`0D)L$ fM:"D)T$ ofDo\$fDod$ HIQAEImE]Ee AL9d$XAAO,I|$8SL WIcoMoI|?8L9WMcOMGEK<ȁ?AsEwAAp A`PAoA;oNPMgLcAOAZEjM L HOLCHHO L HOL fHnfH:")$$HOLA`IrOAwIHpOfDn@fDnI HfD:"@ fE:"fElD)L$QmHHOfDo$fDoT$ L`DXDP8A`A_pT L HEAA_AHXMD4$Lt$8AAwHXA_`XIw H脂D~l$hfL:"D),$H QLcL9L$ALA`I MLfMnA`fL:"D)t$LAwIDHnSfDnxfnl$PHfD:"x f:"l$@I fAl)l$ kHH Sfo4$fo|$foT$ pxP8eOTHHNIoHcAHLDYQD\$T$ ~TEwLH8MW DhDh@XHHRPARAUUSQL荎H0HAD4$\$ H,$DMDd$|D4$\$ H,$DMDd$`+CCIMLD4$JPlJGJKKNQPPID4$\$ H,$DMDd$RXSRSTff.@W;Wt(HOHcH;0t 1fDWfHH<$t$ ?H<$(THcwLODT$ IID9t1HADGfAWAVAUATUHSH8HLt$ Ll$(LLH UAă9ET}<uLcuDUEHHuE9]N0PHuIH<QAHL<I>0HuIH<QAHL<I>0HuIH<lQAHD9,$f.L<I>0HuIH<'QH|0H|$I>E}vLD$LMEII|*MTI>0LT$A:L\$IHEH|PHTI>EoHT$0HL$HuHH|yPEoH D9,$$Lcu]H}H9loDeHE[H}EHDGTE(OLcMDUHuE9Lt$ NNDFD9NE EIF8LAǃ  A tIFH_NHIF8A#?E^@AA* D߃A`A_VALA ]A.~H8IcDwmA'A"LA\@ <DAAă64 At#MFMHMNM;MA@A9MA[A[A{EAA]kIF8HMvA_LuYw H-,DdHH D[]A\A]A^A_Ð tLAǃuA RA(vA)RM|D߃BU R{FuDAW LAEAAAAvAWЃ vA_tA" At#IvH~I~I;>cLDFE9BLE Mf8L#I^AH]In8H)H}aH5 H{A N H50HQEA6AxfDLAǃ t LAǃ t @AdžEDA5Mf8L#I^HH]A Adž NADD$E1E1AdžL_ AD$LEo$B AT$LEo$% AL$LEo $ uuAt$LEo4$ u\A|$Eo<$L uCED$LEoD$ u)EoE)G ,LD $ u AD$$E NE1E1 \Nt9MVMZM^M;JAR9I #AIc~TDL$EDXHEJE9$A9 0OE1t@EANIcAE I~8AHI+ AAEH;MnA_LmYH-DdAU AHA [A]MN8L MVA_LU^VAEAOLH$L$LcMLCDxLA.y MN8AL MvLuD$1E1$LD$ Aǃ'%"DD$t$ E EA u߃BD$A E EAAUXAR'D߃FD$E1Lt$ Aǃ'"t$ |$D AA uD߃BD $A A vEAAUAREAAFD$E1Lt$ hAǃ"t 't$ uEM LE1EM ,A9LA=LA~@t2IAu HAA9t \E1E9uIF8AHMvLuAEALAA9tA^G9lXJD$$G9 JE1E9~AcdID$E9 {KAFTHAElXE1E Lc~G9lX~AAFTH$LA0OADžF.L$D߃EEAAJVHDLbFLDALM^8LMvLuIEHIALE11X$E1D$ L$Aǃ߃XLH $_tDH9LcBD_uILH $H $LcHMBDjuH A_LH $H $AH uG$1E1D$OgBA_A0M McMnCDAEA.EAAEAJEMCL DD‰$6u4$LDM~8AL;IVHUD ,$uEAAREfAODA @DA I+H$1AD$L4 L$AIMcBD`TLL$L$A9C$E1LL$ H<$D`ՉAL L$LcMLCDyFLADžhC{FA}WFD$1E1fLL$] L$A$LI H AD ,$uD߃RE!L/HADE[B|BAdž $E1`$1AD$D$LA AA `BI~8Iv1H)dIH@HHH`@M|$L9@AT$ Ӊу @B@Il$HBDlHPI9BLH\$ _H1DH &D>mBHH54L127 A<$1AD$'LL$ L$A7LL$w L$HcM+IADuYDLL$M H<$_DZA|@H<$L$ H<$HAǃv_HLcBDju@H$ NLL$ L $_teDzACLL $ L $D@AAv_t5I1LcBDVUDH H<$L} H<$4LL $f L $D $A8E ƃ.BMV8A4LI^H]zD$1E1LfbC?AWAVAUATUSHH4$HT$PL$\LD$HHfHDŽ$H$)$oOH$Ht$|Ƅ$H$H$)$pLD$xL$)$HBL$pDŽ$HdH$H$HL$8H\$ Ht$0H|$Hl$LD$($HMt$0HT$@LL$HHL$0Ht$(H|$ 1 A[[ƒH$H$DL$|H9[E[H$L,D\$|E5H$H9$DD$x$H$PH$L$0HIDD$`LI|$t$PH$H$H$ZYIL$IH<$MH<$LRIHL$Ld$@L$ILHLLHzLd$@ T$Yt$XMOL; 2L$1LL; 3HKLCLLL1xI/H+QL$p>H$H$HDŽ$pu'LI;t$膢HHCZIHĸL[]A\A]A^A_DL$LL1H$L舓I/IIOLQ0:EWMt$0HT$@LL$HHL$0Ht$(H|$ {AXAYƒ H$H$Dt$|H9t!EH$Ly|$|PH\$Hl$Lt$ L|$0PLLHt$0LL$HMHY^ƒH$H$D$|H9t *H$L|$|L$L9$Ƅ$|$ru.L/HH+} /ALI^rD$saL( HƄ$YYI L; .H+HKLCLLL1ЅI/[M_LAS0KL$L9$eƄ$X @H$H9$Ƅ$MtHDŽ$pLp{HIML'IHt-H|$P?H|$PH LI+ML$pMHDŽ$pLE1L; ,M11}IM?LLHHLHD$1贝L薸H|$茸$H$HH/HttLHHD$hH|$hHD$`;H|$`tML+L|$`L -LH581I9ƅLB*H5I:L޷|$\LD$HHT$PH4$OLlHHtlx >LEMOIH$PL; ,HDŽ$XL$`1HLL1ۅI/qHMI/IWLR0 LGHH`)H5' E1H;L1_HSHsLoIH3-LHt$`Ht$`HcVLFE1DT$ M E;uAfAUHATUSHHHWHH9|H[]A\A]LEH EEAA A*?E>A@>Mh0HjHhElA.thA[3HPA@Ip0LDMHHHQH9'AI>E7>@IMDLjLhA]toHPHPA@IhHLIp0HQ8A=E>EILDLjLhA.t|[twHPH9HQH1H@HHL$HHAHL$HHu Hu]HYH9YH H5H9-1xHhHPH=H55H?1PV= >@AWAVAUATIUHSHXL9u$HXH9^>HX[]A\A]A^A_HHLA<HL$ AsD=|$Hs=D$,H]TD|$(ET$$=]LD$0HL$@IL9Hk1HAL$HII9>3ME1I)uDt$ MD9DCU A@E9s01HHLL$L$LD$LL$L$A9LD$DBA9HMt!DLLLL$gLL$Dt$ MuqMt$It$ I<$LDLL$HL˼ LL$It$ LIt$ HtI<$I1HLL$> LL$J< I|$ HXD[]A\A]A^A_It$ I<$DLLL$e LL$lMI)݃^t\Mt>E1H9HOH9~ HqHLAI؃>tE1E1AAE1E1LHHII)HtXIt$I+t$ L9;AAEE>LI8 tSH5ũAL=xH5I?AHYH5AH8H5BA:ff.@AVAUIATIUHSH~ :H6MtcAD$ @twDuHL)A~Hu HMH)H9H}E1ILL|UH] 1H[]A\A]A^fI9L$uHLH[]A\A]A^2<DuHL)A9zHLL D9vUHW:HHo<:Hu H}ILLE1TH] H1[]A\A]A^DHu:A<E` :ff.fAWAVAUATUSHHP=p?:O`&HDk.HHtV1 HwtCHHt1H{ H5HH:HH[]A\A]A^A_Ã{`Dk~p_9HIHuDk1DEHDAp9{`9DSD$ IH8D[`1AD\$ E8 HHtLH HHtIHHcD$ H9~I It$D$ H LLLH߃辽HH H{`HHE1778ff.@AWAVIAUATUSHXP=pEJD`EoAnA;nI~HcHH4LF(MA8EM@Mt A8/M@MuA9nKILAV`EcEkED$$Dl$HA[AAp=A^A;^HcLLEHExDL$IHAN`EA^HA{AApCA9^L AAIvIcLA8EN`EfEHLIHEEV`A^AEA{AApVJIHGAAv`ADD@E=pCL]HLHD$ \LT$ HIAEnLAA~`A^QCLIHAAA^A^`DYEE1AA~`An LykIHA~`An^GL|A~`AnUGLH5 2A~`AnAL( A~`AnGL$IH A~`AnALA~`AnFL A~`AnALAA~`An@LIH'A~`An@LYIHmA~`An@L A~`An@LYAnLL"AHXL[]A\A]A^A_ExE~MxEAEAEnU LHLpIHL A~`HD$ AvI~蘳H9H MF LLXL$8LD$0輼LL$0D\$8HH9ATLAQEASSDD$0HT$@ H LHHh QIH1G9AvI~H@HMN LD@ T$H4$*IH@L0IHULLUHHDAvI~蓲HzDP DHAv ELRL$ HA4$HY^IH}DEEnM$EAq*@A~`VELXHAEnAv`gt$0Iv HHD$ 6IHBLT$ DL$0McM9LJALJTfInfH:")T$ H1L:LA~`IAvI~QH-BfnD$fnHLLf:"H fA:"M~ fl)D$ULHIIHAfod$fo\$ L`X`8AOIUANHA~`EDxHD<$L$H=LHD$ /HL$ HAEnVApA=p(7A~`7McnE;n6MVK. LtH Dd$8Iv HEff1IHNDD$LMcL9 LHt$@LLAEHH:AEAvI~A>HfDnL$fDn@HfD:"@ I~ fD:"L$ fElD)L$H:fDoT$HXDP8EAOIA{EAQAAp\;A~`D;A^A;^:M^HcIˋpD`t$LHLhIHEAQAAp5A~`5ANLL$ 軹H D\$ 1E^fInEA~`fH:"AE)d$ A AvI~輪HIHz(AvI~sH(fnfDn@LfD:"@ fA:"Mf fDofElLD) $@HH(HL HfDo$IHXDP8AKtMT$AK4@LHHI99A~ILH|$8\yAp!LEf IHA~`Ef!!L%HHt LHA~`Ef LP[HHt L軬H A~`Ef!L Ht&L>SIHtLyH!A~`EfiL HtLIH}tsH{}IHi.h IwELDHs DUϽ^_IH.[ H֧H6HEIH" H謧H 1HH5G>sH{ΘIHQ-P DHs EDLLRAIXZMR -H趧-LSLc̓{`OEkEsHb-E1s-fDAWAVAUATUSHH(P=p.o9oJHsHcHC`Dc.HIHS`Dc,HIHZ{`Dc,HIHoDC`DcE ,HIHDKHDL$ <DT$ DSHth{`DcE9MEfDExMpD{H(L[]A\A]A^A_DcDc`nEDk뼾H躤HHHD$HHH5A;zsH{ÕH!+HL$DHL@ Hqs PDD$(L$^_IH*H H{Hߺ{`HD$dHHNHH5:2sH{H*HL$DHDX HC HHHqHQHt$PLASDD$(L$Ht$ y_AXIHR*H HH59HڿHD${Ht$o+ HH1H苕HD$H HHHH59sH{H*DX DHs LASDD$(L$Ht$ ~IXZM()DkdH)k1E14.*f.AVAUATLcUHSHLOKHp(Htc;tAHvHtV;t4HvHtI;t'HvHt<;tHvHt/;t HvHt"9uEHNFH1[]A\A]A^DLu MnIEHx I;}whI}IEMUMu+HHOMIk(HHhIC(1H[]A\A]A^MVHHO$]It$(XHpID$(1Ϳ HL$kHL$HH*IEH@L@ LBHB*LMMn_)ff.AVAAUATUHSHLo I]HCHP H;wJHSHCLKMu~LcHuHHMD0NHMZ(LXIB(1H[]A\A]A^ÿ HL$t$t$HL$HI)HCH@Hx IxI@)I]yMMD0DuLcHmHHDpJTLB(L@HB(1vG)ff.fUHHSHHH_HCHH;wHSHCt\LCMuMH[]ÿ Ht$H9HCHH)HCHt$H@HHqHA(H]LE((H;iH5.V BH=6NHHfAWAVAUATUSHHXP=p2O`Wk9k0HsLcJ US`k-;kLSK4 DkAUH]e-HcsLCM A9JDkAzAp*D[`E SH߉$H$s`C DADpf,DKD$DL$(E98DT$(DHSMcJڃ8t$(ODC`s D${`DC# H舋H IDA,H4)LcKLSK<ʃ?kHu IHDAfAODSp)s` DCHDD$רIHCDT${`DS)HIH6 D[D9[HCIcH Ѓ9DAH'M,HcSH{H HЁ9 BpsɋIH EO EGARDs H=^D10A[]IH&.DyH詚/LcCH{NMA: AqsIIH EGEO VDs H=_D1/_AXHl/DIH*,HcSH{H HЁ9 ps̊IH EO EGPDs H=D1 /IXZM+DM{AD[MPH蔙I,LcSH{NA; kH=pW {`+DCHD$/IH>DMAH+Lc[HKJك8QDkEHDAp {`DE+sARt$D4$Ap*D$D;[*Hc $HCLEHEPDL$(DT$0HHD@D=p*{`T(DKHDL$HHD$HHD$DT$HDS{`;HiH%sH{褈H(fnT$(f:"T$0HS fnXf:"X Ht$foHHT$(fl),$"H|$(HH(Ht$0Ht$H|$(H{ *L\$0HL$(fHnHfI:"0(0H)|$fDoD$HIfDo $AE@EH DMAH HcSH{H4HЃ>4Qps莇IHEGEO VDs H=D1+_AXIHD?HoY#DSD[D;[HLL$6 #D[LL$A H脕{`D ${`DK&Vp&DSD$D;S%Hc<$L[IHD@L$DD$( H H%H|HHD$0%HFeHL$0fHnfH:")d$0H% H躔H%sH{HN%fnHfnD$0f:"H f:"D$(H{ fl)$IH%fo$fot$0 pP ${`C'HHDEQDApg'{`((SH߉$H${`S (H=BHt H諓HD${`D[&HBHt HvHPL$D{`DK #AQAp"C;C"HsLcNAxEX<$D\$HH!H++HD$(H HВHsH{ H"fDn$fDnP0fD:"P H{ fD:"\$fElD)$IH]"fDo$$Ld$(L`D` DE1A H+HMq&HH59H$EH$%HH<{ DAt$D{`s-AxApD[D$D;[0Hc $LKIɋBDRD$DT$(HdHHSHD$0HHaHHD$HH"HtnsH{aH8LT$0D@ HT$HDHIrs I:APDD$8L$ ,9IXYMCH:$DS`SxDL$D{`DKTQp$C$;CHc4$H{LAKESL$DT$(H.HH蝡HHD$0Hg`L\$0fMnfL:"D)l$0HHڏHsH{HfDnpH{ 0fD:"p fDn|$fD:"|$(fElD)<$IHlfo$$foL$0 H` E[DODpDSHDT$&HtH HD\${`D[JHHt#HގH}ADA ) < !!"$f0&H[XH5NE BtXDcLmDADE1kAyMi{DEPDHL[]A\A]A^A_DrDsEIuD;sLCIcAM A9DsDs`EgHs LIHD%1M~MTM\$AMIcL9|L5lLHIHLwHUDP"ALL $DcUIH#L$DsLPED;sL{McKMA:A LH$D[UIH#H$DsAIEDM;{HsLcN A9tDsMD{L9{OLIAH虋 #SH聋#Dc.Hh"D[HO"Lc[LkOtMDMN(MHH $z"{H $HLLL$H4H $VTH $LL$HtE @4MxFM HT$H<$E1ILLL\$(1LT$ qLT$ L\$(HHIDD$E LM9T$A|$ #I$MHĘL[]A\A]A^A_A HT$H<$ILLL\$(LT$ ? LT$ L\$(HHvfD;l$4 LD$(D$4L)M9HLLc|$0L|$ Ait$8LT$XL\$Pl"L\$PLT$XHI"@ D@IM0HL$8MHRLL$ LCLD$XMLL$PMjLILAVLL$HT$|$@LT$`IXZILT$P"M=HL$ H|$8L|$PH4$IMHCH|$XHD$`HT$ LT$XLIL)LIH$AWAVLL$|$@HT$x?AZA[HLT$XL9L\$`~/HL$ HT$PIM)Ht$hHIHH|$8LHT$PLCN<0LD$XM4HD$ LT$`LIL)LIH$AWAVLL$H‹|$@HD$xAXAYHLT$`L9~/HL$ IHt$hM)L|$PHIIH|$8ML|$PHH|$XM<Ll$`IMMHl$ LLL)IH,$AWAVLL$H|$@LD$h ^_H- L9LD$X~-HL$ LL$PIHM)HIIH|$8MLL$PM<HsLl$`M HD$PE1M9\$@9\$Ds 9\$ DL$4ED|$E|$(UH|$H`F萶HI뻃@t@ADDDL$D|$DD$9CljD$8M9LMILt$A7E6H<$ADLDLT$HH|$4HT$HLD$D:t$8LLD$IHLD$1E1L1H AM  @KIu0MeIHDD>HHFI9cVA9t(LF L9HHI9DE9u@(HLt$ LH|$PL)H$MIH|$8IJ4;D$<A@FD$@HOHH $DM A HD$PHT$H<$ILLL\$(LT$ 9 LT$ L\$(HeD$(D$D$4jL\$p1E1ILT$`Ll$xMLd$ LHL$`LIH,$AWAVLL$L)H|$@LD$xZYHLD$hL9~!ILLHM)HH|$8ILHl$XL\$XLN<0HH\$pH|$8IHt$HHL$PcLT$`Ll$xH\$PHyLDH)X#H7D$(D$D$4bHt$H|$4DLLT$PL\$  HD$HHD$(L\$ D$4LT$PLL)M9-HL)HHH9*<DωL$AA2A(D$D$@|$9|$@`LUHLT$p @ HĘL[]A\A]A^A_鵋 MEHLD$8MHl$ L$$H1MCIMNL5Hl$8HMH)Ht$XHHD$PHt$HHLLLd$ H~HD$PL$0LLLAE @Mu I}HK46H=LGIHLE1M11HVLM+UjHHH|$ H9}Ht$DLDDD$(LT$ L\$ HD$HDD$(L\$D$LT$ AAT$ LpHLt$H HT$H<$ILLL\$(LT$ L\$(LT$ HwH|$ZH9HwHH4$E96L\$ LILjDAVLL$HT$LT$( HHD$`ZYLT$L\$ D$D;l$4D$(t$8LL\$XLT$ IHvD$4LT$ L\$XA@ @Mx0LcL$0Ll$PLLD$8H4$IHMLLL$ K.MMMIHt$HLLMLHHT$ LLH)HH$PAVLL$|$@LD$` Y^HLD$P+Ll$8AuE6|$4uD:E6D:L$4H4$LDL\$(LT$ H$HX|$LT$ L\$(Dl$4Ht$LDLT$PDL\$ O HD$HDl$0LT$PD$(L\$ D$D$4)H|${XfH<$mXJL9IZD$(D$D$4D$(D$D$4t~HN$D8H$HLPM9D;pH,E;2xL91LIM9uD$(D$D$4bIuHHML$IHDfD>H8HFI9DNE9t'H H9AIHI98A9uf(HH|$ Ht$HHHLLp  I}HJ4=AAAAADD$@Ll$8wHT$ LH+L$XLHHD$8HHPD$(D$D$43Ll$`MPLT$`Ll$xH\$PHGPHG f.AWAVAUATUSH8HFf~ HI=HW} _M AD$ AAAAAA9LmM|$M9 @4H0 @I0IA7A4$AIII98] LuM9vp8]LuM9v^8]LuM9vL8]LuM9v:8]LuM9v(8]LuM9vA8IM9u@1H8[]A\A]A^A_AUHL H@@IHI @A9AMLL)IHwIcIwAHE$CT<LT5DHA8Ht$HAL$AIL 8u IOHL$HAL$AIL 8u IOHL$HAL$AIL 8u IOHL$HtpAL$AIL 8HtPK RDESD]Y^HLL$AO]L$HEAAoIAq A`AA9MWLcOA; AAoAo`Iw HLD$H$LD$HHvH$LcI9}K4LOK4H<$L5A LUA`AwIFH H$IO LLXh H $RKL4$HHAPAADAVD(\AYAZH~LL$UL$ AL$ALL$HALǾHD$L$H<$HLD$AoH$HD$L@IAH$pA=pA`AA;MWLcOA; t5EAEAoH AAoHT$ALLD$LD$HT$HHtAH,$H9l$tFL $AoK IL $*LHT$LD$QTLD$HT$A6Ht$LHL$LD$HHH4HD$|H|$HHL$IuEAE1UfAWAVAUATUSHHP=pDG`Eyk;kHsHcL$LMZ(MtA;HtwM[Mu9kD{`EjErEA:DS`kE^HIHtSLHH褱fEkMcDkHL[]A\A]A^A_ÉkHRHc{LKMHL$MZ(M'H߉CuIH3sH{CIHhDH D@Qs LDDZ^_IH f.AWAVAUATUHSH8P=pcDG`ED}D;}'HuIcHHtHk"HJLcSHsNMJ,MK(MH߉S(H]DkIDAq+{`DKD;KL[McKӁ8$kk`gHs HHT$tIHLT$LcM9LL\$)sH{DuDm:IHfn$fn@LHf:"@ HT$fA:"Lc fofl) $>IH0LIHfo$AAFMnA^ KHt$ H|$(LHHH4HD$ H H|$(InfAWAVAUATUSHH8P=p``D{D;{HsIcH,LMH(MA9\_MIMt A9\IMIMuD9{7L$.Ds`El$Ed$D,$EHIHOpk`k"IH?DC`EDDNDp;S9SL[LcKӁ8!kH=fL}C`D{bHIHtODL\HDDADH8L[]A\A]A^A_AIDMqKAD{H.{`PD`$H-EHc{HKH4H>tHk"HDLcSHsNMJ,MK(MH߉SHDkIDAq{`DKD;KL[McKӁ8kk`Hs HHT$ĹIH@LT$LcM9}KHt$ H|$(LHHH4HD$ 7 HH|$(I-AWAVAUATUHSHHP=p}Dg`E D}D;}HuIcHL MQ(Mt A:]MRMuD9}D]`EiEqEA99 DU`DD}EEkDAp]A9,DL]LcHKPD`T$,Dd$( IHDErDAp+D]`E DeIHXE`HD$01ɉ$Ll$EI̍Bp]` p]=p$;]LMLcOA:WD]`]E8 P=pKp DED;EHuIcLA:U`]}H=p;].HuLcN A9DU`]EJ DXD=p';]HMHcHM$ELl$0M$ELl$GdM$ELl$M$ELl$M$ELl$$_ff.AWAVAUATUSHH(P=po9oXHsHcHs`Dc}HHHKK`DcCHHHXDS`DcEHHH[s`DcHHHS`Dc)HIHtcDC`D^DE{D9~^IAA@DMxCADH(L[]A\A]A^A_D{`DcEZDODkEkfDS;SHKHcLA8f.S;SHKLcN A9f.S;SLSLcKʃ8/S;SHsHcLA8H|$H߉SHIHD$`sH{LT$HD$ HD` H|$HT$DHs ATDD$L$ AZA[H0{`DYDLDE1AeS;SHKLcN A911H kqH|$H} Hc{LKMHH|$A:H|$H߉SL\$HsH{L\$HD$HD` HT$H|$DHs ATDD$L$AZA[H/HHD$Lc[HKH|$N LA9,HHD$Lc[LSH|$KLڃ81H|$H߉SLD$HH}Ht$H{sLD$HD` H|$HT$DHs ATDD$L$HLH豭_AXHHHD$~Lc[HsH|$NLA8/H|$H߉S*LL$HHqsH{HL$LL$CHUD` H|$ HT$DHs ATDD$L$ZYH8HHD$#'LcSHCH|$NLA;H|$H߉SzLD$HHHt$H{sLD$HD` H|$HT$DHs ATDD$L$0_AXH`ef.AWAVAUATUSHHP=pHDO`EJk;kHsHcL$LMZ(MtA;pkM[Mu9kD{`EjErEEA:uDS`kE9kL[K#84{`k9kRLCO$ A<$Dk`DkENErDApDcA9AHSIcHH4D~DvDIHt!S;SHCLcN A9#Ds`DcE}HIHtZLpHqzDADHL[]A\A]A^A_DAkDMckADADE1kH^]HcKHsHH߉K%IHsH{M IHDH D@PDs DLIXZMq0H7LcSHCN MA9AHD[IH|sH{ IHDH D@ARDs DLrA[A]IHHtHc{LCMHL$MZ(MizDAH߉CIHosH{ IHD@DH Vs DDL_AXIH(JAfAWAVAUATUSHHP=pO`k;kH{HcL$LMZ(MtA;rM[Mu9k#Ds`EjEzE0A:7DS`kElHIHtKHrHvHL[]A\A]A^A_ÐEkMcDkЉkLrHtvH LcCLKOLN$MZ(MH߉CIH sH{(IHfnHfAnH{ 0f:"H fA:"fl)$vHHtfo$ LpP Hֿ H该IH ufHfATUH1QٸIHtHHHHtH(tLZ]A\H@P0LE1lf.AWAVAUATUSHH(P=po9oHsHcHDE1AsHH$qLc[HsL$JLك:HL$K({`L$IyHLL$L$HZsH{HH|$DHL$$@ L[ Ht}HWHASHDLPDD$?,A[A\HQHH$=LcSH{L$JL҃8 Hp-k'1뇋sH{HD$L$HL[ H$Ht$D`@ LHT$L$D$UH $|$HLT$HQ1DEWDD$Le+ZYH,AVAUATUSHH P=pRO`Kk9kqH{HcALEhEpMcJ8t6k1ɋH H[]A\A]A^@AHDK)IHtHfInfH:"HtH)$vHtsH{HHUfnPfAnf:"P 0fo $H{ fA:"fl)L$)$QoHHfo$$fol$ h` {`>HeSHHk ff.黴ff.HHLA8OvtLÍFtHLEEQAvEu܃t׍FHLEAsvEuHySHH?HtHPH[ÐAUATUHSH(W;Wt!HOHcH;t2E1H(L[]A\A]eMHc]HuHHރ;u΃H{UZIH_LA}hHuNL*IM4H} L8KSL1DK DCPu ZYILLHxsIIHu@_tA8IIA<$@uALLIeWHNHpHaH@ HfDATWLpMkLA\ff.ATUHHb\Ht$L8MHWHt8HJ8HHt+Ht$1H1HLH}uH]A\HT$E1HLEff.AVAUATIUHHSH 薶E111HLHD$HH@ @H|$HE Ld$HXHSMLsHK IvH9WHH9|OHsI4$H{N$I4$HtH L[]A\A]A^fDMD$LAP0H L[]A\A]A^@HCyZH}PH= fHnIfH:"HvLeP)D$2E1HT$HL*HHILMI}Ll$H=r 7IHH5f HALHEPH}PAUHSHLG HHLHHxHtqHHHH)H~aHsHxLLOHtLL[LPIkIjHt6HKL@HyIxHt AHsLXNTOIL9uH[]XL[]@HG HtUSHHHoH;-ZHUWHNHHHUHHC HC H[]HHH4ff.AWHAVAUATUHo@SHLg(HGLwL9 1HMfHj(HB HB0JM~8LL=fH;Ht@L9t;IH/t7HMuL9tLCHĈ1[]A\A]A^A_HLOAQ0IH~:A IH1LLfHLHB Hj(HB0BMJff.ATIUHSLOL; [St L; :VH]HiVH9t:HCxHHHHt.HLHtH8[]A\HUHuH뷃ff.![wH>HcH6Ã=6Ã=u=>u޾3܃=uҾ$Ѓ*=u&뻃=u(믃=u2룍Nľ6wH5+4늃=>s"n/e=W'R=?=1*,=)= +#%5f.%Yw Hq8ø6fDAUHUATIHUHL8o1HE1H1ͫLLHHHtHmt]A\A]HUH]A\A]HJ0AWHAVAUATUSHQwbH,>Hc4HLpL o@ M[I_HCHx0H;;wxH{HCLSMuJLph@ H[]A\A]A^A_LXH Hpw P,LRDH(D@$AXAYMWLph@ 밿 )$7fo$HIHCH@LH0MHI@I_Tf.AUIATIHUH1HE1H1HLLHH'HtHmt]A\A]HEH]A\A]HP0AUATIUSHH-SL8'I]&~H$H$H9UHH;](5zM$I|$HXH8DE LMADE E;A@cLoXLM9u~E111LHt$Ld$m MteID$tA|$ WHL[]A\A]H5 Hu*M\$HlMkXI9tLAՃm IHuE1LuMBm E1H5OHHHd H1H6 LE1\+^fAWAVAUATIUSHx AD$ MD$ $ @ M\$0D$MLK E1HD$1IIIAtJA+" 7' \3t~ IkH9IfDU"wy w\ LIBHۃHL9HUmL˃"F va dLbfD LD'\t:~yM9~뀃 LIBHHH9<HjL H9LE1I9ؽ'AMlLkLD$LL\$豞IH@ L\$LD$΃ @MV0@A*AlEE11LLyHxL[]A\A]A^A_'g\v ~L9jHjL H9%@qA*Clj v h HۃHLT$HLL$@HL$8LD$0L\$(t$ T$T$t$ L\$(LD$0LHL$8LL$@LT$H9ֻHBLT$@HL$8LD$0L\$(t$ HT$HT$t$ LAL\$(LD$0EHL$8LT$@9HBAE1Mjl$Lt$0AMLLL)un1C+I9\   M~AAILC+I9\ +  SJ~Au|I}AII9LA;I9\  6 i~w6ALoL%A fANIM9Lt$0LD$ L\$T$HL$HL$T$L\$LD$ p؉MA AvA\H43 IL$ML$HL$(IL$It$HL$LL$ ML$Ht$ރLL$ A/ACuN L%+NI$Ld$D3GT4 Ct CL ;CDCI9LLaAgA\A>LLaAu!A\Atw*AA9HfA\fADtDA+A1M\$HMVHH|$u~E1"MLaAuA\CnATHfA\fADnHD$HOHD$HLE1Lt$0wIHAǾ'1EIHAA\A\CCkD1Ld$E1HD$E1IIHI7  LHBMAII98IMM9C,"v'\OFLA~vLT$8LD$0L\$(t$ vt$ L\$(ILD$0LT$8HIHIBMII # TLA LLd$LT$8HL$0LD$(L\$ t$t$L\$ LD$(HL$0LT$89CA{CkfA*fCljM\$HHD$cASAC&uL%JLT$(M $A41LL$ C4I$LT$ H\$C I4$CM$$A<rAu1HfA\fADrHfA\fA\uHL HMfC&uMfA42fCt&fA fCL&fAfCD&fA<:fC|&Ld$"fAN\9B^K4AME1LLd$ HIHt$1EHHD$H:A A HIBHHH9)HIL9t$E.A"vA'A\AAHӽA~vH|$8DLT$@LD$0L\$(^L\$(LD$0HH|$8LT$@HuwAHIFAHHH+A `H˽IHӽHD$HӽDHLd$ E9EBLAكAHt$8It$LL$PAAHt$`ALL$HAAALL$@ML$LL$XML$I LL$hAH5FLL$PCULG LL$(GLL$HLG LL$ GLL$@LG LL$GLE H\$E LL$8LH\$G ELLT$XA C HLL$`HL$hCH6<>A<DAL [ECUJ4LT$PM GET6LT$HGET6LT$@GET6 LT$8AA\6CA\6A AL6AAD6A<9A|6 LBILAHD$LAfAWAVAUATUSHHP=pkO`+k9k$HsLcAJHSJ 9kE1DADHL[]A\A]A^A_H LccH{NLA8uH߉s {`IusH{IHfnXfAnH{ 0f:"X fA:"fl)$$>QIHfo,$Lhh 3HbHsLc{`N EqEyDCD9CH'BDCHsAHDC}HHIH|sH{IHofnHfAnH{ 0f:"H fA:"fl)$JPIHfo$LhP ?Ff.AVAUATUSHP=pG`$k9kt]HsHcALE`EhMcJ8K`k]HHtpDED$D[]A\A]A^HBHsLcՃ{`NEcEk>DKD;KuHDKHsekDFAHDKhIHJsH{HDH D@RDs DLY^Hu@)AWAVAUATUSHHP=po`HDkHHDK`DkEH苜IHtaDsD;st5LKMcK:5tGDsHL[]A\A]A^A_H<qHcKH{LA:5uDkI봋4p=pHT$HHD$S;t4Ld$M{`DkE1?{`DsbH腛IH{`DsH#BIHuz{`Ds1HH59 t&H@IHtHHbDsHD$Ld$DHLKHTHp 5H9H7ifDAWAVAUATUSHHP=pw`k9kH{HcLEpEhHAIHtKS;SHCLcJ4>5Dk1ADHH[]A\A]A^A_fDk1AH"LSLc̓{`OEsEkfH1HcKH{LHA85hH߉SuIHsH{-HHDH LS HߺLhDL$ L$ML$DL$ HHPPDADASLpHK HHyZYHIHDLAeBff.@ATfAnfnfHnUfA:"fH:"SH f:"L$@Ld$HflHHdՅwI\$HCHP0H;w1HSHCH{HuehP@ H []A\ÿ )T$)$fo$foT$HHDHCH@HH0HNHF*I\$I|$hP@ @AWAVAUATUSHHP=po`k;kHsHcH D{E1DK`AGpSLcЃHIċ0~t|fAnLmfn@fA:"f:"@ H{ fofInflfI:") $)\$Mc(>HfDoD$fDo $H@DDHDBt!McKDEzAEfAnfn`H{ fA:"Luf:"` fofInflfI:"),$)|$MZ#HV8LKMcă{`OEjErH$lHc{LKMIA: gAHDCIHRFEڃ+HcIԋqvHyfff.USHHHHH[]@AWAVAUATLfUHSHLVLHIHM,$M\HRH}M]AMS`MtILcD$ Lt$@LDCL|$PHLNTH}H=:-CLLF*LED$ D$ HĘ[]A\A]A^A_?:IHLpLl$@IfDLGO4IM|$ILLHIHH=I.L]IsH;uHuHLU(A2HEHH}(D|H50H9,I|$HtM|$L;VID$H/taJHLI@MNLAQ0L]IsH;u`HMfL D$ HoU0H}(jH+LH0ZIHH\HHLD$ uH}uH}(1Ir LHHAtAtfAH}LIHGHZPLE1L331LHD$(PjjH IHH-+&H5 H}D$ HH%H:Mt$MWIVLHt$@P*IHZH̃H;D$@1HE1H}M@M]AM+LLL'nHHHHVHHHHD$ HuH$H5_ H:I.I^LS0L%$I<$M L$MH= H5 HDI8$D$ IL$HqHt$H(IHHpH;D$UM ufDUH0HH HtCHUH58H@H9uHH="d]%;dH]DATIHUHSH HHHHHt@H7HtHHuIH;5'Ht&H~8LH []A\H1LH5N'HH4$H4$HHHHt$$ HH$H$Ht$HH;5&qHYHRE1LT.HHT$R1jjpH HHtHtH1>ff.AWAVIAUATIUSHHHH ,MA|$ 0AV InMl$AljAD$ At$L$9L9 y@2 MV0 U@ It$0|$Ht$9|$ A@@Md LT$ H9HNHI+wIHtbHLT$ L{t.HT$LLHAIXLT$ H*H5[#I9v\IT$IL2ID$L$9L$s HHL[]A\A]A^A_EA AS M. LT$0H9HNH~I Ld$E<$D|$ vIHtIHl$0Lt$(E1E1E1IM9 Hs IM9tD\$ F;\uLJ|L)b)H I IvJMGIMf.HLHD$(hHL\$(ML$HsMHt$(HT$ IOtJ<2HT$0HLHT$L)AIH|$ A調H|$ HHL)QhHH Ml$KlIM|$IDLd$A$D$(UuIH%HH|$ vHDd$(MM1IE1IHJ<D:'1MxL9F:dMxL9F:dMxL9F8dMxI9F:dMxL9F:dMxL9~wF:dMxL9~cF:dMxL9~OF:dMx L9~;F:d lMx L9~'F:d XMx L9~F:$;EIL9MHMMHt@IL9|UHJ<L)fIHFI gIl$N|I E1LM9VML$IM1Ml$wHMHD$ KfH HL$ I|$ALD$0IH|$(HGH\$(LHT$HJ<3IL)ALH|$ ,H|$ HHUHL)eHH I uHLH诩_MLLT$0L)HL$(LL$ }eH5 HL$(LL$ LT$0H MFIMGHL9 I9aHMtAV <tMF @In0A LD$L9LNI|$rH1L|$Lt$E1H\$IHIL9t$bM9}sC4,@L A<2toImL9GL,EH B< tBIM9}$C,L A<t!IM9|M9uLIIl$KIImL9|'HI9~A ,&L3 A< tMu L9HK<,L)cIHI HSJII<IMfLd$ BI~cHI $M\$KIML9|$(BJ<3pHLHD$ LL$ L6뾿ZpIH8LHIM1(IH|$H5BH9wLKLHIHI9HHjL軦 HjHLLT$8HL$0LL$(HD$ UHt$ H|$8HT$(HD$0H|$0HHD$(HT$ RLT$0HL$(LL$ HLL#L-_H5V E1I} AJ<2M LT$0H9HNHzILd$E<$D|$ nIHIHl$0Lt$(E1E1E1IHM9GHH9IM9tt$ B:t=uLJ|L)WHHI IFJ IH HIHHHLL*IHzH{ XHAHXH JHL`LhHh Lp(H[]A\A]A^D~VE1HuuH}\IHH}GIHMuo,HH8HtzLH5= 1E1I8hpHuLv|H5 H~3LHHH{|g@HGsAWAVAUATIUSHHN@LwL~HAM9MMNM~d1ItH|H9tJL $bL $HHH H9PLa1L9@H(t)L9uEHL9uAH=3NcIALL$4$褲LL$4$ufAtNAt)HDItH|H[]A\A]A^A_aM9uHHH[]A\A]A^A_M9uH-HH[]A\A]A^A_M9}M9|M9~H H1H HATSH4IHtHI9D$u HL[A\LKnLH萘Iff.AWIAVAUIATUHSHHH8HJH H8H~HL H`HPL HL9@E1H; AH(AHELLj`HH L L9OE1H;=K AH/ELLH IH9gMLL`IH9MiHL;IH9KMLLKHHAImI/HmI,$taHH[]A\A]A^A_HOHHLLB_HHMH薖EHIT$LR0M_LAS0pHEHP0lMULAR0GfACbH/IvI|$H~ j/ IH IwI}H~ F/ Iu ?H ? HLIAVIAUATUSHHLl$ Lt$ HŅ$HI~LL$ IąI7I~ L\$ IŅIML9L1H)HIHXHMAI?M)M9L5 I~ QIHLpALAsrI$Il$Ml$ I\$(ID$HL[]A\A]A^dHuRMy L9~HEM1L)IIHX21YIM)M9CH訏H= t D9s豌HDH D@RDs DL Y^HnDH蚛NLcKL[KMʃ8 LAHDS*3{`H/LH袐IHH9HcKH{L HA9,DYDM HHG# HxYH9w~SW  t_@tH0u<7HZ0HHtu<Px[H]A\Dxqff.fATSH1H:IHt-HH<.H<]tID$HI\$ HL[A\ff.@AVAUATIUSHHHt H;=HII?HI}sHHH{HHEI~pH{HHE ItTH{HHE(It8AAJL1HAL1LHIHH}H/HtKH}H/]Ht7H}H/Ht#LuL|I>H/IM9u@L9gHHL[]A\A]A^A_DI$HGH[I$HdE1L9tfDLgIL$tHIH}H/H}AH/HwV0@LWAR0rHL$HL$HէHHE1:HGI,$t&E1HGP0HHGI,$uHMt$LE1AV0HOQ0+H}AH/$HWR0H}H/L_AS0LAW0UHWHHHOHBHH HHBHGHgHHtH/tzH}HtH/twH}LL@M9L]HuMunH-lH8L@A~AH=%]%>H=]%0HwV0zLGAP0|HHZ[HMISHH LISHElH]AUSHHHHRHB`HtCHt9HH5[H6蛅HHtHHH[]HHtH HRH5 1H97Z1[]fATUSHHHH HHMHHH9PHE Į@TL].IHu EP HUEщA HDA,@s@@H0EEA@Ip0IIHrHKHHDHH[L]A\HttfDHI[]A\DXEA@tPI@0HH@@@tfHu0HI9~LHHHH)H9HOHHHHI@H뮉DR<<EHuHAuE@\@@HEHE(EA@IHH"1f,yHH9u@@@HUHD"EtPA@MHHE1G$IL9uE1IpH^HuHHH1X\uff.AWAVAUATUSHJAB;B  ?HHI7H=HcL&H/1H0[]A\A]A^H0HHV1[]A\A]A^NfDH;Lt$ Ll$(HL$LLL\$H}LLL2IIuYHT$ Ht$(LHgLGAP01X軧H\HuI}H5 h{(MH\$(H;\$ M1MMy&MMHt$(MILFL\$LD$ ILL$(J< ]IHLd$(L\$1HLUISMJ<K I I9LIt:HH)HI<0L\$MHuL9d$ wML\$(I9JL)HE1Hu K[LmMI}I}HtHL 'I}I}HtHLI}~wI} HtHLAIcI;E}LI|HtHLH AH}HLw H}HHmE1Ic1HH9H|HtHHL& ALmE1IcMyIuH9I|HtHL AH}LH}HLLmHUA}:D}MmLrAA H5NcIAH}LWtL}E1McMII9(LMLUMhMIGlA A^K|L(IH}LH}HL}LEHUA8:HrIxNHLH谔H}LgHuEDAiLH~AHmE1McHLUM9sJ|HtHLAHmE1IcH^L]L90H|HtHLAH}HtL4H}H L}E1!I|HtHLk3AIcMML9|L}E1-II9K|HtHL!AMcMuZL}E1Mu#PHLAMcM;&K|HuH}LrH}H}LLmE1McMIEI9K|HtHLAH}HH}L,IHmE1IcH&H}H9]H|HtHLAH}LH}HLH}HmE1.HMH9H|HtHLAIcHuwH}L]zH}HLFcLmE1McMWIUI9wK|HtHL9AH}L HmE1McHLUM9 J|HtHLHAAMEAAu%H5I9tL]u AMM^MAtI}LAAH5$H9qv]AMM}Mt'LHHHIH9LL LHH؏LLMMAtLINt?I}t8I~~1L=LI HItQHtK1HI9wLT$@L$H|$@M.HIHHHIH:ItQINHtHILIt9IFHtHIDIt!M,MtIEL,HI9uIKMfL.MLAc>H8D]A\A]A^@AVIAUIATIUHSH HHHHHI,$Ht]HMFHHt$裵HH&HH;D$Iu1HLH []A\A]A^I|$HwFHt$DHH)HH;D$AHHLW1HYHRLE1LHLHT$R1jj LL$XLD$1MTH,HD1H52M H;r)逦]9ȧfDAWAVAUATUSHHGHGH;GL>HH܍Hc4HHu&$kH}{HH[]A\A]A^A_LuE1IcMcM>L9|HuH#uNItH#JA뼋EDHOHuPD]@ASDMIveHؤD] _Et3AF,EF HߺEN$IvPEn(HKAU(_AXH}HuH;HuHHHmE1IcHH}H9HtHAHuzL}E1IcM_ML9[ItHAHuXߤHuH%H;鰤DEDHOHuAPU@RDM<DE8&^_[HUE1Lz0MtIcI;HULb E1MtMcM; $HUHM(HHlL} MEDHuH1P}@WDMI>H5[ o+C4l0H|$pQHHHXk5D$`tV|$`H$D$L$L$A!C4+It$PL$VH 뚃C4lIDVt$PL$AL lOc4MAAL$LHHIMH-|H}$C4l ҎMMH@A1^L ]|H5{ I9)CH5+ 10L=O{H5) I?)MD$HT%IBH={H5 H?)AhSEUT阊fAIw,H 2kHc4HIt$D}HAD}HH[]A\A]A^A_A|$ET$,E\$(EL$$ED$ HOIt$HARAS! AYAZnA|$uHUZ@uI|$H5 0mHH[]A\A]A^A_It$Mt$MI>IvHَI>IvHI>~rIv HAIcI;>}PItHp~AIt$XBIt$HH:鄏I\$E1McE1HM9^NTMtIrHɏAIt$}Mt$E1McMbII9KtH8AIt$BIt$H}Ml$E1IcMI}H9ItHBЎAIt$*It$H^zMt$E1McMMM99KtHAIt$ :I\$E1IcHlH;H9HtHBAIt$Ht l,It$HtHRIt$HH4}鴍I\$E1JtHtH AMcHL M9|Mt$E1KtHrAMcMkMM9|Md$E1Mu#DItHfAIcI; $|It$gFH=It$E1H^0HtIcH;It$Lv E1Mt IcI;AL$,H561QA|$(LWEL$$HED$ F[A]It$HKUIt$H7HkIHM|$Ml$HE1MLLHՉLH5 $It$HtH:HuNH~Lq͍It$rIt$HTIt$H0@HM|$I\$H=E1MHLHMd$1ItHHcMyI<$H9|LH5 %dIt$H@ALH5e EIt$H'HEHHD}HAKHMt$M|$Ml$HMMLLHLH5 sLEAxT.AxL҈It$HtIt$H_阉HkI\$Mt$HE1ILLHDm$ARAS_AXEL E1H=At$,HMHVAD$(H5PEL$$ED$ }ZYH= RHHKH= 7HHH=c HHHtH:'AItHVAH=- H'H$H= HHX鱆ff.fHu,H9WtHtlG @t#W @H9u鯊 uHHDILLLπuLQ2uL|BfAWAVAUIATUHSH8H|$H8DD$DL$袅HLeIID$ ۊHAsI9VIVHID$ L|$(LLLPHL;tM8I{X2LcLEP?IH IL$ މH=rI9~IVHLLLLM9D$ ImI.AH8D[]A\A]A^A_H|$(HΉL*(L$(ILcL HEPHH H(LHH+AMNLAQ0YMeLAT$0&H}(L[$鲈LHH;UH\$LH{(XHHtsٞI L>HHcHt$HH~(LЈHH=rH5 HD$H?^HD$颈vHHt鎈fHGɈZf.IHփ uE11L1HE1Mj1`Hf.AWAVAUATIUSHHH/E ƒ;H9utiMH}?H}4,H=oH9} t(LHH.H1H[]A\A]A^A_鴉ވfDHH6HG?HwHxAtHuDGLHE1E1HrTLHH IIM9u!IL9qH5 I:IH=qH5 H?IAV1IAAUIATLUSHH HHLL$gHl$H1IHHHӕHHH(H=aHHL-HH?H oIuHSL8M0HxLG8JHtyLH1HLH輈HmIt?MtmI.t@HL[]A\A]A^H@P0H=)aHHS顉HUHR0IvLV0HMHLH?HXLE1ELE18|Lff.USQHoHHWHGHGHG HHH|H H H/t}HZHteH| HH/t_HZHtGH| HψH/tAHZHt)H| HH/t#HrH|Hu閈HZ1[]HGP0HKff.@UHHHSLHHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$Ht$ H$$(Ht$HD$0HD$t@H~6D $A/v:LT$L]MMJLL$MH'H[]@H|$DLUAQ$LMHt̓/wGHHuEYD$H0HtA/vQLL$L]MIQHT$MHtHD$HuH8HHHL$H7H_JHMAD $H H;LT$1ɺA/w'EHDHANIH9I2IzLTHLH9tD $H|$HD$H|LRH H0H>L9af.UHHHSH(Hu0HHH5 l1HTH([]HYHRE1LHT$R1jjyH HHtH0Ht'1HtHxHt$yHt$uEH5kff.@AWAVI1AUATIUSHHt$0HT$@HD$hiHD$HIHK1yiHD$(H1diH$H1PiHD$ HoA~@HT$xHL$hHT$H\$pHL$fDI~HT$E1HHt$xH|$pH$D$EBILl$xAbMrtaY5HHRHLLOxHH|$L6LLL_ ? H|$0HtLpJMtLLX8A~D4HH؇HLLHaA^@D$8u#Ht$H|$ x HHH$Ht$0HtH|$ P HHHH|$(L/ HHH1TgHH|L|$1I~0LcL;GH<$HL|$HHGA~@HDŽ$3HD$HL$L$H$LHLLvvLH$HuH$H<$tHT$H$L1H$H<$Xy Hl$H2IHH<$uIHLwH$IHTL{LsH|$@H4$HHTD$8LDH|$:H|$ t H|$ (HL$(HtHH4$HtHHtHD$8HĨ[]A\A]A^A_H|$A~@EN@I^L$L$LT$L$DL$THDŽ$HDŽ$HDŽ$L\$Hl$HL$HL$HT$E1LHt~H$L$HŅIOL$ mLSdM9D$nIT$H_IG LLLPH1LD$E~H H H0HH L[A HcI9T$uZIT$HtOLHLHL9C HmLmHAU0H$RLHHuHHl$HLH|$ K HL$scIH+H<$^cIHH|$(HcIHH|$HLLY)HLHHL}LuLmHt$FHuANHH=YVH5LH|$ 0GaH=-%H5 H<$$ANPH|$(LHHHHHD$0HH|$ HHH HLHHANH.HHHLLH:ANHH|$@L/D$8HD$8H>cH5O H8 HD$8Ll$xIAM~-HH~HLLg~HLL6/=~HT$0HLH`~-HHp~HLLC~H4HLGH$HH7HbH|$0HtL LLH7L&H|$02}H|$0L\ |,HH|HLL6|H=aH5 H? IwL$ 2}LpaH5 HD$XI: H|$XH H C,HHeHl$H|$T}LFH= yHHHz{L|$fHHl$H{'}}}Hl$H@ff.IHH;=z^ILq4SHHt/H8Hu1[H OH@HHk*[Ã[ff.H_HGH8HHHqu)Ht$H`HtH9G~LGIH;_t1ATUHSHGHHP`HtsLMuxL%[L9t1[]A\AL%[L9uLkxHH[L9uLNHuH{H []A\醁L%O[ff.fSLVHIL;]t L;%ZuLHfuPHH[H5\L\tLHftK~H5YL5uHZH[-~ff.@HH1HH9HHH=š%̚ff.AWH"AVAUATUSHHLw HHGLLI9LGMHwI;pIMPM,HHwH{IEL9MfHnIfI:"HxHCH}H}L} HEHELm H/tYI/t\H}tqHL[]A\A]A^A_HGI(tAE1AIHtHH{H9aH_S0IGLP0MHLE1AQ0H~f.ATSHWGHG_H %mH9OHIHt:x y9I|$t HL[A\LHHDC]DC_E1AWIAVAAUAATUSHHHL$ HD$HLLHHHxHEHD$HHIcIcLd$81H$HL$HD$H)بL]IWM4 H YI9NIVHIG LLLPH1L|$8HH H;4$HD$LuMGLkLO4A vL pYM9N,IVHIG LLLPH1L=|$8II AL;$qHD$fI]H9\$HHD$HH[]A\A]A^A_H|$8L|$8H=ZH5 HD$(H?$HD$(H|$8L|$8`LsZH5 HD$(I:HD$(;HuIL4 FLEXM9FIVH Mo LLLAUHy=1L|$8u@II AL;$tQHD$uJHH9\$H|$8L |$8tL YH5 HD$(I9#HD$(H|$ ҼIH}H|$HLHD$ pK}LHH9\$,YLtHHZnLZHHL@HH||@AWHiAVAUATUSHH8Ht$H9G~HHr}yQHD$LcxE1E1HD$(ALM Md$MEM~E LHE y}E1@M MHu0HʃLHIL[@{[LL$0DSZAQN LLD6'ZYHH|$J8|IM)LM=LHzHmHt$HBM(H8H[]A\A]A^A_LuHAV0Hu%|1H-3Aƅ{HkxEHtLeMH|$(H|$J?HD$|L9|$~XMu1IHHT$LH軘IHHLd>{LIwHt${E1L9d$|HE1bH{xHCxHt LLcxHǃH9UHHL=H H=vLLHHzLHHuHM HʃIMHCxHtHHHǃHu MzMzH->vHEHǃg1+HH%zH HA?E zuH<y{z1zzyT{zW{ff.AWAVAUATUSH8HHu1H8[]A\A]A^A_HEHHr H1aIHzHE1E1觍HL$ HT$H $IYHuJ)$g}Hq?HHc HDVHvHHK8fo$H([]A\A]A^A_fHvHH[8fo$$H([]A\A]A^A_L~LNAALvM+ MBI H1H9*MTA:HDnHvH}1AHuH LK8Hc׾HA@@H[8fo$H([]A\A]A^A_HvHj}}CLK8DU(jHHMEEIQ(?K}LC8Ey{Ar2As#Aa{IwH|LS8EG(HIOEEIR(?|LeE1McMx I$I9}KtHf|AHEHN HL{8HAP|Hs8D~zuaHuH<|L{8D](_HHMEEIW(2>{HS8D$ HC8HM`HHP(=AAwH0zLHTt{HMHU1HjGHYM{HuH9{LEM{M I LmHIu{LeHAt$.Z@@*HvHzHuHzUz zL5QNA4L{8HA:@DFLfAdA Pg1AjALH=ZYDfLnA0AMwH y H}LmdIHtu H;M$ E1H \MF$LHyHuHyHk8DHߋL~`HuHwnuHK8LABHSH<AuHe<HHC8HLhIE ?HtLLHH@_uLHLHvHuUDBA!tHuIB4L[8HAn;@@H=ח AWH ȗHHjLMLEZYLAy@'uHvHH4TuHK8VHߋ:AAqIHuH{8IHuHu1HHMtHuHtHK8nHypL+RtLS8HuHIBpLxMzpwtHk8LEpMpLupH=VH H1jLEHLMؤ_AXLCL?AAG@ ttD_AAtHuHtLk8IHA9sH5GH sLc8HHA$[9@@HvAQA1jAhH6AZA[L7A~@ srHvH,LsHS8EHߋ8-sH5FHVsHs8HߋH8@@3H= AQH HHuLMLEFAZA[HvHrLS8HA18rHuHM@@H=ATH HHjLMLE轢A]A^o11I>LH̟BAAqHmH^pHUH\LK8HAAAH5{EHqH5_EHTrqEHs81Hߋix@@ItH ,qLk8MEpM`MepUMl$LHHL)L豧pEt$HS8Hߋ AE16E]AA*pApA pAApH5L\L<H5?M9AI9AEmmLmLLmE1KtHmAMcMnM$M9|ҸH{8IH}mE1L]M9KtH8XmHmHBtL?mH{8IH*mHS8HnHzpzJ mHs8H~pLoHLnp2lLK8HAo2lHK8LQpMrLqpE1IcMMmIH9ItHUulAH= H|HNlLH H=۟ zHcH@lM:lEu"L[81ҾiHA  H}J4HLK8HAkMl$KtHqkHC8Hߋ"1rkLC8HA1RkL]HCtyJ9kH{8LoH kHHHkIH= BHHAjjjjjfAVAUATUSHH|H[lHHC8Lh IU lH x<H9M&HUHMu Ld$HLLAVHHkMeL_IHkHHLkLHmMkLK8IypAmkLS8HH@MZpICL,ظAEdEeAmH[]A\A]A^H|$HILt$IąvH=\=H5mm H?[LEHAP0VHhHHfDAWAVAUATUHSHHH;5<tcH;5<tZHHIHmH{0HHǦII9u6HEH;L;thHS8HH4@HJpHyLE(E`AhH[]A\A]DATUSHHHtC;C tf:fA:fA:dHHfA~Hc HL~MfHvLM/ e1MuL9I9L]LIt# HA|$$Hv>RLdM\$8LAǃT AAHx[]A\A]A^A_øHxL1[]A\A]A^A_\*IHKdLMIMHu1LL*3"dH]E1McHeLM9JtLfcAHHvD@@H`>E%xH @ LcHuDm8HD9n 1҉L9mcLuM$IL$8SL狑L7HAAI|$8HEHpHZIl$8LepMl$LmpdZI|$8IrI|$8HeI|$8IXIMbHbHbMbE1HLL{6sbHuLW_bIT$8DL狒?bI|$8L]LGpMhLop5bIL$8LHqpH^HuHYpaE1Hl$H]LEMcHcLM9 JtH-aAH^(H;HuEHL;aMD$8HEIxHHI@HHWH= 蹬IHvaHL-LH= x 聬IH>aLHL b赳IT$8LHr4`H= 0IH`LHLadHu L `I|$8LJH7FPH5]*L]`MT$8SLAe`LOLIM`ID$8GL狐_11LL\ `L蜲HuL _HMHUL!_E1Mc1HI9VHuLpHvHLNV_HuHI|$8Ll$_L2HAALV M*HxHL[]A\A]A^A_5HxL1[]A\A]A^A_龫HvH`L>1HD$L9 f~¾ LNAALFAox A" IpLLD$<D^IT$8Ht$DLD DHt$Hu^ULt$DjA `H'B4Il$8LLt$]L\$IL$8EoC DAfE: IsHxL[]A\A]A^A_kLvM]IH=u Hc}DIHHLD]LHձIH]E1L9 HMNDIHKDILvHvHAIvL\} IT$8zMD$HuLAt,IL$8eLHQ(H tML$8IvIyH6HH9\HL~^HޮIt$8L狖<C} ``HD$PHvL[I|$8cHD$H[HuHj[LLL$LT$D$ J|MZL\$(H:Lct$ Ll$1M)Ll$M|$8H;\$5 HUHL$LlIEoP(ALyf~L9#1wHD$@HI}fLHD$PAH9\$(L$XAE ALt$@t$HIuL LL$@1IqH|$@H97 gI}ML9k1M}H\$0LAIcM\IH9 IHT$nH\$0I|$8-+ZMmM|$8LLAo](A ZHL~1LcMJZMM9zKtLYvI|$8IiI|$8I\I|$8IOHD$HMYMYMYHYMD$8LLIppLn1MhpE1b-ZYHu1LLI(AYIL$8H]E1LIpMyLypMcH][LM90 JtLtXAf~¾ LHD$@GY1HT$@L.0YHt$@HY1L5YHl$@I|$8qHU+XLE,HAAH^D;AXAA|$ I|$8IH(XHuHL' XMD$8JLAWHuH4It$8L狎ZMd$8ML$pMiMl$pf~¾ LHD$@BY1HT$@L-YHt$@I|$8HYHVq*YL+H@@HxL[]A\A]A^A_HxL1[]A\A]A^A_oaMD$A XXI|$8jI|$8I]I|$8IPMAMHAEVHVHuLqyVM\$82LA XVID$8E1HLHxpLoLLhp1*)VI|$8Lz)VIT$83L狒UH5L0UM|$8HLAUMD$8WLA^UHuLzUHMHl$E1HHIcHkUL L9&I|$8LqHHl$LJ(,UMl$86LMUpAmxMrMupLuAov Af~THm E1Mc1HtHEI9XWMd$8I|$pH_I\$p&H8Ln(TI\$8HSpLzL{pH]1LcHVL;M9UJtLJTI9I|$8IH TILqHl$I|$8LJl'SID$8Hm 1HxpLhxLxpLcE1H M9d Md$8I\$pLsMt$pHUHt$LLtSH5oLoSML$8IlLIQ( NSM.MVM]Ma 1ALپ.LH LLSHEEPH uDoN DfD~L~R1IvLCRt DDʾL6nRH|$MD$8_HOIP(L AAhSIpLLD$RIT$8L狒 QLL$It$8LEQ(HV(DjL$II$ QIT$8D\$Ht$Dg IpLLD$wQHD$LHp^fQI|$8L FQMD$8LA  QID$P9U8~H}HtH5 x >FDRLL;XRL蛣It$8HMHV(HUlL  E1L9LEOtIMu>A Ɖƒ @3Q"Q@RLi0A}*AEI|$8mHW(L7PIvLHID6PIaɢIL$8L @@SA|$(LOI\$8FL狓i AAHItHbOAEQ1DoU8 DfD~L H1TIHfHLLD$袛D$AL1Ҿ.LLT$L\$WIHHHH|$HD$ HLv~yHHz1I!L$ JtLHHgIl$8LTAAfD~¾LGIT$8<L狒@@NH|$@D$芚|$H{LwAaJ GMT$AM\$8A{}HuL @@HmH\$(H|$LtMAo`(Af~F LaIvHM~E1IcMFML9ItLIFAI|$8XIT$8L狒iFM\$8LAHH|$HD$+H|$ I~AHH|$H.LHD$IH=FHT$HHt$LHEQHFMD$8HHD$Ix(DLL$HHHIt$8HD$ LLL$ mHD$ LL$ HLwILT$LLEMl$8LA7jD L"AAH={ H]H2EHtLEA=FHT$1LD1HcH;}HtLLDM|$84DDDDDDDPFFDFDH- H5 1H}d1FFZD:DPDKDFDfDATAUHSHG8HxpGHU8HH @HrpH~LAA@StE`[]A\ÀN DAW AVAUATUSHHLs8H$H|$ HD$H1IVpB uVAdžt"H5z H|$  HHt$ Lv8Hl$ ASHGLu8I^hlE1AIH HHfDDfE~AL~1E\$IAOS/wMIIu\MuMAHuJID9uH6HuH$AąGGHHH#t*GN(부N(A9FM/A}uIUIAHD$ LHxGS!ALGDH|$1 fAn1fpfք$DH$H]F1tDH$H.FE FHt$ H$D$Hn8Hm HDŽ$H}]HD$0IH|L$L$H\$8L$Ll$LL%k; LD$(Lt$JH$Ht$xFt$xRL$H I9HnMWIME1LHLHuL$H\$8AMD$@Lt$L @Ƅ$ AE1L L= @HcI}L$[ZJ,Lce9HcL IMB4HHA#cw,DH Nc IADpOn AE9xL"MmL M/H\$8D|$@Hl$ LE8MphMtL!DM6MuHc$HjOIH H$H@LK G$I:HpL`LNMtF(uAy$u LHLNIAA$N~CQH~LkL_M IHHALM9uM91LwLnt ڀqP9UH@H9ECHEAEqLD Ant Aqxx19}\HpH9uNHuEs<LDAnt Aq1DP1D9UH@H9EHEErLDaAHl$ Lu8I^hHmL#M[I$HH HhHHL+MJM}MALM?AMu I?.H|$K46(v.Lc$L$MMEAOL AD$E$$I fAAA-ET$E HLHD$@H:AL$HD$@L5M9XM@ L$Md$LaM\RA9KIcH1LkL)A9HHk|d DD MOD$A9Aq,DL9cLD$AA,IMHLD$DLLwA~ ESMcIkHpVAVL9fwg( ^11LIVLD$ MX8AA`LgAD$(,ALwAF(fn^Aq(/Aq@A9-IAIAAN,G4AAHHDq0DpG,/EsA)DpD`A9ƾDEEQXDAqpAe(AEALD$AAILAEDAAAAA0AA3)HA7MŸHD$H:zH$HH^)HD$HL\$0E1E9~/MkISJc|LINTIEHDqHt$H|$ HD$HQ (L\$0L$MCL\$HMH|$0L1HwHtrHt^HtJHt6Ht"HtL9L9 HL9 HL9 HL9 HL9 HL9 HL9tiL9 LPLN9 HL9 IBN9Lt|IBN9LtqIBN9L tfIBN9L(t[IBN9L0tPIBL9uH=y*H|$0LLD$XL\$PLL$HWHL$HC*L\$PHD$XL$LL\$HHD$PVvLT$H1H|$PLo L<A9~HkHA2 Edډ}>AA6O*2H|$01LczHHl$ L$L]8MM2LAqMVA aAET$A9Ic1HkHl5HA9 DAcZA AA<HA9*뮀8np19u(DD)ˉDHD9M;)@9EH]ErLcLeA(A:S1A9LkHFDAA(A(AAg%IDQ(LHqAC(LD|$8ALt$@D ЈA(EISHLkLEEHDNIHAk$A$HQIKAryH{&CDxMcHMkLKLk!Go)AG1K|)IK|1IEL\$ AAiI{8AAIA-z%AAEHl$(HHl$0HcLkIE;aAuaEA AP#E1WqE ELzxAuEAtAh#E1E9UIkID E^7%LT$0t$HIrJ<覀A#DD$HHc1LLkApL A9uI}B'qAM(E ImBD% ##ff.Gt)HH@HGH 1@qt@nt 1fDAT1UHHiE(uH]A\Ã} E1D9e~CH|$%McH|$HAMkLUAoLkLGAMZMX뷀O(1DGIE~rU11EHSLWIcLЀ8 AptY9u3HHH9u[]AKI[Ht{tbH[9stD9tHcoLkMAHXIX1ɉOD9txA9~X(x9up(HHH9tDiH[G+G$ATUSW H5AD+gWA[A|xHKDCHqAs$McH~I9}mJt ADC@.Dfkk$[]A\1H%$AA~1H$AbH?#HH{!i#LcSHCMJT AD[@*DbDcDc$`DHh#Dc AAAff.ATIUHSH>~H#H}0HHHOH+HtBHb#H9u[]A\HH9UuHm HEI<$#nI,$HCHP0ff.AWAVAUATUSHH8HH4$HD$oIHtkHl$ Ll$(E1HLt$HLLtDL|$H|$ LT$uLsE#H}H, HLt$Ll$I H<$HmLLLHuIL9uH tHCHPA(HSD I:#HL H` zLkaHB LKH$ Ls{H HkLNL;N "MQLSA.lHAHCH{0vH H{M9IyAAH{E!Hv LKHX LKAWAVAUIATUSHIH|$(H|$XHD$HHD$@HHl$p1HHIֺIHH$MDŽ$S;LL4 L=Z H\$PHT$(H\$PH9snL >4 HrHt$(DA\A;$OH$$H|$xHSuSH$DHT$(H\$PH9wH|$HHH|$@HH@Hĸ[]A\A]A^A_fH$fD_HT$(H\$PH9?LD$XIM)IL\$hH9HJHL$(zGHB HIH)H:+H9rHs!@uHHt DD @uFLc[]A\LLHD7HyHHD1H)HH)LHHʋDD7DD1DT7fDT1H)HtH{HLff.ATUHSHGHHHH9}HHHKH41[]A\HLCL$HL9t->HHCHsH{LNL#1LKH,H QHCIHHsE1 JDKIL9ff.fATIUS1HHGu9f.HI9\$v$H,HtHHmLHuID$I|$AT$H[IT$HL]A\fH2MfATSHHwPHDNMcH8LGOи I$1LH5` H=& "xOHL[A\H1HHuHt$w IHtHt$HHH?HQtLE1LfAWAVIAUATUHSHL9_HHLA>HL$PAdHL$WtL|$x%O3w*HHHu(ILLMIqL^ fH|$pD$,H5} )D$0)D$@\$\cDGH53NLcd$XL MB4O,+t$ tH|$`AƒXAEt nEHMEHHx E H]ƒ @@Hu0>-H$E1McE1L)|$xno|$hLl$0LL$LDT$-]H|$,T$MLL$LL$WLt$LAUjLT$(.^H H@\$,A9^Ht$INI+N H9P1$XILLPAUT$hRLL$ H`H HtHmJLdH[]A\A]A^A_LJL9^H1ɺ []A\A]A^A_N|$hdH=H9}SDHLNH>Ht$HLx)Ht$5HMIHuHt$LH1NLI-HHH[]A\A]A^A_6H$AA-H5{ LLl$0I8ipff.@HHGHLO(E1H~HLHFF HFLF(F$u,HF0HF8t,f1F@HG0@LVHF8LV0uHVHV8H /H~HHHFF HFuE1lL `ff.Ho0f.HHt2HSH)HH_H9HH9_| H_H[HH|$:H|$ATHDg GEtLG$L)tuuuHLA\sL'IT$ H)uH7H H11A\CLd$HH;wtH|$gALd$HLA\ÅtHLA\>ff.HUHWHHB`HteH@0Ht\H5vH9uMHLGIwHu$Hc}]H{Ht H}HHx]Ht DMAIc]Ԉ]H ¹HRH5y 1H9E1]ÐSHHHGHwHu$Hc{[鎈HHt HSHHP[Ht{Hc[aSIHHH\$HL$Lʃu2AB @t>A@ @t7Ht-AIYHHHI[Ãu,I[ H[HtIAHxH[I[ fDfG Gff.fG LG$HGHt6HHHWH)H9,HHHWLHLLHT$H<$ 8H<$HT$Iff.@HG0HHtfLG HW(LHHHL\HE1ɹ4?HHHHHthHtBHtLRHMIM1IM[LHzHHHH1H5M[HI1LRHLHL1HM[HI1LRHLHL1H5M[HI1HzHIII1IM[LM1HzHHHH1H5M[HI1LRHLHL1HM[HI1L9@LRHzLHL1LR(H5M[HL1III1LHIM[L1LLR8HM[HL1MIH1HzHM1IM[ILII1HzXIM[L1LIII1L1LRhIM[LLHL1LRxL1HM[HMHIM1IM[H1LI1L9HVI)Au IUoM1L^L)ڃuKIA8#IiMrL1IHIH I1I1Ii H6H&-@UHSHQH=[ IHtHEHHhHHX ZL[]ATUHQMHWHH9B00-jMHHI|Mu9H}HtJ@H}Ht<@HdM,ZL]A\oM,f.HyH9GAWAVAUATUHSHHH_ HKHHu(Ls HM~CHE1L=ksLc8Mt I|$@u4H{0LWA@uRIHM9uXH[]A\A]A^A_"LfLHM@H;=H[]A\A]A^A_@MHM8L;uHtfDM~HHtHK@IkHU(LzMtMgA$@IALE(IXHtLSA@GIHM(AL-A%MgDMHML;H{HpI9%HKLHMu[H;I|$qHK,HH=qpI9uP%LSPM9u'A$%ID$HA\LAHAAхwLAЅ>LfDH5I@USHHoHHUHH9W;H}(HG HM LAHq HQ(IH<@M LH9}PHzugHHLBH9~DL$8HIh31LcD$H= -T$xBYEIMI2D=TD5\S5tDL$xHl$|P|$xAY4IHtsHHSLI^[]A\A]XH_1E1HIHtsL9nJ|1Z8H0H=0CD, IHڏH;t*HMHQH;H5tV 1E1J HE1@H?AT1E1IUE1SHHoI9}zFT# A Kw+A AMIILL)H90LIA\vA A_MIIA"jA'uIA뫅t MA'MIH@ @0@_0IP0bHJE1DbI9}yBD D8<\< < < p@^w HIHf\x@HL DC4@qH:AD![L]A\AA"H!HL)H9v/LA'f\nHnf\tH`f\rHR\HACHADfDHHG;G ;@tHw ;H0HH@ATf(USHfTC Df.7H|$ PfEҿfD/rD$ EE11DEIIIHfA.zXYHH!DRHL!H fA/H,HfH*H\L9;fA.zbYHH!DRHL!H fA/H,HfH*H\L9C;fA.z YHH!DRHL!H fA/H,HfEL*HA\L9:fA.zYHH!AHL!H fA/_H,HhfEL*HA\L9v:Eu`л=A<A)IDHcHII=D)M!HL HH9HGH[]A\D҉f(A\H,L1RHIfHAL H*XBA=AAmf(A\H,L1`fWa@~HIfHAL H*X@fD(E\I,L1oHHfEHH L*EX_fD(E\I,L1IHfEII M*EXf.vf/@/H4HFHHH8f.H ff.H)NHWHB`HtGH@@Ht>H5H9uHxH;uHHDfD{PHRH5U 1H H91ZfGfT>sff.HHHHMff.HxHH9Gu HHf.HYHH9WuHfDUSHHHMH.H^ HHKH=/H9tH[]HsH}H X[]7H  ff.@S1H0IHtVH;uH[!HHHH fHnI@HfH:"HI@A@ L[ÐHOLOHA(L@@(uHuHQ0LALY0LHLAHz LHzLff.fHGHVSH HL$HT$ڋH+H8HqHX&HLمHx&EHHX&EKLHfHp@L8HP~T$fH:"T$MZIHKfHnH H1fH:"HHsPH [H=ȈHuK1HHff.SHH HWHmH|$H4$H9u?OIL$MJI9ABD$YD$pH [HXHtdHyH~;H9YtmHt/H9Y taHt#H9Y(tUHtH9\tCHH9ufHt$H|$L$_HHtH9u@L$D$3@MXMtyMXM~KI9XIt;I9X  It+I9X(ItI9\HI9ufHt$Hx D$H$MMtI9HD$f.SHH HWHH|$H4$H9u?@D$L$MJI9ABD$XD$nH [fDHXHHyH~GH9YtHt;H9Y tHt/H9Y(tHt#H9\tHH9uf.Ht$H|$UHD$sMXMMXM~II9X2It9I9X "It)I9X(ItI9\HI9uHt$HYx D$H$HHAH9MMtI9ff.@USHHH?HGt=Hf.W:Ezt 1H[] \I1MtHH3HHfHnH(fH:")$Ht.HT$H=KHHHt9H/t(1H(H=2HHHuGHGP01σ1)fHHGHGGHOHQHw4HtHtf*GHfHËwf*Ht$f.9zAGH|$H H/H=H5M H?.8ff.@HXHJH;GHBtHpHtH;puHGLB AtIpHtH;ptHFANTAtIpHtH;ptIL9FfAU1ATUHHH5 SHӺHILD$HL,$Ld$H9MHU bFH I9L$uAIT$Ht6LLLHL9E t?"t'HHH[]A\A]LHHu-YHt%1LH蒄LLHEff.ATHHUSHHHFHEHHEHHuXL%H{HEH5tHyHHtzL;%u%HIHu HL[]A\LgLH言IHiHAPALs1HD$Pjj H HHREEfSHHHf(t1L$y% $HH~34)$fTf.DH=CCH=/|$@Dt$@DfD9DfD$@l$@HL$4HT$0LD$8f(fDt$@Il$@MQDH\$8L)HsHd,Ll$@dL|$4DL$0MHH H HDA)H 1Z9H|$.Dt$.DfD9CfL$.l$.1HpfDt$.l$.;"fHL9LI葽HİL[]A\A]A^Y 1Hİf([]A\A]A^~f4AYX.UHu\~a1-!3)$fTf.jBHHt$Ll$@ HHBHt$HRAE1Df( $fTf/ T1H=~H5xH 1H?f(AUATUHH3CHGL%3|HL9uGH]A\A]@HXHHzH~OL9bHt?L9b Ht/L9b(HtL9dHH9ufDL@`MMMLLHM9[ 1f.L$ztodIHtlMMM9AImAED$LAQ0D$HHH_L9uf.E1SHtD$AIHz*1\$Iu)H )yHP1H5F H90iHG"IHAHSLD$D$4f.UHH HzH9FuOHVHtEHE HL$HPHCHtH|$tHzHH ]HZzHHHt$HHCHt$ff.fHnH(fH:")$Ht9HT$H=HHHt9H/t1H(HGP01H=ǎHʽHHuCAWfHnIAVfH:"AUIATUH LgH=V)$HiCHLNHHRCHH=}HHCLiNIH CHzI9D$uKHzI9T$0u=11LLIMtFHmtH L]A\A]A^A_fHuHV0I$LLL衲LIH zH9t LHLnIfATHSHIHtHBzI9D$u HL[A\LLHIAUATUSHHHGLoHX M~?I1D{u"CuHSLH:Ht HH/t HH(I9uH[]A\A]HOQ0HHMxH9GALGHcL9u HL uH= H  H5H;uH;Vut H;ewuCHmuHMHQ0LAHHuL LHAHuHkHHmtxms8HUHR0yADH5IuLBuH>H|$HI8tLH"uHH[]A\A]MPLAR0AfSLNHIus~ JHSHC ‰ uJ@t+H0;[+Au3hJH{H@eJ?HHHVHuL~ [@,JHsH@J>H5DrL,BIHSHu HS(:LqH5C 1I8)1[DAVAUATIUHSHH^HwHzLmHFII}HIHOILXMMHM~:I;pt^It.I;p tRIt"I;p(tFItAK;tt3IM9uIt$IT$LOLFHIIf.HEpIHMAH} H9HOHINHszHHtKI\$(LKC(uAMuOIT$0HLAHmt H[]A\A]A^LmHHD$AU0Hl$HIT$0LHLAIV HI~HIT$0HLAHWLFHtLRAHDH=oH 11H5A H?@tH9HHuHAUAATIUSH(HD$H+IHt$HHsDHt$HHHT$HtHt2H\$H9uRHmt H([]A\A]HMHD$HQ0HD$HHnLDH5B H81o1HHD$H|$fAWAVAUATUSHHGHG HeH@tHIHL[]A\A]A^A_LkL$IH5H@ lH@ZHMt$0C уL$ OHHkH@&HE1M9}|$te|$GB\}K4>Ht$~v<t o u>$ÅyH|$?CD>IM|$+0C>IB\=뤻 fDAWAVAUAATUSHXAH|$Ht$ HA$H LrA I+ D$8-AE[0_ D$ AuDHMcffB.z[ L pML11<_ IHHUE$HE9|ڀ_ @_x Hp fH*BY X "f/ 3%!GH,LD$(HH\$H9FH<HH?GLT$HoHt$(L :oLPHP HjD`EFL2Ht$0IH=K FIHHCHL$(Dl$AD$MT$uPMYLIHHЉH?HHFLMtA|M[zMT$Ed$EtBEbIEyE9H|$(AAAA0EXD$ AABMcEtqLHiLH]MIFMI%MII0__D$ A HhM11f.<_HIE4$F<3LE9|A__HHcHHH9@HLD$AHHHIHI8L\$HILPM11LfIM9r9A<_tDIL ƃ~݉HIH?WM9sDžt7HHL)HI9?LL\$DHl$HI1 I^D$8IH|$(IIEA@ƒ߀XtdLH9HFKHHLbHD1H56 1I;nHIAL9LMMH|$ tL|$ M'LhhMD$N1_tI_fLD$AA*&LD$M^&BAMMMI@vLL5O G$BIE9VH5CeH8L_ApoLcI9cL`H5O5 11I:CmI_LGt6AW_LGtDCHHHxIHIt$H@IT$HH LHuHfHnHHHH<HHHtZHtHHt;Ht.Ht!HtHtHPHHHHHHH9t(HBBBBBBBH9uIItJ IHIh[L]A\H~L 1H HLRHLPIHteLZLXIHtSLbL`I$Ht@HJ HH HHt.LR(ALP(IHtN$N$II$L9uHLH9oOE1<[1]A\1fATISHHHGtCDG E=LWLD_ AADA t]A@tQHG0H[A\1LHL$L$u+>L$HL$IPII$Hu=HGHHGHfAVAUATUHSHH?HL-r^M8H5FIHwII$LHL9u^Av I~Av 9w@LU(IBHHuI<$HKIT$M8M FAh H[]A\A]A^LHL$LD$uLH7LD$x9AN IVAN ;J@xH5 LLD$g LD$W1fDAWIAVIAUATILUHSHMvFMhFI^FHUFHIuIHF IHEHCImIoHCI>AEIIpHELd$@Ly 1LHH}H4?H<EHLL$H$HhELt$hfvHL$HHT$Ht$MHD$h)$IHDD$D]HHT$EEHMDLL$L9LNMHD$|$fAnfInHDŽ$HuXI9f:"LT$Hf֌$INLcLIfH:"LLMHL$PLl$XHH\$`HL$@$L:Lc[HM8I{XLLH&H|$hI:H|$`Ht H/H$L5NH='HAfHDŽ$H$H=$HL[]A\A]A^A_IE1AdCLgAT$0nIUHD$LR0LL$I}CfH$$AE/HVH5+ H:pH$L|$hHDŽ$M;H|$hE1s)LsLu&6HHYL8IzXnARDH]BILL$LL$HIAHLL$,@LIILL$uAH-UH57+ H}AfAAWAVIAUATAUHSH8HHGLHHH$L)IyHHG(H9HIYKHIHMHM%FLL$H=ӕLHFHHLL$HLJfo Dc@E1L-hO LsHUA>HS|HO AALcE1Mt$A<$'Lsw{A $LtN IcLLuLL)HM9E1HLLSLqLIt(HN$I wOcLMADIH8L[]A\A]A^A_MID$Mt$ML$ A~\$0fI:"\$(HIVIIT$ML$ I9LLHUM)MIGLI|$IHEd$@HLD?Dc@LN4HC A>LsHSAv  E^AO4LscDID$8HtHpLMVLM M|$(MA~t$0Mt$fI:"M|$8IT$ LJMHLuI_L)MHHG<HMzHLLMt$LE\$@LsHUHCD[@DIt$8DD$H~HH=ƒHM$MT$LqLIHDD$IIL$8ML$M$MT$HHLMLqLIA|$ L{EA|$Hc HfLsE1L;4$'EE;T$IIfInfI:"cEt$LtMIILHL9LQM9HHKLJ HC:DLL{8MAII7HL[LDwHVIL]M)HS L9Gt H9\M;_RIoHf:S(HLM)IHL{8M_NLHLs8MbHUL)LIVHGGHIPMvLLI LHGDK@LwHDO@M@ DD$LL$ęDD$HHC8u@HKHHH@LHPHSHHLt$HHHUL)HG^HDIt$HHLL7N4HGA@M0M$HAMT$LqLIL[H$LL$E1A|$L)H9gL]AT$ It$HDD$tFHf?HLL$N$I\$IT$ID$ DCHIT$I9DD$6D;BH;U:DofE:E|$(HLHUI)IIGzMII|fDK@L[EtwDEFL]AnfDLL$E1LKL; $RA1I|$DD$LL$IDD$-HT$E|$LL$HzOfHnH&H fI:"kfL;}t A ILcwfHJ.HL[NHCLLHyJ4KI9LHID7I9LIHL9At$M$LcID$8MHhIT$(HZHI)LL[ML$8HDIAHM!MM|$8I\$A~l$0fI:"l$(IWLI|$ DRH]At L9'I;_HI?L)H(;Mt$8HMNL HHM|$8LvHUL)LMIWHG:HLHHLM\$8Ed$@HCMsDc@I LsdHSL4$E1A|$I)L9HUTHC HKD9B<0DoIMfE:Dk(H{DOALHHSL)MHUHGC8HLJ1HHEd$@HLDHC N4Dc@LsoHLf:L{8{(H~ ME>Et7E^LcADL9$$vA$A;V9O4E>LsEuE1H{8LLS(MwN4M)L`LLS8M:LcMzIHLeEwLLZL[ L)M9|oIJf:K(HHG-HLHHLsLH@[@LpMHUX@H>A|$@t |HULADD$MD$HIt$L\$LEH @IHLT$HDD$LH=~S0fH:"S(IHCHC DofE:Et$(AOMDLET$8I|$IT$ DOL9|3M|$fDL9<$v E7E;t$8t#IHM|$IT$ L9}E1I9LHMd$L)MLeHGqJ46HHHULL[[@HFA ^@HM4LvDL$I)I96L4M9?HHLIoLMLM\$(MJI)LLM$LqMT$LIAX LeHLL)HG5HHsLHHLH@ LvXHL=IL$(H AoL$(Mt$LMf:E>LL$LsE1L;4$A>DD$vA9D$DD$M~ILL$H? fInfI:"{H{Ed$HH+ML9 L)HLH}L)HG LLsMHHHUM LMIIB MrAB@fLL$HSE1H;$:DD$HT$>uI|$?DD$L|$Ed$H> LL$IK fMnfL:"DSE\$E1ML9QHJ|J4HH9AD+H"H92LsE1L;4$DE8IHLsLL$LsE1L;4$A6A|$DD$, DD$IILL$H= fMnfM:"DK*LL$HSE1H;$w2I|$DD$HT$] DD$NE\$E1ML96HJLN4I9AH@AMI9LL$ E1LKHL$(L; $A9DD$LL$', A>D$, 9D$DD$H|$HL$(IH< LL$ HH{E\$E1ML9wLOtKL9@M@@PHGL9WHKE1H; $-DAw L=$FG0w LFA42E1D9HHHKLSE1L;$A2w L5EA46E1A9t$IIfInfI:"C5H{E1H;<$7w HE42H|$I|$E1DD$LL$<DD$KLL$Ed$HV; IK fMnLL$fL:"DcLSE1L;$A2A;t$BLcE1L;$$A<$ ILcfLcE1L;$$rAL$E1HH9LI|M4HI9ADyMpI9LL$ E1LKH|$(L; $LA9DD$LL$pA>D$p;D$DD$Ht$H|$(IH$: LL$ HHsLL$LsE1L;4$A6A|$DD$( DD$LL$H9 IIfMnfM:"DC6AL$HH9 HHtLI9AH@A M I Lc1L9}@L;}GA? !8L]LUL\$M9M9B EwDD$(LL$ DDt$BLL$ D$H8 DD$( L;|$ E?DD$ ALL$DD|$ALL$DD$ H8  D3t$E1EmL]HEI9TM9 DD$EGLL$DD$HD$ T$DD$LHD$ E4QLL$fA_H!8 @A AI9*DD$E?LL$ƜELL$DD$LH7 C SfA_ A9AA^HMLUL9I9E_Az*HBEB@A_ @M9;*E?Az%*L5aBECA_@ DD9@@HMLUL9I9RAG6LL$DD$t6IMyLJ HHI)LM|$(LJI)LIIG)LHS8[@MHHLrM $MA\$@HULID$I Mt$E1L9]*H;U+uE1L9]|HHDD$ LT$LT$L\$+LcEL\$LL$LT$DD$ HLItN$LIHmDD$LL$蘑LL$DD$H3 L3 LcE1Mt$A<$'LsA4$IcE1MHG $HLHHLLK8H@MqI HIt$HDD$LL$n-H#LL$HLLCE`DD$I9HCHC _DDD$ZDD$H0 DLL$E9LL$DD$ H/ DT9H/ |$_AD DHHDD$Lt$̓LcEL\$DD$LHHUI"O<MwAAG@K!HHHMM4LHCLsC@HL$H+I9HHHLHLLs1lHHDD$LL$LcELL$DD$HIJE1L9K j{@L[t L;] !E15DDD$ XDD$ H2. KDLL$ i7LL$ DD$(H . %Dx7€|$_ H- t$D$Ed$O4LsLGAP0YHHL]IRIL MIRHEJHAsfSHHHt HCFH{ HuH{(Ht HC('1[HC @ATSQLgMIL$HH9O$ID$(HW HI|$ LGHw HO(I~eAI$MHkILH9}PLAMt,LK0M$HIMHS LK0ILZ[A\HHAH9K$HCLE18fDHH%HwHFpHtHHtH 7H9u.HGHHVhHt H:6%H= yHZHGff.HG %HPhHt Hz1AVAUIHATIUHL2InHHHHHHPHHEAHJ8Lt MH5=\I9H=}-HuAH8LM0AA$1%E1L1BwH1HLFHmt H]A\A]A^LEHD$HAP0HD$HH$HEHUII>LLE1HL6H$HV)Hr1LLHAHf.USHHoHt[HwHHH9:%HHt HCH[]H*H:tFHCH覵1H k'H9u1ff.USHHH(fHnHfH:"Ht=Ht$)D$H=%B`nHmtH([]HUHHD$R0Hl$HfUHHHGHPHw!HtJHHt}HcH] HHHD$HtH|$,HD$H]ËOHcff.@HHHwHt(H(AH— HHt-H؎H= ,AH 1mHHu1ZHWHt!HFOHt%vHx2Hx)19HFHtv11Hy11ff.fHAWfIHO|OO:AVI1AUATUSHH1HL-*HT$XLd$P,Hl$Hf$H|$UD$HL$PHD$8Ll$@Ll$H)D$`)D$pȎ1HL$@IHT$0LLƄ$&0H|$@L9pH5)L8LGMH`MH#I:#1\IHH|$HL9FLl$0L|$8MUMMIHH`AH9MEH=Im fLl$XIEHl$PLD$`HD$hH|$pHDŽ$L$x$L9MHL)L9O<I<$MIM)ISMJIcIx$$I~oMI?IBTH8HMAIL 8uMXHMAIL 8uMXHt{MAIL 8uMXHt]MAIL 8Ht?JLHt$MpHL$Ht$LHLHH 8MDIsHt$HI?.L $E1B:3`BL3IIL@uMIM9}IMt>H|$XHt4LMMcImHAHD$XH/ZHĨL[]A\A]A^A_DMHL)xI~DUIxAHHDHLMHIL D8HDHuID:IH1ALHHKL)CfE1<$RMXLL$1LLLL$Hl$PLD$`1K47DL D8 t\H9uBL3HH@MLfL9MHo0HD$XH/LAW0HH9IJ`LL$HH1L2LL$HH=D$HE1ALIF\5F80HH)H|MX2LHIHLHLL $L $IMyMMIX1I<$UL $LuOL $IIIN4 L $H<$LH<$ALHH0SL $I`I]Ht$8LL$VLL$ZM4Mx%Mx LIIALMHI߾LHHWL5MH5 I>AUATUSAPHHHH9fHH=_ IHt]HtcLkLiID$ H(Ht HHHIT$ MD$ fHnID$0fI:"MD$(AD$ZL[]A\A]H@ E1ff.fAUATUSHHH8HFHP`HH;p#Ld$ Hl$(HL$LHRLl$L[HLLLTHHIMzH{(H|$(IH8L[]A\A]HkL%k I4$IHHL9KH[(B< H8[]A\A]b1H= 4IMH[(1Ht$IHHxHt$LH(LT$(I<1HHtrHtZHtBHt*HtBIAALT$BIAQLT$B IAILT$F$IEaLT$B,IAiLT$F,IEiLT$FIEYLT$L9B4IAqLT$BAALT$BAQLT$B AILT$F$EaLT$B,AiLT$F,EiLT$FEYLT$L9uE1HLK8I<$H5& Ht4HH5H6YHHt H;[Ht!H HRH5 1H9[s1[APHHwAH Hʈ Ht HY1ZATIUHSHHH!HՅw!H{ Hu"H{(Hu'H{0HV![LH]A\LՅt>!LՅuH{0Hu'!"!@AWIHH5b AVAUATUSHXMiL $H"IH@L $Il$HH>HqHL$0HL$H $H aH4$11II'fDLH)L9LHPI9l$rH9}|MT$A>ID$LSHHo0IGH/I91Ho0IGH/%H9$Ho0IGH/[I9Ho0IGH/6I9Ho0IGH/SI9Ho0IGH/DT$ AMt$tM6H5JI9v(ILqH|$LH|$H|$LAH|$H|$LAH|$H|$LAH|$H|$LH|$H|$LAH|$H|$LAH|$LFHX11[]A\A]A^A_MH|$LAH|$H<$~HH9HkPLL$踠LL$HH$lI|LL9_1LL$(HL$ Ht$H|$0+H|$Ht$HL$ LL$(MLVHI)M9[IA H$HD$1>f}v@uLHHPH9HtIu$EA fDELLBH2ItHLHt$HLHwL-H1E1HNI}H5 jH|$0H|$H<$KAWIAVAUATUHHSHG H] 0@LH0H9dDEL AAL-yG$YAECTeLHt LՅuIIyE1D9kP 1[]A\A]A^H{@IcHLl$@I}uA}tmH}M\$MM;]LH$HHHLLj`H$AU(IL=I 1IHL$HHyHL$HYUHD$8HHHH|$HH\$HHD$8H|$HrHH\1IHLT$XI$MLIELT$HL$HT$PLH/H~H\$PL\$XLHL$=HHD$~Ht$HHH|$H~HlHLIL~L4$I~hL~L|~wHH\Hq^~LIS~Of.SHFHIHP`Ht HuHWLMfXL;%H I9uvHT$E111CLd$tMt3HL[]A\L;%t LHXMtHD$LjH&藷IHu2H5hH>AILemHZWI$E1WHGHH; H@@!ff.fATLfUHSHmt#H{@HYMH/HHC@1[]A\HEf.{ff.ff.SHH HWH]H|$H4$H9u?OIL$MJI9ARD$\H [fHXHtbHyH~9H9YteHt-H9Y tYHt!H9Y(tMHtH9\t;HH9uHt$H|$YL$aHHtH9uL$@MJD$I9@@MXMtvMXM~II9XIt9I9X  It)I9X(ItI9\HI9uHt$HXT$H$MMtI9HD$ff.fEAP@-_A@H5 AHcH1L Ez_QEDAQAEADAY^ZL gEuAg붾L L AeL }붾L ofrL ^ff.AWAAVAUAATUSHHDD$L$DL$|$8\$8؀f9^fD$8l$8HL$0HT$4DLD$8|f\$.Il$.LcD$4LMH^H\$8L)tEH=WLBWM#ArIpIHMAHD$DJMODL$AD$AMJ|LL$hIH]|$0LT$IÅhML)H^I<+L9}LLLT$I:ALL$HLM)K4.HjLHLAI)}.u |$Dd$Et2H$L}1LLFH5Q AUT$8HcLEIcNI~fnf:"fAFH HHLD$H,\߀NuD$0eIHZ|$0tpHDžu~EHoAAIu+L$I2W>MA$L$Is+>MeA$X-Hx+LX+HxvMcE]IcNZff.AWfH~AVH AUATUSfH~HHT$H1҉|$t$\LD$@y%ۺH H I܉I DfHnff.z]LMMLEAAI@MAI Dt$|M L|$(EAEAfH~f~f~D$xDt$| H|$xLD$|$|LD$ DL$x)A EH|$|AxEAEpEHl$(fA5EA*A)fIEDY- I E1AI?I L fHn\ɌYɌXɌXf/D, _D$8D)AE1 EDDl$DD$ -LD$HIWD$E~~A9މAN)t$ A))t$PLD$`LŅW-IHVEtDH 6IHxVE1|$~|$tILT$( AD$HA|9~)؋t$ Aƅ~Hb-HHV~LH-IHU|$8tLH2I |$DL$AAI D\$|$D\$XE~LD,IH VEh MD$XLL$hHLH\$0L5M\IHL\$DHHM9McGSD$ 0D$D)NHsJ KD998KmHL.HHw|$A…HcOC)L L[JtK DD9<gHcwU MLI<hu E I|$IL$AL$L9d$"TH1Ҿ )HH<1Ҿ LM9o)IH IIcLq^E fD/L$( D$8E1Dl$ HLl$D$!HH0JDD$ME1LHDD$Hl$&LD$0Dt$Hl$Hl$H}0H|$I9HL$IHIAY9LL$A32t$PL(HH|!IfH~f~f~D$xE1E1 E1D$\vID$XD$$D$8ALL$E;FH|$0H9ID$<LL$1D$(%LT$hD$<IRAB1HT$Dt$Dt$X8@D)AAD L;l$0 AE0T$HALEDC<HALEDC<HALEA<6HALEDC<pHALtEA<PHI9ALKEA<>'LCCLLÄ(EDC<HALEA<6CLIXDDC<CLIXDA<CLIXDA<>CLIXDDC<aCLIXeDA<6AIXI9@Hu L9NHI|HH)HHt$H|$HH $/ HHB@ H $LL$HT$ XB@sCH{0LIH IIIMPHC0IAL9Mt~ItgItUItCIt1ItIt MYL_I4H4HMLHMLHI4H4HMLHMLHL9sZI4H4MTLTM\L\ItHtMT LT M\(L\(It0Ht0MT8LT8H@L9rLLE1t 8AA8tFfGIt BCIL$@MD$MT$ IpL9!IL9It$H;It$JH;HH$HSHR0H$@I9L[ |$MJLLeL9UAHLءH(L[]A\A]A^A_ÀLm A@L}H@1 IHAE1LM9~L5ʼLDEC<=HI9tEE _fAvMsAL$L$LeLsI9~ |$tLMu I9IL)MHK<XHHAHLѠAHAMLG4H)I|LHHp?H4$H$HH?M9fA| u|$LCtL|$MtLLLD$H$H$LD$>I9LsfA M9fC=LuH1 IH?1L L9L-غHA<:u!HL9t4A yLHt?I9~Lk ?|$tLHu L9s=IH)I<6HtHH=HL=H@LLsNH-/HPH5 1E1H} O>H=ff.@HGff.1HDAWAVAUATUSHHHT$ HH$HjDIT$HL LLHL9S U8DI,$I/I.ImH$HEHIHH5" HKIHIVINHHDMfHCM~ L$ I$ICLCA mCL ɳM9L$L"HHRC( @CM\$LAS0MuLAV0IVLR0IGLP0HMH=DH[]A\A]A^A_ÃLCUHSHAPsH;հ^NZ[]ff.SHH HWH=H|$H4$H9uOOIL$MJI9ART$f.fz[D$^YH [HXHtbHyH~9H9YteHt-H9Y tYHt!H9Y(tMHtH9\t;HH9uHt$H|$c-L$QHHtH9uL$@MJD$I90@MXMtvMXM~II9X It9I9X It)I9X(ItI9\HI9uHt$H,T$H$MMtI9HD$HΰH5) H:\1AVSHHH;H|$(Ht$ fMHWHWHH9KOIL$8MJI9AZ\$0ff.zD$8f.uf.~%rdf(D-ffTfTfA.f(fA.fEfA.zfEfD/-ydf.z\$D$ L$D$Hbf.`f@E@2Lf.PfAAD@蒘HH[A^f.fD(fE: fD.E?fD( efDW=McD$f(\$fM~D|$8< d$f.%e\$f(z\$t$L$fInHrD |$EDf.eeE„4Kf.Re@DDŽKf.=cfWbf.HXHtcHyH~9H9YteHt-H9Y tYHt!H9Y(tMHtH9\t;HH9uHt$8H|$()LT$ THHtH9uLT$ @MJD$8I93MXMMXM~OI9X It?I9X It/I9X(ItAK9\IM9uDHt$0H|$ (G\$0-af.ztf(f() LcD$f(\$DT$fD\$fA/w f.VaztfEfA(ӕH9H8LE0HuHL$A@$JZE1A1FHL1H趦IHmtLD$MpO<MICLAIL 8MDIsLD$HH?{18+L+IIAIl(H9~Ll$(1Mt2MeM$Mt IYH#HD$(Im%Hx[]A\A]A^A_@Et^EA1I4IDHD8MPAxfDM<,E8t-L+INlLIAIDHH9>Ht+El,E8iuHtE4 E84H9uHHH?Ll$(M)MPH1Ht$ LAօ.LD$0LL$ MdH=H9ubIm0IuD$LV0D$HH9]gHHIHLLHL:HH?GD$Ht$ LӋD$X(AHLRHH?H=w,HL!H(LHCwH5 H;%LxHV1H5 I:AWAVAUIATUHSHHHD$H`HIL}M`H]HE Mt H9H)IMyHL LHHtdL)L`HuI+LLLH]H[]A\A]A^A_I9`M;guH}8uLeIHL[]A\A]A^A_MHtE1Y`ff.HH`HH"fATUSHH`HGHJaH8yHHvHH<H H0H-#H9|LG LgL ,LT$ fInHfH:"Ld$ HD$(HD$8LL$0LT$@HD$HHD$PHD$X)D$MHSJ,"H9hH8H{ 3`H9Ht$HL Is{AMtDDAHkH9k 8H|$Hk Ht0H_HHt HEHHD$H/H`L[]A\LLJ|&J|!HyHH)H)LHHxHHu_HSHCH{ H9 )_Ht$х _Ld$ MtsHCH pH9uAL$H}HHA(EDEEL$AEYE1L$Hu%[!L$f.L=nH5c E1I?UH|$xmfY#IfBTH*XL5=lH5 E1I>zY#IfCLH*X3 tff.AWAVIAUATUSHHD$0HD$(5xHHD$8HbIvHLl$@LHkL{D$tHD$hp\bHT$0HL$8HD$8HT$L|$(HL$@$bH5' LbHHHaHL%H+aI,$HD$0HmHD$(HT$Ht$E1LL{Ld$0Hl$(I$HEuH5z LJVaL*HHBaHLsH+LCD$HAP0D$L]H1AS0YMT$LAR0/LKD$HAQ0D$}LD$t`LdwLHĈ[]A\A]A^A_LBwHĈH=7 []A\A]A^A_Dff.HGHHHHHtYAULBATUSHLHhcH@HDDDDDDDH?)H9'MHLcI[]M)A\A]Kf}v@uLHHPH9HtIUmEfDELLBH2ItHLHwL-]H1E1HNI}H58 萷H<$23HH9[lHkPLL$lLL$HH$6lRlMlllAWAVAUATUHSHhHGHT$ HVIIILHILHIYH\$H9"oHJ<L $IIHoHt$H=_L$$HpHx L&[EXLD$E HIEI9 N Ld$LL $营HH!oH }_H$LpL\$HH Ht$~0 GTHEMfMnIA@H?A)Hu1E1D)ML~HtGHtAGAHAHA?DEGLIL ȉH?B|IGDIL AHA?FLIM9@C|AHL ljH%?BDGLII EIA?DFDC| HH AHA?AFL CD$HL H?B|$IM9uM}1E1L<$MMAt~ItHItCAHAHA?EUB|HH AHA?G|IFLIL AHA?GTIM9B|AHI EIA?DGLBDHH AHA?G|FT II DI?EC| BD$HL AHA?GT$IM9qeB\C9\SIM)M9 lJHT$0H߉L$(Ht$L\$xIHkL\$H5`\LT$L$(LXHT$0HpHD$xH<$E\HIAtLBHD\$t$H9fI\L$8H\$(HXLD$0>DL$8LT$(HD$L\$0DL$(H >[H8HGPjLD$L [LD$XHt$XI;qHuH [H;A(u)FBt1DL$LII DBtLI‰A)|$EHII I9-M_M11AItPIt#uHcHH)AHA?D DDHLL)AHA?D HDDHLL)AHA?D HI9DDHLL)AHDA?HD DDLL)AHDA?HDLDD LL)AHD A?HDLDD$LL)AHA?DL HI9a]HIAHKH9 $L$(AI\$1AAփHHHtuHtPHt+HGLADIM D!IF\ICDHH D!HB|IGDDHL !HBtIC\DHH !HBTIG\ADIM D!IFTIC|ADII D!IFLIGDHL HD!HHBTC\H ID!IHFTG\L ID!IHFLC| H HD!HHBD GDDL HD!HHBTC\H ID!IHFTG\L ID!IHFLC|H !HBtII!ImLmMIMHM~ BtINttLD$ I(IoHHHHH~ A\LRt#HhL[]A\A]A^A_1CDL\$MtA|LZL9tHMWHtB|IFI9nMHM\D$DJD=?w!AII LD$0ELL9D$0DdHIAHSH9$L$(MGTDD!IFTIHHX|H@@MMC|M[MeLAT$0fDL$AA?ADLHH I9DL$A?vLD$HAxsdLQHAzLT$dLL$HAy\cIRHw11t4AA?DHI9u݃LT$8L\$0L\$0LT$8cBdkcdRdff.APHHwAH H9 *Ht HYR1Zff.AWAVAUATUSHH H|$HT$HD$hHD$`HD$XHD$P}HD$HH@ H $ @H|$Lg0D$HH4$1HD$hH}H<$D$E1HLMIl$Ll$`1A<Lt$hLLLI|LK#}LH9$~tă-|A<_LD$hHt$`I9p|H|$PHuNH|$XH|HD$hHĨ[]A\A]A^A_Ht$H|$^xHT$LbH|@AVIHAUATULMSHD$@HLL$0Ll$8HHHHMM9vaHs$urHtHE(E*tu L9$LLD$(L$诐L$LD$(HHD$H}LLD$(LT$vHD$HLT$LD$(/H|$D,MLMM)LEIA?H?A< D$HH|$@H|$%H$HHD$XgIL$MVLt$HEHl$}AWAVAUATUSH(HG LgMG  bHoH@tHo0HtHHL9bI1胂HD$HBLH LM1HHHLIDD@A^~\EHHHItjIt2DDXA^@\HHHXDDhA^\HHHDDxA^\LFHzLHL9HD=DPA^\bIpAHWHHD=DXA^wl\3IpHWH5D=DpA^w>\IpHWH+DU=wxDpA^$  f\nHHI9&L)H|$AHD$H([]A\A]A^A_Ã@D}=f\uAAHH=AIA AAL?GAÃADVLAG,0DnL?GDVH?ANDU=낃DU=dDU=UF uJf\rHDU=DU=DLGHf\xAŃAHMG<+D~MA<@yqH(11[]A\A]A^A_~D=AAAAAAAA AA=kH=GAH F\U00AL?AG47DvL?EAAFLG<3D~HFDVL7GDFG,.Di D=7JD=6D="f\tH_D='f\\H=D=D=ff.AWAVAUAATUHSH( t$ QE  LeH@tLe0HmH]HH9&H41/}HD$HLp LH:E111E1L A H=4AIAE+5DXA~AFEutE1HHH9t[ATEtDPA~A=IM Ѓv@LHH?ED^EuAt|$ u Ap+HAeDXA~vbA뗅t$H@ H)ʉIA?B<@~Et-HL)H|$ HD$H([]A\A]A^A_AFEukL^L$t'EA)DIA?GDH4$E1L^L$߃AwPL$-LIL$1H4$E1AEuAtA|$ p9wIDIAuH(11[]A\A]A^A_zAIA AM Ѓv-MHIA?GDVf+-E1H%AA uf.AWAVAUATUSHH|$8Ht$HT$(HL$H|$hHD$HHD$@HHT$IL|$p1L11IH$E1DŽ$LD$PD$HD$ LD$8L;D$PE EE7IxA+FAH|$8D9$H$H$H)HD$LT$xAE,2HLD$8E1H$L;D$PoH|$u A*H|$Hl$HtEH\$L+D$hLHH|$@HnLHĸ[]A\A]A^A_AfE,rHH$E1DLmH$DAt$߃A@HwzID]H LD$8AwDj I܉IEHH!Ã|$A$(DLxD$At$|AT$Ѓ AA+,t(IxH < IxH < H|$t AA-u ILD$8D$E1ML+\$hH|$8L\$`H9|$PvAH-ȃ߃A<L$D$11ALD$ 1HAt$E$8L+D$hH ۿ LD$`H|$8H+|$hHt$HH|$XRH׿ AWLd$HATLl$XAULL$xAQL$ARH|$XL$L$葫H0AƅH|$HHtH|$@HtHD$pHlH~1]DqA +IxH 8Ll$`Lt$HL$ M.H9$uHD$ H$$vHt$x$HwHH|$@HH|$pHHD$HD$1HA+@H>HmDd$E$$t$Ah ALD 9'HtHK!H|$uw tzHtuHt$H H Ht$XHt$HPAWLL$HAQLT$XARL\$xASL$ATH|$XL$L$蔩H0LD$8L;D$P|Hl$Het$LLD$0mLD$0I+LLD$8ExUSHHLCMtbH{HtHGHtNH[]LJHHt`HIHHCH{HuH{Ht HC1HuH)LLM9uMLKHt2IL>N LM9u0HHtML$I M9uHsE0E1LIHkLH9H9ML Od KDHI|$ID$H/DH9KlMDII|$ MD$ H/@HH9~^K|MTII|$(MT$(H/t&HH9~7I I|M\IM\H/uHGH4$HP0H4$H9fIEHL[]A\A]A^A_fIHLCHxI|L9LHLSMLL9H)J K IL9fDI}H4$HHE H4$ImtgHHgIH4$HwLL$V0H4$LL$H9'HWLL$HH4$R0H4$LL$H9IUH4$LHD$R0Ll$H4$HH4$?IHHE L$$1I4MDIMDHL9|E1ff.@1 fAVH5WJAUIATUHLt$ LHh|$ LHIEHHt;HEH;/HRAH臽LHD]A\A]A^LAdfATUHSHLcgH_A8wD;c{H{CHGHt(CCJD(HEH[]A\HD$CCHD$HC HH=\TLcSH{H@HH@ I$L`HD$HT$HS HH}HH]H/t'sEE1JD(HE?HOQ0H]HLV2H5'7 I81AVIAUATUSH H2H|$HH;=0HX`AAD$f(fT f. f.H|$ &t$ 1 DXVf(f: f.zXrf(f: f.zXrf(f: f.zXrf(f: f.zXrf(f: f.zXrfD(fE: fD.zXrfD(fE: fD.ztkXrfD(fE: fD.ztOXrfD(fE: fD.zt3rX9f(f: f.@tt$ mHHL0M8Dt$ MZEM IEAEHIck[%WkLCLOIAM I8LOHCATUHSHHtHEH/ U~G1 9]~8HcHH|HtHDH/uHwV09]fLe HE MHNI9\$I<$Il$ I$LID$ NHtuH9]H}uYLe HEHHE NMtBI9\$u3I<$u,Il$ I$LID$ ZNHtIILu[1]A\HGP0fF1f/GAWAVAUATUHHSH8Ht$ -HkIHD$ LH$AMH./Ht$(LH\$(L93Au@-E1@+OA}0uA}@XuILL}DEHA6wEC<HA.HZH }Aǀ<xHD;A0A6vLcMLd$(I)M)HI9;@P\CH{+sHDA0A eDKHA0A v 1葊HH|$(H5}HGM~/MT$IM)M9A 06wDB<.MAI>L9I?L9MkIt$IM)IML9pA 06DHa|B*AIIWHfI9IMH5I92%uHOL|?YL9HH)DA0A63EG$fHA*XHyD;L=*,AH;$EtfWhcH;-'IH8L[]A\A]A^A_ÙIAHH)\IA-M4IM)BfjHaIIM)I1E1:IHSL)ALo6HLzHIAHA6L9HH)06AfH*XYH9I9HH)DD)A0A6PH5?zEfF.D!*XEt2AAAEtqf*XIAHD$HX[]A\A]A^A_1|$4Q1 D$48D;L$JHt$8LDL$$DT$|$H$D$}D$H$$8 DŽ$DŽ$Z$DŽ$p$~ff.LLFHNHVHF LLGHOHWHG fATUHQdmL`LMHt HHLZ]A\PH5 y]ZJDAWH4 IAVL5AUfInIATfH:"IUSH8~H>HD$ HD$()$\H1Hl$,MHD$(Hu1`IwHsA1Et HĠ[]A\ÿ^fHH8Ld$LH H3 HDŽ$fHnH3 H=3 fH:"L3 H-3 H3 H 3 fHn)D$0fHnH53 H`3 H$fInfHnL s3 L}3 Ls3 fHnfH:"fH:"fI:"fI:")L$@H\$0fI:")T$PH5 )\$`)d$p)$LrtHsHHu1Ld$ Hl$ LH\$ hHe~u1xff.ATUHSH H. 8t&=t[=$~H H[]A\3DD$HL$HT$H4$iDL$H$HLD$HL$H H[]A\DD$HL$HT$H4$DD$HL$HT$H4$xoff.@LTHHLE19fDH9tEuOI9tlL BHL@A<9@8tBE1LAuÀ.tQHt$IAI9tL@_M9tLL1f.AWAVAUATIUHSHHHH $AAA11HH}HH9~LxJ<HIH~LHHGH}M,$HtHE1HH[]A\A]A^A_E1|1ff.SHiHt|H5 Hq~H5 Hp}L= L{HH8A-|AJ|DH= }lH|x:u2A{H H9{ILHPH H 1Ҿ-1Ҿ1Z1Z@ATIUHSHH HW<$wHShHLH L[]A\fH HLL aH>fHnH5hfHnL,|fInfH:"fH:"fI:"t@u:H9;H5;t*Lq< LILt; u;~;H9;H5;tL< LILy; z;;H9 K<H5<<tH H; L:fHnHHfI:"H<<<DAUIATIUSHHxH<$uHxu1LHxL[]A\A]AUATIUH0HvLl$HL|$vHT$HLHD$W|$wvHt$HF,tLB|$Rv1LH0L]A\A]ff.AWH AVIAUATIUSH~ Ll$ HT$1fH:"L)L$|$ H$HOHLL!\$ HL$(Ht$0H1L\$ HL$(Ht$0L%QA|$uA|$ ?xL|$`HLL1\$`HL$hHt$pwID$=Gu5$G~wH=11ҾQ3uLL4\$`HL$hHt$p6xI$H+4wN4H.xHHLHD$\$`HL$hHt$pvH|$7HGvHHD$9Ht$L9\$`HL$hHt$puHt$L|$H|$@I7:\$@HL$HHt$PuL1AD$HHL$Ht$?Hl$Ld$\$ Hl$(Ld$0fol$ fDoD$0LA.EFH[]A\A]A^A_ff.AUIHATUHSHH(oUHMIEUxHKSHMHHSHxHމCo] [ }0DE4{0LDC4p<$vHHHLM<$vHHHL*<$vHHHL<$\vDMPHuhH{hDKPXYvHH=>vHuxH{x()vHH vDH(HLH(Dn<$uH0H0HLK<$uH8H8HL(<$}uH@H@HL<$ZuHHHHHL<$7uHPHPHL<$uHHHL<$tHM8HS8HLoooDDD<$tHM@HS@HL'<$|tHHHL<$YtHHHL<$6tXH`HLH`X<$tHhHhHL<$sHpHpHLl<$sHHHLI<$sHuXH{XH|H|s1LH(L[]A\A]fDSHHHS2HCHH?2HHǃ(2HHǃ2H{hHǃHH{xxHlH(ǃ1H0Hǃ(1H8Hǃ01H@Hǃ81HHHǃ@j1HPHǃHS1HHǃP<1H{8Hǃ(1HC8H{@1HC@H1HHǃ0H`Hǃ0HhHǃ`0HpHǃh0HHǃp0H{XHǃ[ ff.ATIUHSH1H H<$qHtHHHqH;*01LH+H L[]A\ff.@AUATIUSHH>HtqHH$HG/HD$IHkq1H9]~%HEH<H=qIDHH$L!fo$1A$H[]A\A]L1ff.HH1sAWAVAUIATUSHhH|$H$T$L1H|$@O$\A}I}XVE1 A}PL?H$0DH|$IL$PDŽ$X9H$HLHIPA]PEuE}AU t$AtD$AtD$ t$ $D$ H$D$ Ht$H|$$$L$L$$gMuxL$H$@LLHT$8$3~$XD$\~$PAu fA~EfAEEtAEADžA}PHD$pHD$xIHDŽ$HDŽ$HDŽ$HDŽ${HA}PH|$L6$HD$pL$HD$0H$$|L$A}L\$(. L$L%g5LL$ M|H=R5A} HDŽ$HDŽ$ L$LLHH$t$OLD$xHL$pLLHM$yEEyL$LLHH$$ILHHHL$P$_yH|$P>H|$1fDo$EH|$0L$PHT$X H|$(H|$ LT$XL$P$L$fo$L$$fo$)$)$L%3M|H=3hEEEH5| LDD$ DL$ HToA} H5 DHwH5 LwHwwA}$&=y1A}H5 H wH5 L2HeqI}Hu[H5 LHpH  IUHLHL $L$L$$pIHH HIHI(HvH t L_ LHS$L$L$$$L$fDo$L$$fDo$D)$D)$kI(I[Axt7T$LH|$LR$L$L$$pkA} AE X (A}$yAE$A}yAEIEI}8I}@IIIUhHe I5A6xA}PuAEPH|$@1E1H|$L$LT$ H|$8$H\$ L$Dd$HL$H$D$fDo$fDo$D DQHD$Hh[]A\A]A^A_I}hC{IuhI}XvIuhLtvL%I|$ Ha I}hvIMpH9?vIH.sH|$H IL$L$L$$kiH 6HkIuH 6H]kA}H5r HpIu!ILH$'rILtAluK11QIHjH5Z HLt#H5s LLtLGjH  ILHv$jjIU@H ߿ LHL$$tLMu8Al/kLLH$`mIH5ƽ LD$psHH]Ld$hH,H5D$ LD$0IupI}hLD$h(cmxkLj AKc LH|$H  LIL $L$L$$] gL=IH7bmA}H5 HmH5u LHmH5j DXHuH5ܾ LHtAE EM0IhuH=*8IhH|$ qI`L%uIh_H-L%H|$LLd$($L$H$$eqHt$(IMhHDŽ$HDŽ$H9qMMpH)LH$MHL$|hI`IhH=* t&;HHjL$I<$"I$I}hAfDo$EMhAE HT$`H LLHD$`L $L$H$$;fH|$`HwleDIDD$PH u |$PIH ^ |$PIH G |$PIH} 0 DL$PHt$0Hu D$pDDL$0 |$pDT$0eHt$(DHY DŽ$DT$( $D\$(dHt$ DH3 DŽ$ $dA}H5 fHcA}H5 MHcIuFH  ILHL $L$L$$cIuFH ILHL_ :$L$L$$bA}y,A}H5 HHaAEIEH|$1EE/H=O .I`8H=&9L$LTH&dMD$H5&HIr LHHAuNLNT I`H  LLHy $mmDDH  LLH$M9ehIUpH5B Ld$(JH)JLd$(}IpoHVIpHaI`:Ih,L%/AAEADžD$ yH c%HT$pHHt$0$fo$fo$L$H$$)$)$oLHH531M LILOH=ILH=HLế H=HL:1H5%@IL:1H  H5h#ILẪE1H=HH|$11ҹL$L$LL$(LT$ H $H5 HHL$(-HHL$( cbADžfdHD$ (LD$ MIJ<aIHhH$L=]HhH$(L6LL6LL$L$NLT$(L߾:L\$0`5H|$0HD$ ?/ohH$0Lm6H|$H|$0NhL$0Ht$(A<3/6hH|$ YVHL#6LL6H$8L6L$H$u,$iH$*H$HjH$u,$WiH$H$HRiE111H|$ H$HL$d H$W H$J H$= H$0 H$# H$( H$  H$0 H$8 H4$1贶LD$HT$ 3DEH$HH|$2L$@H$LT$ :H`3IHu H%L|LH)H~H4$ HcHH,$HHH$H(H|$ Ht$$@H<$ }cA?t IooǃH(uH$HH8u H$HuuHHu H$HuI1E1E11fHnLfI:") $fo$AmLEuAUH[]A\A]A^A_HH4ybH8wbH(GpbH4$1޴7LL^$@H$HH$PD$X2Wadd"fff.USH1H8HHZH; HH{ HCH{q HCH{` HCH{ O HC H{(> HC(H1H8[]DS1HHHtmHHH;[ff.@AWAVAUATI1UHSHHXLt$ L芲tXH}E1A HH$L;<$TL IIK-(dZ[]ff.fATIUHSHH@Ft H(Kt1H=5@Ɖ7DAt L 1EDAt LjEt Ht H 1t LEA8DAt LE DAt H7Dt1H=DAtE1LEAE DAt1H5ZE‰t1L ~@A9DAtE1HEAD{H5.tEbbL[1LXS pHk`H[XHl$Hl$HH$nHH=1Hc&b1LH@L[]A\1H{_@AWAVAUAATUSHH<$T$ Hlct`=Ib*D|$ H,$MIAAEu@DLHLD$%LD$HIbI)HM1Hĸ[]A\A]A^A_LD$KDLHHZ%HHD$ HD$LD$뤐AUATIUSH8H~HF0kd1LH8L[]A\A]fDS?dH1HX$d[AU11H5s ATUSHXH$H8Hu_dxIHDdH@ HX@@JID$PIHAdI$I$H yH{I$fHnfHnHfHnflHfl)$M$M$pHL$(fInHL$@flADŽ$tHT$T$)\$0I$I$IDŽ$A$迿L M$p;MAIMHIǃPAǃXM`IǃhAǃpMxICACMKICACMKICACMKICACMKICACMKICM9aHMI;M(uDHyHH@H0LHuI;u(u LnI`LZHB1LLZ[]A\A]ff.HHff.@P'ZÐU1SHHPR a1HCaH- H{ HaH{xH`HCCX[]ff.@ATUHSZZbE1U1]b ]D ][]A\ff.AWH HHIAVHfHnfHnAUfHnfH:"AATUH-9 SHfH:"fH:"HLnH|$0H=&fHnHt$M fH:")L$)T$ )\$@)d$P1ۃADIIE.HaAIcAHpDHD@I$uD IAuAL%EpM;l$(u(&88 87!:IHejH@H5oH IF1AF M HjDP A iA@iLX0AH@IM;l$(u;foopE1HD$`HT$p)D$`HHHI H9uL=H==1HiA&1IH&I8Hi1hI@HriMd$(M9H=s^HiH=~IHriH=Y4H]i=P u;L5 d?IF0Hh@ hI8I>Hu H= aH=ļ [hH=4hH=L hH=gH=̹gH=gH=TqgH=ؽ{JgH=Ծg#gH=SfH=|?fH=h+fH=|fH=ȸ`fH=9fH=fH=eH=eH=,eH=0veH=wOeH=Hc(eH= OeH=;dH='dH=ȺdH=tedH=з>dH=ԷdH=cH=ԸcH= cH={cH=sTcH=_-cH=صKcH=7bH=#bH=bH=`jbH=CbH=HbH=DaH=8aH=ĻaH=aH=oYaH=[2aH=lG aH=3`H=Թ`H=8 `H=<o`H=H`H=!`H=H_H=_H=(_H=_H=k^_H=ĹW7_H=C_H= /^H=@^H=,^H=гt^H=M^H=&^H=]H=@]L=LL]H=x]H=ٸd`]H=%P9]H=<]H=}(\H=\H=e\H=ɶv\H=O\H=i(\H=\H=[H=m[H=At[H=U`n[H=LJ[H=M/8ZH=)uH5/H=(=TL?H=ZH=0ZH=|2YZH=_-uH5~H=7-=H|$`LH|$8Al$`H\$hL|$pH=uH5H=5=YM9 H=8oYH=!$[YH=GYH=ɶ3YH=eYH= YH=UXH=YXH=XHHXH=mXPQHH5ݓ HHg?vXH=I IHWHԲL`HH5zH-cH; QM~1HI$H;PMf1HLIGI8PI^1HL ID$I9PM~H1LHCI:PIvE1IG J<CWIIuM I ukI HpI uH=x 5I HWHngIDž I 2?I HHT$LrLt$ HVIXH=~PHD$HUVH8UHHQVHIXH5HIh=(VH H9UIHUHH5H4ULH5H5=ULu;H5HUIHHHH5<L>;UH5x HTIHTHHH5<LA:ETH5=[ HTIHTHHH5}x<L:TH5 HWTIHjTHHH5Q9<LA~:EDTpTHX3IH+THHH5;r ;L@:T ^|IHSHHH5;LA:ESH  H51HH=}IHSHHH5o;L9|SH=m 2IHdSHHH5|3;LAx9E>S{IH(SHHH5K:L=9SH=2IHRHHH5:LA9ERH=1IHRHHH5}:L8RH,IHoRHHH5>:LA8EIRUSIH8RHHH5 :LM8RPTIHRHHH5 9LA8EQH=>L=uH5ֆL^6 LIH @yHIF5/IF y1IF(yCBIF0yH=IF8n0Hc=IF@yHc=IFHy1IFPyH|$IFXHXbQHLH5Ȅ 8L#7PAyIHPHHH5$8LA6EP1IHPL=10/IHk HLHqPL6MI<HuL SAƅPLZ>LI_6M HLH57L:6P/8IHO1L=uI<.HPIDHH/uH=1LH58 gLI5MOHLH5a7LA5ElOH=.IHTOHHH5#7Li50OH=! E.IHOHHH56LA,5ENH=3HuH5ƃH~3 HIH w ID$vID$ vH=-ID$(-1ID$0vLL$ID$8IyXNHLH5 &6LAk4E1N IH NH=5-HH,NHH5{ L5H߉D$@4DT$@ENH=,HHMH5HL5H߉D$@3t$@MLH5k Li5M uIHMLHH5d95L3jMH=[,IHRMLHH54LC3.MLPLI(3MHLH54LA3ELH=iHJuH5|HT1dL\$HM{IHBHLPcLHLH5P:4L2GLH=T\+IH/LHHH53LAC2E LSIHKHHH5k| 3L 2KH=uH5tH=X0i1 IHQHHH5k3LA1EvKRIHeKHHH5m43Lz1AK1IH.KHHH52LC1 KHD$HXXHJHT$ H|$H5 HXTHL$H=`Ly aH=k xJH=W dJH=ӘEIHGJHIHçH5i/ HH12JHH5cH2JHtH5= H1IHNH50H1IHH5H1IHH5H1IHH5H}1jIH^H5\& H_1LIHH5n9 HA1.IHҢH5H#1IH H5H1HHH5|H0HHH5QH0HHrH5=H0HHH5H0zHHH5Ho0\HHpH5HQ0>HHH5H30 HHdH5Z H0HH.H5 H/GH`H5! H/GHH5b H/GHH5IH/GHH5% H/lGH(H58^ Ha/NGHRH5HC/0GH̢H5H%/GHΟH58H/FHH5$ H.FHrH5 H.FHH5 H.F1A\@H5R HHHD$ {.LD$ {FL,IXH5 L0P5FLEH$FHH|$8LIp_Tl$`EIpRIHHEL?,IpH5HEE(HIPEELl$MuEhE]EL%RL ]DL@IHDHIxEEL5<L$IHDHH5H=1~IHDHILHD$ \+LT$ MDH|$LL.LI3+H|$ )+M?DL؉WDLLDHL$L1MHu H5MLI*MCLE1E1*H|$*LD$0A(IXMxEpHD$0HĈ[]A\A]A^A_&DDFD\DDDD/DYDDD6E;EEELff.fQE1A1"GHKMZff.AWAVL5AUATIUI&SAHHKHIIAJ<K HAHN<@AuݸA,H[]A\A]A^A_HII&AO tDHcEMIIAK<OHO4EDHcAMIIAK<ILE1볅KLH3LKJL HKI݃IKAJ<KKKff.fHW1@uHHHtH[H9uHAAPZ@@ff.HGHO(H=T7(H=fqÿH9nSff.HGHW(H=HD7(H=HrùH9xSHcHkG@HHHHH?)H3 QHOH;NuaHSG DF D1€SHA SA@t/H0 S@tH0@@Z1ZHHHH@AUIATIUHH=;LLH]A\A]ӾHAWHHAV !AUATIUSHHEHHTHeI$HHI|$!I$PF1LTSI$IAOI$I$I$8-H;-u M}H8I$8H=I$$Hs+ML$`IMt O,I}uTH8H;H{tLcCIIIwIO,I}tHs0H3NRIUH;HLIH&RHs0HH8SL$JfDML$hIM$*ML$pIM ML$PII$HI$M$HtH; M$M$MI>LLhIHPQHpHLHQLI(#EHLBHH2LuAI$HLC@E1HAEHD#EPH H;DkEA ArEPHLdHmHձI$Hu1u0I$H I$HH/PM$M+I$@I|$ I|$(u IO(IL$(I$uII$I$ uI I$ LɓLI0/ H5_L/H5Lx/yH59La/(H5LJ/H5L3/^H5L/H5L/A@c M$XAIiL9<K\HsMD$`LMt L[`MwMD$PMt HSPH MD$hMt HKhHMD$pMt HCpHM$MtHHUI|$0I|$@u#I$uLC@HMD$@I$I|$Hu#I$uHsHHIt$HI$I|$XuLSXMtM M;VXI|$8u HK8H*I$uLM I$uLMtMM$I$uhI|$xu`I$H5L $H|$3.L $ H|$H5.ML $uHHsxI$It$xI$uHH I$uLMTI$Hx HN I$HI$uLMI$ I$(uH(HtMI$(I$0|I$HuLHM0I$uHH II1A@#@tI$@ `u`H I$IMT$XMt?I|$PI|$`I|$hI|$pI$M$ADIDuI$@H;mKHKI|$xM$PE1M}M9~(K|HOtLD II$1πI$H[]A\A]A^A_I$@H@HMt I;@I$@M;I;((IvpHIEI8u H8HIxu HPHJIxLXMHtHFpL;XMXM^hMMEI8u H9HIxu HAHW Ixu HQHIxu HqHIx(u HQ(HIx8u Hy8HIx@u HA@H IxHHIHHM]IIHHIF`HIEI8u IHIxu IKH|Ixu IsHK Ixu IKH, Ix u I{ H Ix(u IS(H Ix0u I{0H Ix8u Is8H Ix@u IK@H< IxHu IsHHIxPu ISPH IxXu I{XH Ix`u IS`H Ixhu IKhH3 Ixpu IspH Ixxu IKxHRIuIH IuIH IuIH) IuIH1 IuIH9 IuIHHIuIHHIuIHHIuIHHIuIH IuIH IuIHcIuIHIuIHIuIHFIuIHFIuIHIuIHEI^MMNFIHIEI8u H:HIxHJHsHlEIHaH0HtMt I;0bI$0UINPHIEI8u H:H Ixu LZM IxHBHHtHQPH;BI@%EH-yI$H%DI$H|H4DH%ID$xL MIEHLHHDHpHL H;FHH(Mt M;M$bH-DI$I$H11HCI$PM$X1MyI9ITLBAt EHMOPML$PMM$6 I$tM_hM\$hMwpMt$pMW`MT$`I|$HHH7CI$HHCHMt I;4I$'L-ML#B11H=ܢLd'IHBI$HLLA EBHI9A$BI$HsIt$HI8Mt IshH;>TI8LI$@ 1IDŽ$8L5+L9@ H?THudIPMtIshH;~8JIx8AMtIChH;pIpI$@LVpI;:>0HNpH;Q?A@BI$3I$$Ao@I$A$Mt I;I$Mt M;_M$RI$MoIPMtMShI;R(IP(H,IHxHtHx`H;OqIHhMI@HI1Mt I9?I$HI$HHI;$zqfHI$HKHuVI(HIpHLHpIHHC0HSMt I;F0DID$0:Hp`H;LP`I;JxfLP`I;-I$ &IW IT$ %A0HIx 7HIP(9HIp8OHIx0)HIPPgH;IxXiHIpHyILI$dHtHP`H;rpZIppQHIHIH@HICHIP`I$HI8 HtHx`H;OhIHhHoI0HIHs0H4H<$s=Hp`H;DLI;:gI{hH;W~I$#11LH!IH =H LHrHH;QIHLQPM;ZHp`H;~ KHP`H;r8tHH`H;Q(9LP`I;z0:MShI;B_LP`I;rHPHH`H;QPQLP`I;CHP`H;rHp`H;~X)Hx`H;O@HH`H;{LP`I;JM}LP`I;R`Hx`H;qHH`H;2>9999DATIUHH=PZZLH]A\ff.AWAVAUATUHSHH(LXMvLuL;5)HIMr;L?LI MV;IT$HU;L;5ށLXMM9;LXLHHPHHNHMC;H([]A\A]A^A_L=aHT$HL!IH;|$HH&LI HH$E1VH $HD$)LH $VH|$H32:H $IL9 OtIFug:L{ IEL+(ff.@AWAVAUATUSHQH:LPE1ImI9|XHImHXLyI IHu:H1HXL9}OLXItHHItOTMXM:IM99H LZL[]A\A]A^A_1H9~"I|HIL9tK;|9IHL}I99N$L IH91H9}MLMXMHOl&.IH9HHHN,LH HHd9L1HE11I9IHctH;s}zLlE1KBDHJHH9~ L;ltXHIM9LL1g81LcLMMM;H}O;lu ADTHI9iIHaf.ATIUHH=SHI#HH[]A\_ff.@AWAVAUATIUHSHL-}L9ou9M|$1M~ItH9HI9uH[]A\A]A^A_H\$ L=HLoIH9LHLUIH9L1L)M9qi9ff.ATIUHHAPMH:YLHH]A\"ffHnHfH:"HHH=})$Ht fo $H(HATUHSH1oIHt-HtHI\$HID$Hy:ID$ L[]A\fUIHSHQFH%u H=~LHtHh(HX0Z[]~MHwt҃:H-=t:H{=tH=tv:Hj}tHuU:SHHHH={HtHX([ff.@SHHHH=wwHtHX([ff.@ATI&HtHyHLELA\ff.ATIUSHt6.HHtHhH6HLHHt E1L[]A\IA<$(tf.tSUH-SHQf.< t,CHt&<)uHHH0Ht H>9ff.ATUHH=wSHIHt&fH@ Hh@(HuI\$L\#L[]A\Hff.SHH=y1HtHHX[ff.@UHgHHtH}HtH} H9H]&DAUE11ATAH5h SHHHJHHT$DHE14'H{L$DHL$H5IHL[A\A]H@Ht Hxw8HfHnH9uLFHPHOIL IHHPLNH1AI LNfD1 ff.AWAVAUATUL7M|9HT$H5tL#`9H|$a1H[]A\A]A^A_AUIATIHUH)HD$Hb9H|$Hl$LLHNHAHD]A\A]fDAVHgH AUfHnfHnIATfHnIH UfH:"fH:"SH]fH:"H)L$)$)D$ iu"H=]h9H5oH>H$Vu#H=rU9H-vpLEIXTu"H=SZ9L :pMIRu"H=Q/9LnM3IPu"H=P[9HnHHNu"H=EN08H tHH,Mu"H=zL8H5nH>HaKu#H=J8H-tLEIIu"H=HW8L mMIGu"H=G,8LDoM3IEu"H=MEX8HmHH4Du"H=C-7H 6nHHiBu"H=A7H5qH>H@u#H=?7H-lLEI>u"H= >T7L sMI=u"H=U<)7LyrM3I<;u"H=:U6HvpHHq9u"H=8*6H qHH7u"H=66H5oH>H5u#H=)5}6H-lLEI4u"H=]3Q6L nMID2u"H=1}&6LoM3Iy0u"H=/R5HnHH.u"H=-'5H mHH,u"H=1,5H5kH>H+u#H=f*z5H-zlLEIL)u"H=(N5L &qMI'u"H=&z#5L lM3I%u"H=%O4HjHH#u"H=9#$4H jHH "u"H=n!4H5lH>HU u#H=w4H-lLEIu"H=K4L ;oMIu"H= w 4LlM3Iu"H=AL3H5jHH(u"H=v!3H BkHH]u"H=3H5lH>Hu#H=t3H-kLEIu"H=H3L nMIu"H=It3LhM3I0u"H=~I2HiHHeu"H= 2H kHH u"H= 2H54iH>H u#H= q2H-nLEI u"H=QE2L jMI8u"H=q2LmM3Imu"H=F1HhHHu"H=1H mHHu"H=%1H5ykH>H u#H=Zn1H-hLEI@u"H=B1L "nMIuu"H=n1L_iM3Iu"H=C0H$fHHu"H=-0H kHHu"H=b0H5eH>HIu#H=k0H-kLEI}u"H=?0L lMIu"H=k0LlM3Iu"H=5@/HlHHu"H=j/H lHHQu"H=/H5kH>Hu#H=h/H-jLEIu"H=ATH=7BAIHCID$'4ID$ 'ID$(BHID$0&HID$8&ID$@&5ID$H&ID$PBID$X&ID$`&ID$h?1H>-LA\ATUSHH聯H8-HHI@HH#-[H]A\.Aff.ATH=G@IHtJ&ID$%ID$ %ID$(%ID$00HC-LA\f.H7QHW-HGF-11lCHHJ-;1ZATUH1Q0IHtGfo  fH@ H@@@ID$(IDŽ$AL$0HtHLauLZ]A\LE1ff.fIHIH!HHLH8uHHHLW I9wLHH8tL9uIH!HH3HHtHHc=X!IH2HHtL1Z[]A\A]1H@ff.fATUH-HH=uH5N$Hs2H:HHH=.H}2HEH=HM2HE Ld$LqP2LHc$H1HE(HH]A\1@ATIUHARH.TH8Hr&u,H%H1H.LH1ɉX]A\nH&&E1LAY]A\UH1H5& H觺2H5) H萺AE1]ff.fAUATUSH(<72HIAՉ,H91HL$HT$EAHt$LB1H|$Ht$xH|$IH(L[]A\A]@ 2Q{AUIATIHUH2LHLHH HA5D]A\A]ff.AWAVAUATUSAPH3HIHIH5OH2HIH2HLRHLHL8G{2LHL[2H RIT$8Hq(I9w02Hu1I|$ H 2HHH,2ID$ HtgH=ȝtGLL1\IHtHH=LHRLZ[]A\A]A^A_袺HsHu111QIH5NHL1IAZff.ATUSH 2HzHH1HoIH`t4H`HsH9wH5Q'9y1I$L[]A\ 1iH`Hu1HHO1H;w1H1H4H>HHuHÉD$ D$ AUATUSAPH1HGH 1HOHH(HlH9u`H_ HC HHHH9|FoHHk11IHX1H}H}HxtH.ZL[]A\A]θIH%1HHrkt0^[]A\A]靸LG AII@HHIHL90H<IH0H=L*H=EH5wHH.*LIH5wHI )L FDH5wHI)LIH5wHI)L4GH5mwHI)HDH5YwHHx)HIH5HwHHhW)H9EH57wHHG6)H BH5&wHH&)H5GHHH5w(L-AH5wHIU(H=GH5vHH(LHH5vHI(L HH5vHIo(L!HH5vHI_N(L8HH5vHI>-(HHH5vHH (H.GH5vHH'HEH5vHH'H AH5vHH'H5{FHHH5sv'LH(L[]A\A]fATUQWH'HHHADZ]A\AWAVAUATIUSQHDL8Hi'HxH'DhDAHHcHH'HAH9Pv'E('LLIHtFLLHH:LIM%'HLZ[]A\A]A^A_&ATSQHt(HFHL H puII4$HuE1LZ[A\@ATH@H|$HH|$ 1H$HD$HD$(D$tHD$8IHt#H/H|$8I"H|$(H 'H@LA\f.UHH'HWHH+'HO H'H)1H5_tH=[to&HHpHtH]&1uSH~8H_HH/H5C7+HHI[HFH/HV H)H9x/HH~ff.H@t ?HOx-HH9rIL#GuHHH9vH9tHʸfATIHtH~8L*0LA\ff.UHHGHV"22 Hy ~ y4H9t HH]H1H]Ht$&2Ht$1;Vff.AVAUIATIUSmHHtKHL5$&LHHxuLHH1HHH[H]A\A]A^ff.AVAUIATUQHGLXM1H=HLI9Vk1'IHu=I}Xu_HNIH1HHLi1ZL]A\A]A^HI}Xz1I|$H5= u+1[1fHi@H8HJHtHA(HrHpAUIHATUHH:IH1HLHkIH1L]A\A]fDAUATUHSHHHH?HHDL8IL`fHnfH:"Ht;fHE1E11LLMpHl$ HD$8)$)L$T$(dHH[]A\A]fSHHH5} IH0HxH;=<u MIL[H5<tfG HWG ;B@1 fPZHZVHUU*WH@HHHHHHH?)HHHV1Y{ff.AUIATIUHSHPAYIL[LHH]A\A]Dff.AWAVAUATUSHhHWL>H@HI9GeWHvH~Ht$-WLBH{IHLLD$|IHHD$E1E1LN0L9MM~D$fI:")D$HI}L5D=ILLHH.WD$ L9HT$8H5/HVH|$8HVfoL$Ht$@H)L$@H|$8I|MVL#VVL <IwE11LI8E1豆IHtkM9LT$Ht$@HHߺLl$HLT$@Lt$PGIHtLXAtH<I9GLLD$L|$LHUILHLHM9iLIHhL[]A\A]A^A_N\IKMTE1IIMLqIIWI9XUHJSHGRHt$ Mu4H|$ LHt$H|$ HIbSHt$E1M97SHt$(IqHH|$ LHLL$HT$LL$ pTHL$(LHT$ HL$fLL$ HD$Le,LH5mL^$SL)@UIIE1SQH^I9|ZL[]KDLHhHptILH[SIff.H99IIHHLH8~ff.;ff.AWAVAUATIH5OmUHLSHH 8L 5HT$HT$xPHD$pP1L$&ZYWHT$pL|$hLt$xHZHT$H^H'61H HD$HJWL IHH5PLoHUIH H AH1H{(D$HE10HHUHD$0HHLL$L:fHnHUPH H4HHfHnHDžFfH:"HL@LLHupfInfH:"E`fHnfI:"LILPHHLU0L0H@ILL$HDžpLP)L$ 8HEHH} 蚑H;$VL%NHL|TL5NHLHHpXUHHLH`  HH5NcH H L5NHL6Hh H H5MH SH5MH SLXLs L]MH{(EtHIMDIL |$t LIHufInL fH:"m HF HHHMLbLH{@uHSH{HuHSL5LHLHI HRHؗUH=XMH5QMtH=H8HuH t%HmTL3L@HhH IH.RL$H$HDŽ$L=E8H$LxDHHL4M8I{XE1LLHLBuLSfot$ )$@E1LH5/HDIH9HH5`KILIMUQHL$11L&LHۼH0QHIǼH|$轼HĨL[]A\A]A^A_E1H ~DL9~"H|$J|LGABQIHt$HJIHQH9Ld$LHHQI$LME1MH|$0LdL@A]H IHCPH-LpLxHPHLLHD$'H$HHD$011{ H|$0HD$|Ht$HPHfLPA>HHD$ L\$ MOH HMcHD$H:E1H{(AD|$8ML$HD$0HpOD$E1Ld$0L^PLLd$0H|$0I諺MH|$ 蘺LL$MD$IQLD$0HHHt$00HHNIBIS E1H\$@Ll$HILMHD$8HHMtH9\$87H\$@Ll$HLHeNHPHH`*I$XH|HEHEHH(LuL]HPH;m0NHH贅HL-ML 2L9HHIHMHHL1ML1gHHH5tGHHcOHLEMH|$HEt$HL$H1|$8LT$M\L9tMHLEuE1I ADžd1I@HNEHH9ut$L%[LHS(HT$PHLHD$0E1D$Hl$@HL$ Ht$0HlH}eLH,NH5FH:QH5iFH9HD$0LL$0M9uLc\$McLHl$@ML)辀HD$0H LHD$@H\$XH\$ HD$@H\E|$ubHL>HHHT$0Ht$PLHJHHJLHD$PHD$@H|$@I9H\$XH5aHbYtD$8H5xEH8^뫃|$8?M|$4MDD$8DD$E!t$H|$H7ME.MAH8H5H9HT$LHIv|$8LHt$Hƿ12HD$ }JLIJDJ?J:JK0J+JK!JUJ@LK@AWE1AVE1AUATIU1SHHWH9}UI\HCYZLMt~HHT$MHT$Iu!HMIMHL[]A\A]A^A_HLHT$tMLLL}YHT$HHT$qHT$hYff.fATIHHtFIL$(IT$ Hp Hu{Hx(u!M$MuEM$ MuH9LDLA\H(H uMQI9uA$IEHuIxH9uA$IEH9uH;H(LDff.fUHHDHnYHH]O,ff.@HGIILPLL!I$L9uLHsZIH4It0L!ff.@AUATUHSHQHHuMHEZD[]A\A]H e,E1H9HuHIH+ZHHHZL@H01DH*H@ATUQHz]IHf HH]HH%H `LH01LH蔲Z]A\ff.H)H@ATIHUQHuYHtHFtHWHH4]11CHH]L1HKDHADZ]A\HNtH~u]ff.@1)fAWAVAUATUSHH~H8LVMHIMH]H/HIL=(L9~]E1E1E1HtHEMAMM%H{HkHO]H{LkHf]H{ Ls HK]H{(Lc(H0]H{0HC0H]C8M9t MH\L=HT$HL~0HT$H f"H9Kz\H{(HS(HC81H8[]A\A]A^A_LoMt ILwMt I\LgL=r'L9\M9M9E1I$IEv1xLbPE1L1LHD$Pjj觯H HH&[E1E1nIaE1vfDQHGHWLNL@HtHJHDH="H H5 Z 1H?}ZfH11AVAUIATIUHSHH]IH]HkHj]ML;-%&]MLc MuL%&{8F]L%L96]E1HL1LLLH蛮H>]H}H5G tHC0H\H}0HE0H][H]A\A]A^LkMX\L;%k%_]H ]HGHff.HIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H+$H$HL$ 1H8HT$LHL$H$D$0IHfUHHHtIH}Hu6H} Hu4H}(Ht)H}0HtHEH]H@ff.QHVHT]HF HtHLG0HG0Mu H#HZL責AUATIUHHH*]L-M1LD$LLMt/Ht$H}HHuH ]HH]A\A]\ff.fATIUHH=ЃQjwH]HLH]H=?wHH]LH]H=YwHH{]LHmh]H=vHHP]LHB=]H=vHH%]LHZ]A\ff.@AUIHHATIU*8Ht%LHHLdHA D]A\A]HY"H8A\tE1ff.@HG HHG(HUHpHuPHEpHtHHtH]@AUATUSQH_pH\H- H9Ct HZ[]A\A]HIH{\E1L9c~ JT JtLeX\IH}pLmp H]p@AUATIUHHH*\L-J1LD$LLJt/Ht$H}HHuH \HoH]A\A][ff.fSHHu!HSHsH;u*H H[HֹH=WLu1[@ATIUHSLNHHwLQaHS(HBHt[LHHR ]A\HKHSLAHtHrHDH=' H ݇H5V 1H?ov[]A\QH`HF`LG HHw M`Lh1Z@QH`HF`LG(HHw(M`L(1Z@SZH`HHHtH[HGtHhHtHHHu[ff.fQH fK#t HHZ1Zff.fAT1I1UHHHιHHD$LD$HtEHt$1HuuMuH]A\H(LJtLH9ЃATIUHHHlH9Ft>HT$H5qHmaH|$Hu)HLgH]A\H]A\9袦HL9ATSQwIHtHLHlILZ[A\ÐATHUQHH8Hd1HILH%HdHHI LZ]A\ÐQHdLWH5ILpL;YL;'„tdIAH8dZUH7HEH]H@SHHHCHH9t5HHHs0HH9uH0LC(HSMu'LS0Mu(fC(Hu[7HC[LK0MH0MB(ff.fAWAVAUIHATUHSHAPIHH{XHCHLXHHH3HcH-GtL{McAIHt[HxH5tYL[L]A\A]A^A_rLHtHKHHLHHLMIZL[]A\A]A^A_AWAVAUATUSQH=ftBIHHIL1 HHtH=ifHHIΣMuE1ZL[]A\A]A^A_HCI|$8HXumI|$ tLHIHtH豼HHbIt$ bLLHbHShvLbM|$M`AIHQHLHBukbfH=D@AVAAUATIUSH*H5pL HHHIH?bDHP,bH{8cHsHE11Ht HbHdIHaI|$H54aID$ I\$HS@HtHLuQHs0HtLغbHL[H]A\A]A^ÃaPaAHDaATUHHAPHEH@@Hb菚IHtHH.LHILZ]A\fDUHHHt HEQHEH]H@ATUHVHH5t)HMIHtHHu YLH]A\HA蟞D]A\A]fDAUIATUSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HH8HP`HG`QIHtHHL$ E1HHH$HL$HHT$L$D$0LHĝIHL[]A\A]AVIAUIATIHUHSD\ `AL[LHL]A\A]A^ff.fHH@AVI1AUI1ATIUH1AP@lHL%mLLHHąHtHZ1]A\A]A^ff.HB ƃ @t,GLR0@tZ5LWuILZL_GÉt%AAEDDOLRH@u eAE11dATUHHHt$\IHEtHP8HDHu HT$E1HLvH]A\Ht$1HH1HLH+fDATIIHUHARHFt HH8HHuHHLLAYH?]A\HLLHL1HX]A\{+ff.HWOHȉGrHWalwwwATfnUf:"HSHHHuhH9lH3 H9S(lH=fD$eIHt(H~L$u;Il$LHI\$fAL$ 7HL[]A\HlH9GtkHEfATUHHmLGMt'L11{HHmz1H]A\HW0H5iJHmH=1H? hfDff.AWAVAUATIUSHH(9oH)oAT$ C Mt$HkAAAAAt$D9I9 n@ML$0LL$ n@HS0HT$D9l$AAD$ @CnC @9nH5n7IH]nHT$H|$HLIALHL0IGIL0IG I$Mg(D9l$"H(L[]A\A]A^A_A<Hm詚IHmHT$H|$HLIANHLd$HHD$LL\$LIGHJTI_ H)I<IG(2HFmLd$HHD$LTLD$LLIGHII_ L)LSIG(H$mMD$HLD$6L[HL\$AH|$,L$Ht$HDHD$HlHklmIHlHT$H|$HLIAHLd$HHD$LtLL$LLIGHII_ L)MLLIG(HkHIGHHIG I$Mg(H(L[H]HA\1A]A^A_رH(IGHH(IG I$Mg(HHFH;n~ UnHu 1Hi2HcxAUATIUSWHF o~ nL-4 1L8u(IUHcHH4Hu1YHc[]A\A] IMH|ff.AUH7 IH5bATLUH8IHtLHHuLIzML]A\A]ff.H=9Y餪@WHHcnYeDAUATUHSQH_ MIUH=YIHHnHH5EL蛖nH=YIHwnHHlnL谔H=IYHCHCnH5Y1HHCHH"nHnnH=-H,uH5XH趒xsHk H5rLHٕxQHHmHC]qH5DHHoZ[]A\A]{mvmf.H11AWAVAUE1ATUHSHH(LvH<$HD$HD$HD$ HPIAuH= L1IHL3MSm.LfHtLpSLI$I$PHlH3H<$I$`HIt$HtHL$M$pH>LsH50P1lIAuHl跭HH+HH8llM$M$I$PfInM$I$fI:"I$@M\$PL5AD$`f8%KHkIT$pI$HI$AL$ HQkDXAv1Hu8jHILILfH1HHcEuI|$0H|$LkBkI$ I$HtII|$H.IHkI$HH5  LAEH|$I$H|$H-PI$H`suZH.HvdHjH)HHoIHijI$HHpLAuE&H(L[]A\A]A^A_HHaLxL=MH;jHuHLI${MfE1M<$MH5@LIhH5@LhH5@LhI(I|$LG HO(MILML$IA LI$LMAH1蕪HH*iM\$L\$YLD$H5?M$hI$$HH4kLL$H5?M$ hIT$HT$Ht$It$8KMD$LD$L-Ml$0HE"{HHKhH=HxI$hIDŽ$Iv&h!hhhATIHUQ!HhLHHHADZ]A\ATIUHHAP}ghLʹYLHH]A\[ff.Hʚ;HHHt*fH*D$L$^ L$D$fH*T$ATUHQAąuHUDZ]A\ff.fHBATIUHSHH3hHHu~ HU[L]A\1f.UHHHt$H2HH9Fu8HVHt.HH]MHt HHH]HH$?"H $HHL$H4$qH4$HL$HHgAWIAVAUATIUSHHgHG Lt$HILPHHgHu MI$HL[]A\A]A^A_H|$tH{(HS H{ HLAH 6uHkHHLALCLucH{ LWLO(IDML-HkIML9otIzfAB聋Ld$LL5LwAI~fLE1 HrHJfHk LLLHUHHWHH+Fu"HHHHHxL+LtHcHx1HcfDH=@UHSQeH,fHH5;HH'fHSH5;H eHSH5;HZ[]f.HH8HBHeH ff.H=~d@ATH5IUQH-HEH~eHEHH5HL_xeH-@H5LHEH9reH-H5LHEHA1E6eZ]A\ATIH HFHPz=ez IeH <$Te1LH LA\AWHHH AVfHnIfHnAUH :fHnfH:"ATfH:"USH:fH:"HH=EH^)L$ Ho(()T$@)D$0Hl$lH|$`HHH|$.%t$`t$ilH.lLEHlH5w:1IxHHk(H=:,IHjLMAh kH=}:RTIHHH5LLİML1LXLA談EfD$`D$xd$hH;\$1H=DV3HH~RIHtVLH]H=1EtZH=8lSIHhH=H$HH$YLIφMhL辆H|$1L}IpXdI/HeI7KHI,KMeC|/tHI|Hm1IHeLLIH5GLYHLYL]A\A]leff.AVHwHAUfHnfHnH ? ATfH:"fH:"IUA(HSH0@)L$H\$ )$H}H)e1LH0@L[]A\A]A^ÐAWAVAUI1ATIԺUSHHoeL|$HHLAXTHH0HReHD[]A\A]A^A_ff.ATIUSHH0@HHl$ HH<$eH;j0HHHe1LH0@L[]A\ff.SHA1AHHHt$t HgekeHD$H[ff.@AUHW> IATIH~UfHnHfH:"H0A<$/)$eHHXeA<$.u A|$/uIH|$LH|$e1LH0L]A\A]AWAVAUATEUHSHHHt$HT$ HL$(DD$#HHA eAQD$D$<E1Ld$8HD$L|$HE1|$&11LQ\HdIIL9BL#dL$8MtLLL \HdII)LLL[HII)IL9t4BD#FdD$8Mu11L[Ht`ILT$MtL\$A1MHH[]A\A]A^A_I|$Lc1-HD$H|$cccf.AUIATIUHHl$H,THcHHt$HHcL9l$cLLHFH)-HL]A\A]fAUATUHSH(H<8t,=c=cH(H[]A\A]H([]A\A] ff.SHEHHtHC`H c1LHh@L[]A\A]A^A_AWAVIAUEATUSDH(Ht$HT$HL$BIAE11HI9dJ<d(IMadDM1A IHw{AIL9|IpALL)d)HdH\$H1H([]A\A]A^A_EE1AKAA14w"Ã?IAɀAAHE`bD(Aw@uBAAAAA?A A?AˀAʀw>AEPIEHEX mcD#A\cAIA?EPIAɀEXAHEHfDHH1YcD$%=HĘff.fATI1UQ2H cHLHFHAP'DZ]A\fDUHSHHQ/@H=bH HH1Z[]ff.AWH AVAUIHtATfHnIHUfH:"H5ݾ SH)$oHbHHHÅb&1LAEHL[]A\A]A^A_AWAVAUATIUHպ@SH1HPL$pL>Lu(MbLsPH5 LIH@eHH51 LH%H^eLT$`HLLT$JHHl$@ID`NH|$E1HHL$ALD$dL|$@MdLL9eHLLDt$@LF%EdC4{4tA{4t6LHChH_b1LHĈPL[]A\A]A^A_abf.USHHtu9ta9t 1H[]Ã=us1|$H|$ƒ'e9t1HyudHL$|$7r`dHL$|$Љnى|$11QTHcz=|$(d$> ddDAWAVAUATIUSHHH_Lu"HSH|$ L?|$ LeI\$HH;X(u%H5H|$ L|$ eI\$Hht>HIHdHHH5XrLApE{HHt;H IHdHHH5#KrLApE/HHt;H IH@dHHH5#rLAIpEHHt;H{ IHcHHH5#qLApEHHt;H4 IHcHHH5:#vqLAoEKHHt;H IHkcHHH5#/qLAtoEHHt;H IH$cHHH5"pLA-oEHHt;H_ IHbHHH5"pLAnEgHHRHH5W#HgpHkIHybHHH5=pLAnESbH-IH;bHHH5"oLADnEbH8IHaHHH5X"oLAnEaH0L(HT$MIHaE1M9HLH5q"koLAmEaHhHqaH5Q1KHHYaH觋Ia1d@} IH+aHHH5!nL5maIL$XHHH[]A\A]A^A_Ht$J<=H|$%bfQHRH"bZ@HH=QSHH=m-IHt$HLHXHCIC ICIC(D-L[ff.@UHnHHu H]镆bff.ATUHSLg HI<$Ht HӅu+I|$Ht HӅuI|$1Ht HH[]A\[]A\ff.HHHHkeff.AVHBAUIATUSHH HeL&HHnHNH;-nhIHU eL<heHHHou HHHY H \I9L$un1LH59tH=I|$PH eLHL'HH`L%I$LH H[]A\A]A^H5Lt$LD$LLHHt$H5g蘵HHtLdMLHHH|$HedL5 LkL9dM9LD1Y HCIHtHcMtc@HH~xH=sfH:"H)$`2HdH__1HUIH΃u4dE~bH>HH @:0tIHH9wH]ÃuEpdLE~:]*HHHtHH)]H)]ÉL]"EDL]W]避SIHHH47H8t.HH9rH[Lz*HHHtHH)[H)[Ð~״fAVH=AUATUSIHCH3 H5lLH|cH?HL-RH5`H=#LH 1L HEHHGcHLL<"cH -H5+LHcH5\LtbL5eLLZbH+LH@bL-1LL&bH5LL5~bH5LH`bH=f6LbH5LL-.bH5)LHbH5LH|aH5 LH^aH5/LH%@aH5LL-"aH5L aH=uH=CTHnH~H=UuH=~gTH@H]H='uH=SATHH-H=uH=UTHHH=uH=SHHH=uH=SHHH=ouH=rSHZHH=AuH={SH,HVH=[uH=7]SHFH+H=uH=67SHHH=uH=SHHH=uH=RH|HH=cuH=RHNHH=5uH=0RH HTH=uH=yRHH)H=uH=nSRHHH=uH=d-RHHH=}uH=+RHhHH=OuH=nQH:H}H=!uH=QH HRH=uH=pQHH'H=uH=oQHHH=uH=zIQHHH=iuH=#QHTHH=;uH=6PH&HtzH=uH=PHHtbH=u1HHt6H=u11HHm]E[L]A\A]A^U]P]K]F]A]<]7]2]-](]#]]]]] ]]]\\\\\\\\\DHH8HJHX\kff.1HXfAUIATIHU-H\LHHLsHAVD]A\A]ff.@HIIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HHL$ ALH$H8HT$LHL$H$D$0\H@MAfATUSHuHIL[]A\HHH9[H[H=IHtHX@H,H@HHH@H@@ H@8H@0pID$(H+[D(dff.@HH8HJHfDATMUHSHnH;'Z[]A\ff.UHHHqHZH]Tff.@ATUHRHu:H}Ht } u .LeHA$@XL]A\T H}胕뿐HZUH!xZH]ff.fH=Yi@PH5ZfH=tTi@AWAVAUIATUSHHG HD$3H ZHIL"M=H*HHtgHHH)HcgIHZHkH$HHDHHYHLL4HYLISHASII,$HsILH5LL S1H5 L$YH5 LYH5 LXH5 LXH5LyXH5f L]XH5R LA|XH5A L%`XH5- L DX1H5 L+XH5 LXH5LWH5LWH5LWH5LdWH5LHWH5L,gWH5LKWH5oL/W@H5\LWH5HLVH5LV1H5LV H5 LkVAH5LOV1H5L6qVH5LUVH5L9VH5LVH5LVH5LUH5{LUH5iLrU H5WLVU@H5CL:uUH50LYUH5 L=UH5L!U1H5LU@H5LTAH5LTBH5LyTCH5L]TDH5LA|TEH5L%`TFH5L DTGH5tL(THH5aL TIH5OLSJH5@LSKH5-L}SLH5LaSMH5 LESNH5L)dSH5L HSH5L,SH5LSH5LRH5LR@H5LRH5LeRH5pLIRH5^L-hRH5MLLRH5?L0R1H52LRH5(LQH5"LQH5LQH5LlQH5LPQH5L4oQH5LSQ1H5L:QH5LQH5LQH5LPH5LPH5rLsPH5aLWPH5PL;vPH5?LZPH5/L>PH5L"PH5LPH5LO1H5LOH5LzOH5L^OH5LB}OH5L&aOH5L EOH5zL)OH5iL OH5[LNH5QLN1H5FLNH5;LeNH51LIN1H5)L0kNH5LONH5L3NH5LNH5LM@H5LMH5LMH5LlMH5LPMH5L4oMH5LSMH5}L7M1H5pLMH5_LMH5QLLH5ALLH53LsLH5#LWLH5L;vLH5LZLH5L>LH5L"L?H5LL@H5LKLH5LKPH5LwKTH5L[K\H5L?zK`H5L#^KdH5zLBKpH5lL&KtH5_L KxH5RLJ|H5CLJHH52LyJH5$L]JH5LA|JH5L%LHH=ׂLHH=JLHH=qx|AąIH H5!"LHH4H=H=hH=hIHIHHH5hLL hLt$LLTH=hM~HMQpMMLjhHHLIHHH5L蓵HLIn L8H8HH=gLUHg)HHHHHH5L7I^(H5H=gHH5}gIHHHHH5LH M~H=$gI8HH_HHHH5#L覴In01LH5fQH+HIF1H5fL3HH HHHH5LQI^H=H=/fH=(fIHGHHH5LM~8H=eHHGHHH5'L߳In@ʚ;qIHhGH=z9IFPHOGH=o9IFXH6G1, IH#GH}HCHtЅt;L;L1LHHHtIHLFH@HH;uLH5LHD[]A\A]A^A_FFFFff.fAWI׺AVIH AUATIUSHAPwHFIIIHc{6HHFH3HLAt*HH?I9uYL[L]LA\A]A^A_M?FH6H?DAWAVL5;AUE1ATE1UHHHW L9gILHH4HuH3333333I|$L)H9EHk( BIHEHLL=FH>H5QjLMH|$ HEH|$H (LHt$H5LHLL$D$ 4HL$(D$0BLD$8D$@8LL$HD$P@LT$XD$`AL\$hD$pHLt$xDŽ$GDŽ$HDŽ$H$D$@KLIDMtILLHf>DHĠL]A\A]A^A_IHH1CHSHGHHp(Hp HHH9DHHG&HqDL@HX [LÐATIUHS衜8QDHxHHHDH{Ht [LH]A\'Dff.ATUHSLg HI<$Ht HӅI|$Ht HӅI|$Ht HӅI|$Ht HӅI|$ Ht HӅI|$(Ht HӅuwI|$0Ht HӅudI|$8Ht HӅuQI|$@Ht HӅu>I|$HHt HӅu+I|$PHt HӅuI|$X1Ht HH[]A\[]A\ÐH;=iAUIATUuAD]A\A]HAąBLH]A\A]ǫAWAVAUATUH,7SHH|$H|$HHl$@HD$8HD$0H7IHIHt[HIHBP B@BHP0HLHH9u'HĘL[]A\A]A^A_?@x I1H|$X 1L|$PLd$PfHnLI4.LD$@fH:"D$hLL$HHt$Dd$`LD$Hl$XLL$)D$p]^|$`Dd$`Hl$XHT$pAfDUM^HD$pL\$Lt$L;t$@sEExHt$pAAfDTu뻃M^L\$LDT$DT$GAAAIAf$fLUfH|$8H4AH|$0HALIg1LDT$ODT$Dd$`Hl$XHT$psA@腕HI DT5L+t$HHt$8H Lt$(IH8ALt$ PAWH|$(WLLD$HAPLL$@AQLT$PARLL$8LD$@H0t9H|$PHt8H|$8Ht8H|$0H?8E1lDd$`Hl$X??@?f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.f.SHGC HCH=IHtH@HHHXUL[Áwff.UHCHHu H][7ff.ff.UHSHAPHHFHt~CHSHt~HC?IHt(LME1M9~#JDHKDILZL[]HKK,1H9~LDILDHH;uHIH5H9uqHEIf.SHH1H H5H=DHC0H[ff.AWAVIAUATUHHSH(HH EHDAHDH}RIHDH谒LIu5IDLmIUmDA} D1IH5L`ADžAMDL1HHDHp ADLL H(H[]A\A]A^A_LyIPHA1LHD$Pjjx4H HH$DH}JCÅA DH5L蜶EYCH1U4mAU1ATUSQrIHtF1L-1sI|Ht1-HH3EHLْ0EH3ZL[]A\A]fHHH9GELGHtHHw1MEHf.ATSQ,IHtHLH|3ILZ[A\ÐAVIAUIATUHSDG,IHt"HALLH_LH03I[L]A\A]A^ÐUSHQ9wr7HGH+G H~*sHSHK u@, HC 1Z[]Ãuf,JHmyE,ff.@H=G@ATUHQDD1H5MHkDH5@HODH54H3DH5,H{DH5)H_DH5%HCD H5H'D=uH5{H=0xU H5Hu8L%H5^HHLC8Z]A\CCAWAVAUATUH1SHxL|$0HLHHiHHt$`HCLl$& Lw Lt$XLHD$/NHt$`MIH\CL|$ L8 Ht$XD$%HHL)HHFCH)H=FBMcLcA9LH5HPLH5H>1A9HH5'LL1H=ÂHHBH5H蘢|HHx[]A\A]A^A_LH5PHLD$HT$H5@HH54HLL1H=&HHAH;HHA8,EAH(L9uH=zHHA ,Adž[D]A\A]A^fAVH1HAUH ͲHATUSHHl$LL$HD$ID$`'AHXÅAHAHT$HtHH=HH@H@fnf:"D$=Hfuwit@HL-rkLpLd$ Hl$(HLl$ ;HSLDŽ$H]@CHðL9uHHH[]A\A]A^ÐHATIUHSH8HZH.@LtHL[H]A\,@ff.@AWAVAUATUSHHH/Ht H;-PH=HHi@H;+=@Lt$H=Hl$ILLIH@HH?HIH=?L)LLHl$H=AlHHU?k)H+HD[]A\A]A^A_HEPH=TAă ?"?HHHH8ff.f[ff.AWAVAUATUHGLhMt;LhLoXfHHGhLw`GXL`lLLLHI]LA\A]A^A_ff.@HcjAUH؍ATIHHUSHUfHnfH:"HH>HPfD$XHD$`HT$@D$ )D$0L$HL$hH=?H3?H*?Hl$0H?HCt0T$ LH+IH HĈL[]A\A]>f.AVAUATIUSH HD$H?fHF8HH;=>A\$tH1HH}AHHHHAA EE HttHt$HFH\$Ls LkLL9ID$Mt$ H9^>I\$@AD$(Ml$0Il$8H []A\A]A^Å=?>It$(H*K>fE1AL$H5VHHH]>HP}HI&M>I}Hf=HL%T?=ff.HIH8H?HGff.ATIUSH?[HH?H@uH HH_%H?HH} H;Ey?I,$[]A\fAUATUSHVHGHtHIZL[]A\A]H5U׫HHP?H|HI$MtI|$HuL?ff.H=ȻuH|$^H|$IH(L[]A\A]AVAUATUSHE?HGH$?H(HuhLuHMnI9>J<%IH>LHH?HtL3[L]A\A]A^LSL9t>W ``tLw@IHw(IH:G ‰ >@!H0IqMKJH9I9ADHMYL1IIHHH@Hof80fsf80f83f83fsPfsf83hf83`pL9rMIIMLL)M9tE1F LG IH9uÄ=LWH@=1L9tEzEH1D7EHI9uH LHHff.EAu鐦[ff.AUATUHSVqHHH9K=HH8LiHtQHH=H{!IHtDI\$H5LeI|$ HKHID$ZL[]A\A]^HI=AWAVAUIATAUSHHAH~u Eo=L5MS(L9=s(DL#={(Iƃ=EH{ ƒuIufE;LL$LD$Ht$LHL$ HT$(u7H|$Hu(H0L[]A\hHuLo2;-;:;HHGHD$HHw6PI1APIH5HT$RQ蝼H H1ff.AWAVAUIATIUHSHHL6M~MtaHcI9tUHHOH9:ILCPI9uzIIw*1L贬IH:LMM}MtI$Lc@HtHEH{HkHLsH:IE1H[]A\A]A^A_M :xDUH H0HGHt$HD$(HD$ HD$HD$H9(/:1H0]fHG(HuHÐLG(Hw(M:ff.SHH8Ht HC8H{@HtHC@[[ff.fSHgt H;,[@SIHH~LHtH)[ÉH7H:tH9rH[UH&HEH]H@UHH@Ht HE@&H}HHt HEHH}PHt HEPH}XHz=H8H@HATUHH=DSH HL$HT$HD$LD$HD$RLd$IT$Hu@HL$HT$LHAH Hc[]A\a1I9\$~KItH~H>H>H>HMHQ?y >H}H]fAUATVHG>HIHxH>H=tIHt0LH1LHuH5LI MLZA\A]AUIATUSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HH8HK>HB>1IHtKH$HL$ HHHT$ALHL$H$D$0\oLH IHL[]A\A]ff.fAWAVAUATUHHSHHLzHH?H?HH?LmMH}HAHW>Ht$x(IHf>HH;D$x<>HIL5eD$DHD$0HD$(HD$ Lt$HALLHHEHHH$LML=g 1 D$@D$8D$D$D$ D$D$HD$1AEL;D$sMCtA@+AUA#h?EOcMAK|bHB?A멃|$MLL$Z|$tArI|$ |$|$P|$@A>ڃ\$8=|$|$|$ |$=H|$ t6=H|$(tIHi:LDHMHL[]A\A]A^A_D$yD$lHE1HAD$DL%SHD$0HT$HHD$(HD$ SD$ D$L% H}AHcH}H|$ HHAH9OHO;Ht$xHD$ H;LHH;nI.H(L[]A\A]A^A_Ht;3H{h12軩{ HD$HCp2LcP1I'{$|H{HCPHT$H5b=M6Ll$MR1LONLIM L;%4n2IT$0HgHL$ME1I$HwMtMLMM1HCpH{hHH{h1ծU2訨{ HD$HCp12HKPE1HtH+K@IM9S2L1 HD$H32Lx M%E1{$tHHHBHCPM~JHHHL!Ht/K47HiNHLHII)IHCPfC@M~KLSxL9SP}AHHLXIHs@K<7Hs8L9cLLk@Ld$LCxLHIIHJHuH|$L"uNLd$VM.Hs@LHs8LM)Ls@HHHfH|$H0E1Ht M0H|$LuLd$H|$L?HL$ME1IMLILIBsH{@I)LLH{8HD$IHbHk@E19Ld$MC(0Hr HHH1Ҩt DDtD fD Ht,@,HC@II)R.&/ff.ff.AUATUSH0IAA|$1I A|$Ht$HkL/H\$@HHH9H?HHH)H9r0HH1Ll$1蘢HD$H0LD$H9/HA|$It( H)WHtHS/HHD$H9h~H|$H{/HD$HĨ[]A\A]û mfDAWAVAAUIATUHSHH9HFINHLDH觿LIċD$ 趠LH?|$ uo/HL[]A\A]A^A_Ätp/DHH1H|$H=Ht$jHDATUSHH HD$/Hh1觩/zHHCp> {(HCpH{hLd$萪1LH\$H=_HЛH{h1H2/HCpHHHCH==L1HHD$|H{8IHt HC8H|$H`/HCPHC@HCpH{hԩH L[]A\HH#HHC/,L%PgI$.+/ff.@ATUQ%/HH5g|HH1/HHADZ]A\ff."/HH1HGH=Ht$HD$\HH'.HfHHff.@H(H5HT$DH|$HuH(ÉD$ D$ ff.fAUHHATUHH Ll$H|$H=2LHD$IE@t(Hd.}u'HxH L]A\A]Ep.{.AUATUHH /..H=Ll$1HLHl$Ht$H|$LIHcHH5=HT$Ht$H|$;.M.LH eHH ]A\A]ff.fATUHHH|$Ht$HT$HuHH]A\HdHH8HW-@-HMXHHu`H}hfHEhHL$8HT$HL$Ht$0Ht$H|$(HEXSLd$M-H|$ HL$(HT$0HHt$8$Ld$0Ht$LHL$(LHHt$8ݻ#HL$HT$Hƻ ATUSDgE3-G胚DH-HH1[]A\ÐUHG(3--HHE-H}Ht HE(H}8Hu7H}hHt 街HEhHH,HEH]H@SHE8fAWAVAUIHATUSH(HHZHY.H#.IM.I}Ht$hIm -I}HW-Ht$`cIH-H菼H;D$`;.HtI}HGAǃ-LH>I} Hƃb.AHDfo Ll$hDŽ$ $)$A,A|$-H5 LvHc؅t3H5/L`H5LD, H-HpH袯-rL$HL$LHH5=H?HHT-ELLw@H$HH,LH(H[]A\A]A^A_LaII\$PLA1LRH$Pjj5H IH+1I}(Ht$8t$Aut$6t$HOH7I}0t$t$&t$5t$H[+E1H$"N8AA1E1cA- BIH+H5H P1HfHnH$H _fH:"H53HH=W;)$!+ IH+oo@f)$HH$HH\++HD$pH;-^e+IH&M++IHT$pHHT$|=$+H\$pH+H{{,H{LH|$ԙHD$HM,Dd$ E1Hl$0LH9l$~~HsH=L$I$vuFH$LLL8>D$8?uLT$8H|$H;{+L$L\$MTH{Hl$0HDd$ HD$pI HT$Hr<*Hl$pHt-H}>-H}LH|$ʘ~l$HD$0fH:")l$ H1+LT$xL\$\Ll$1LT$L\$8Dd$DH9\$b-HLl$Dd$DHD$pLlHHk)fot$ p L5\I8H?)Ds A*G4vD$=*@$EuTHuH$Ox\$A9HMDLH$yLHNuVt&w&tH mWH5H9(&&F'*())^(-fHHHvHHuHu H8>HQAL HHL$Q1jj'H Htff.ATSVHOH; I[t6tVIHt1H/LHILZ[A\G(1LGA@1YHw8[LA\HVHQH5nE1H81qff.@AU1ATUHSHHLgL9}H;TuHDH[]A\A]HE1M9}%J|HHT$.l1HT$I1AWAVAUIATU1SH(L_HcI Ht 9Am HcIH8HH=+lH8HH='PH8HH=4H8HH=ޡH8HH=)H8HoH=H8HSH=@BH8H7H=zH8HH=H8HH=pH9HH=*TH9HH=8H9HH= H 9HH=H(9HsH=LH09HWH=ɠH89H;H=H@9HH=HH9HH=tHP9HH=|XHX9HH=dHX:HH=dH`:HH=yHHh:HH=),Hp:HH=Hx:HH=H:HgH=}H:HKH=oH:H/H=H:HH= H:HH="hH:HH=LH:HH=0H:HH=wH:HH=˜H:HkH=H:HOH=H:H3H=H:HH=wH;HH=4lH;HH=7PH;HH='4H;HH=Y5H ;HH=H(;HtsH=H8;Ht[H=$/HH;HtCH=_HP;Ht+H=~6HX;HtH=H`;H=6BBH 4H&lIH&H 4HH53 &H 4LH5m&H 4LH5O&LNE11LH 4H5L (HH:HH &11L)%HH:AL H 0H5zL[(H6H%HH:AL bH /H5L!(H5H%HH:AL @H /H5 L'HX5HH%HH:AL {H LZH4HHp9AL .H ?"H5 L H8HHp9AL H !H5ؑLH@6HGHp9AL H !H5LH5H Hp9AL H Q!H5U*LrH 5HHp9AL EH !H5GL8H7HHp9AL H H5LHH6H_Hp9AL H s H5LH7H%Hp9AL H  H5LH5HHp9AL H H5}LPH5HHp9AL ^H H5bLH4HwHp9LL ?AH HH5>H88HH:HP;L "Hp9AL H H5LH08HHp9AL ӸH H5؏LMH4HHp9AL ѸH BH5LH4HtHp9LL ʸAH H5nHx5HH7H9L Hp9AL 9H H5CLH(6HHp9LL {AH 6H5JH4HHH9L Hp9AL KH H5ǎLHx4HVHp9AL QH jH5LH7HHp9AL OH H5gLH7HHp9AL =H H55LGH7HHp9AL +H H5L HP6HnHp9AL H BH5ˍLH7H4Hp9LL AH H5H7HHH8:LG HH;H7L( H:H7L H 4E11LH5L Hh9HHl11LXL LE11Hh9LH`6HH'1HX6HL LE11Hh9LH7HHH7HL hLE11Hh9L=H5HHH5HH 4E11LH5)L H8HHQ11L=L $LE11H8LH@4HH H84HL LE11H8LhHX7HHHP7HH 4E11LH5xL ӵH:HH|11LhL lLE11H:LH04HH7AH(4H"L +LE11H:LH7HHH7HL LE11H:LMH7HHH6HL OLE11H:LH6HHeoH6HPL @LE11H:LH05HH)H(5H L ˉLE11H:L{H6HH H6HL LE11H:L5Hp7HH Hh7H~L GLE11H:LH86HHMW H06H8L LE11H:LH7HH Hx7HL ɈLE11H:LcH4HH H4HL LE11H:LH4HH{ H4HfL JLE11H:LH4HH5? H4H L LE11H:LHh5HH H`5HH 4E11LH5L lGH@;HH11LHL LE11H@;LH6HH`j H5HKL wLE11H@;LHH7HH$ H@7HL LE11H@;LvH8HH H7HL džLE11H@;L0H8HH H8HyH 4E11LH5wL 3H8HHD11L0L FLE11H8LH@5HH H85H L LE11H8L[H(7HH H 7H L LE11H8LH6HHs } Hx6H^ L zLE11H8LHp6HH- 7 Hh6H L 8LE11H8LH5HH H5H L LE11H8LCH5HH H5H L LE11H8LH 6HH[ eH6HF L pLE11H8LH6HH H6H L 3LE11H8LqH5HH H5H L LE11H8L+H87HH H07Ht H 4H5XLL {AH  H9HH7 11L# H 4E11LH5JL e H`9HH HqL HP9H`9L HH9H`9L H`9LL AH H5 HH5HHW H ;L? H`:HH5L H 4H5cLL AH * H8HH 11L  H`;H8L H:H8L H 4H5aLL AH {  H8HHT H7 L 8 Hx8H8L H(;H8LbHP9H8LCHH9H8L$H 4H5LL AH f ! H9HHH" L cH8H9LDHP9H9L%HH9H9LnH 4H5YLL uAH p k Hp8HHH, Ld H8Hp8LHP9Hp8LoHH9Hp8LPH 4H5LL AH z  Hh;HH11L H:Hh;LHH 4H5BLL AH E H@:HH11LF H9H@:LpH 4E11LH5L zH:HH;H> L H:AL ~H H5~LH6HH:AL H H5`~LJH6HH:AL ~H wH55~LH6HqH:LL oAH "H5~H6HH4H:LH:AL WH H5}LH6HH:LL }AH cH5}GH6HHH`:LH:LL #AH H5`}H6HHPH:L8H`:H6LH:AL }H }H5}L~H6HH 4E11LH5|L LH0;HH11LMH0;AL H H5|LH7H\ǃ4cff.S4H=[)HcyIHtaX\HcHHcH@H@@H@LLH fHnMCxIǃfH:"ACh|L[ff.fHcF$tu9HV0Ht$HLG0HN8IHt H1H8H7HvHFHH~1H9~LV0LO0MMHLF8E1Mt!L9~K4HO8J4IfG04ff.H%HG@ff.ATUSG\Htru_u~_uHLAH蚯HD]A\A]L"HOH1H5AI8*}AVAUATUSG(ILo8HGA|$\HFHHP`HuwH;~&L(IHHx8HMcT$\AE1M9|MD$PLMD$H[L]A\A]A^M\$hOIH{L-#HIuHHti[L]A\A]A^vHwHu[HGwH p!H5xE1H9oHr H5E1H8QHt I|$`H]fYIHIct$\H9HLQ{HHAt$(I|$L[]A\A]A^Yff.HXH=<L <ItuMLfH9p0tKH8H8uLHLHHuH<$tLLbHXDPL9vD9PtHHIH8IKH8tIH8Lff.ATUSHHH Ld$Hl$HL$LHSzL[0HL$LHI;UIHC8HHT$HMHHL$H1H []A\ff.AWIAVIAUATIUSIcHHH4$LL$EHHtE1L9tKD]LMEtA EYIEuIDŽ$ H$HtCHL5`LHH)L{I$ HA$ M$ fHnIl$Il$0A$HL[]A\A]A^LcʃJ<hLc҃N N6H,$HcH &LcN HcڃH LcƒJ4HL$HH)H{LHLVI$ HHo0f.Q EHH@ffH=H @@@ H@HHPP@XHǀǀǀ Hǀ Hǀ ǀ Hǀ Hǀ Hǀ @ @0   Zff.AUATUSHQHL+H5I}tJLcID$A|$ I}hLuH\HZ[]A\A]fDAVIAUAATUSHHFqL`L躢HEHAtZHH thqHyH@u t Et HH)HpI9vHuHH[]A\A]A^EuEHHuP qHyH@t@ XkGuRGݫH Y.fUHE2H]t@ATIUHSHHDž = HAԸ[]A\ff.H HPH f.H H=鴳@AWAVAUATUHSH( uYIHI1HL~L9|vIE1II9C #w MIAt9 v Dž H([]A\A]A^A_MIMAuUA #t wHH@gM4ILL)I9IH5LxAuAFI~<:t<=uWH t tH5HDEQAA_ADuBtH׾DD$ H9dH)HLd$1H#t$ HII<HcIt1_Zt$ Rwt$ LCAHH u(L==>t$ LLDLeut$ NI9t2Lt$ 踢HmHHHt$ HHDH Dž Hu$LHuH  AVAUATUSHLg8HMtoHk H}HHGcHcuHWH`HH9HOtE1HL?H}XHuPLoLvMM u!1[]A\A]A^zHC8IHuLcMALLJ E$tHc}ALLLH H}Pff.fHt@u @ÃfDHH H9Gt H5n'YfAWfnIAVf:"MAUMATUSHfL$HbI1@fA A M<$AD$8AD$(貜ID$IH 0I|$IH?vfoID$pAT$xHHL$Mt$@LID$AD$Ml$ Al$H}XHMPLwLyLL 1HT$Ht$H|$H([]A\A]A^A_lIQH}HEHH9HOE1Lf.ATHHHFcHt$lIHtH^H;D$cLIHLA\ff.AUIATQHH8LbI$7MuL-(I$L.IHt HLZA\A]IHH 6LH5 1H9ZS1HH RHHHX1 HCH8 H[DH(HHHt1ff.HHHH&ff.ATIUHAPHcG;GtAHUH ƒ9tZ1]A\Hy_uEt&LL&5I HLL$HJHL$X1LLiDIHEHL$XHCEIAIALl$PME1HT$PLd$`VLt$(E1ELAWt$@H|$8H LH|$HHNEHsHH|$p1H|$HLhH|$H_EH-H|$H1Hu]JHt$`LH|$H1L $I05JL$Ht$`MCPHt$`FL>ff.ATIUHSH Hu?HtH HL[]A\.>1HL$H$-H$HL$HHEuLHt4HL$H$=HHLH}4H$HL$PIt$ H}HL$H$5H$HL$HHLEH}MHwLHL9MPIM1IIoTHI9uMIAt NNDL] L9uwHEHEfnIfnB0f:"I f:"BI|$ fl)$% Htfo$HXX H []A\E1J4JtIM9uHL$H$菈H$HL$HEHEmHKKLKiKfUHSHAPHt H;=KHsHwH{~HsYH[]1uKff.H S8uH H;Ht 3H=CuHH;Ht 3H[fATUHHH$L$H$]HLDŽ$(USH$HH]A\H=YP$@ATUSHP=pS{`@SHߋk IHu?{`kRHMHu<{`kRHHu:kE1䋋L[]A\úHH\IHuRHGIHtBRf.ATfovI1UHSH_ H=NH0HCHqRAH5NL(UR1H5ML(nI I n LIhvL`vL;e|H5TH+IHmHPHL$@Ht$HE1HL$(Ht$ mM;oK|HT$(H5SlH|$@HIHmH|$@uL>IHtgHT$ LHLL$LD$lH|$HHlLD$H|$H|$AjuEH|$lQuLGu2HlIHT$H5RHAH|$ uH|$0uHtMtLtAkLL$811I9HHkHH5RHT}kHtHst)L%0RHL1HufgHHHHX[]A\A]A^A_H|$LkH|$HH|$ȷH|$jLL9@u&HHj`H`jH HLԿ^jjfHHVlff.SH79lH=">IHtHHHXj>L[DQzlHW1HkZfHlHH9Gt H5sjff.HAWAVAUIATUSHHH|$Ht$LEIHt=HI9D$t/LHHkLrHւHIrHL[]A\A]A^A_fHHHGH=Ht$HD$8EHATUHAR3IHEt-HP8HDHtH111HL1HX]A\AYHL]E111A\/ff.@HGH kHPH9WkH0<>ff.Ht?UH5)H HT$UH ]Hl$H.HD$ D$ 1fHPH@H;=ATt%HH5ҴIHt HLA\IHu)H=lGHHtLHUkA`EwOL HHtL贔HmA<$A`AjL詐IHiD$A`EGyiL袇IHLHHL*A`IIL11L\HHiAAA`< LH&LUBIHAwI HHTiD@DH I_ HPDDLSHZYHIH2hD $A`EOlLIHD$A`EWElL IHuLEAD$E1AGLDL$D$D$DL$HHFlE1111L[HH=lL袘A`IYM111Lc[HHykgkff.fUSHQP=pKl{``lHߋk6Hu"{`k0lHHukyZ[]ff.ATH/ISHAP9kH9yHLYH5[A\dff.@QkIHkHH5!;H1H=; Z@ATIt>I$H5^IHkH@HHkILA\HHtHA\AP)eHt8HtYFcHHZfAUATIUHSQH]kI$Md$ID$HLhJkLHgOk1kHHIHkHxL kLiHU HKHBt H`uI$ZL[]A\A]L?I$jAWAVAUATUSHAPP=pLk{`1kD{D9{ kH'jLCIc{`M EiEajHHHjH&{`IjsH{蝀IHZjD@DH L[ MuGH}QLDASD^_IIHjM׃ZL[]A\A]A^A_MvAWIAVAUATUSHHP=pjHT$0LHD$0tALd$0HHL[]A\A]A^A_HL$8A_HL$Ld$0LL jAA_~ApjA`cjLEo0IHtLHumA`Eo$jLHt)AA`EwA9~$HD$0DJEoAA`AAoLHD$HtMFLhAx siA} KiLHHD$iL˴IHhLT$LLT$ 7LHD$7HT$1Ht?HhHH Ht$ HD$(HHL$?H|$ 7Ht$LHt$ LA.IxLD$?Lf7H|$LL$(1DH|$ IqLL$ H|$IHD$8eM+hH|$DLl$8I L\hAN$AV LLT$EJ,EB(PAw -ZYH8gggAWAVAUATUHSHHhH{hoEfI:)$fI~ID$fH~H.HH\hHxLlh(Ls H} IVH9U(L@hfo $Lt$PH=KBHL)L$P7HHhH5)Ht$H9"HH9gH;gadM$X1MQL9}M9lHH}LgdH}HE1L1H541pIHH@E1gM;}|=H} LLIHcLcMtIHhL[]A\A]A^A_IULJ HHHL$ aH|$ $tc4$uIHYcH}LLt$H8c{ H$H H<eIH$fIHT$@Ht$HHD$HH}LLD$0HT$(Ht$ Ht$ HT$(D$HIX Ht HHH9 =eH[ff.fUSHQP=p6e{`=eHߋkHuk1qZ[]H!Huf.AUATUHHtcH;5 Ht$tL蝽yc@AVAUATIUHQH?Lu1Lj}HH11H=c<HpIHcLH4}LIY^McLLHA:^L2^ZD]A\A]A^1HEHjAcaAHff.HHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$ H$D$0HD$HT$&Hff.@AWHAVAUIATUSQHL8LYIHt:H;t1H5HM~5HHSHtH;VuZL[]A\A]A^A_LL}`ATIH5H苙`IyHtH5莙IHu-IH~`HFH5&H:ovLA\H@tI$DH)HHHH8 ff.AWIAVAUIATIUHHHt$L8HH2HSscH|$cM|cMuL%94HHthLH5>"HVxJLH5MHVx4LHt$HIHtHpLHT=LTHTH1]A\A]A^A_@AWIAVAUATUSH(P=p_cA`CcAOLL$ HD$Hu+D\$ 1E_AJAH([]A\A]A^A_AsApybA`bEoVHHsbA_`E1AtwbEoJ|I L#zHt@L6HHt0M9uMH|$HJ4CH/bH|$HEoIw LIHu>NLMT$O LcM9HYHt$LLA[o bAWIAVAAUATULSHH|$׉L$LL$ %b|$u D$VbH|$H ~L#HLDLDHT$AH51RHx#SSSH IHaH5UHIHHKHHaHH5L諡@aH=Ht$8Ld$8H$HHaHD$(`H|$(D$Qt$`|$L)H=H?pA9LD$LD$LD$LpQHhQH|$ HHHaH$HIHVaL%xPILt$ H4"L1t$H5ATLL$(LH LIPHPH|$PM,`|$H=ZwL=3IDIHH_HH5pL8`HPHHL[]A\A]A^A_LL$LLL$LT$__ATUSHP=p`{`}`#HߋkvHu9{`k`HHtI~L[]A\ÉkHAIHtH{ yIH`HL`SI`Åx[ff.ATUSHHP=p;`{` `HDcE$HHtr HuHt`H#$fHnfH:")$HtCH{ IH_fo $HIȃHL[]A\Dc1AUIATUSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HH8H@_H7_IHtHHL$ E1HHH$HL$HHT$L$D$0?LHMIHL[]A\A]11.UISHQHt5H.LH4Ht1H9~HKH4H~H|HZ[]1fATH=SHQH9h^HE1Hu5ILIHE^1LIPLIIPZL[A\L$I^AWAVLvAUATUSHHXL^HMSMI M.MW_M~MtZH-I9*IW]LHt$JIH]HH;D$]MIInHIMfML;%cxE1I$D$ HCM[LH5k$AMDH;-nH=HHMH{ HH{(H^H{0H^H{8H^H{@H{^H{xH\^HH7^HH^H{HH]HH]HǃHǃHChHǃM{H{(HLCHC(H\LH5IH7^1$D$ LHEH߈HkHHC fCX]Lk HIE蘘LHH ]HzLHH| Aą]L9JMMLnH M9AI9@AH-I9L|$H=TLl$HLHD$HH[XH|$I[@k_H5LL@k]號AŅ[H|$HtIDk^HCp w[CHXD[]A\A]A^A_I~ L$HZ8tH<$D$ EZH$I~( t$vZHT$H5L踞ZH|$HL5L9w\HIt$L${ZLHt$RIH3ZHH;D$ ZL$@HUZH ҾL8IrzH%lHt$H߿IHiZH[H;D$6ZL舺HHBZG"LzYLbMMT$L$LA1PL*LHD$(PjjhGH IHXL$ڒIH~YHt$H=Ll$H>IH[YH:rLA/GA'YD-HC(HH-L@Au&HC(FH{(u6HC(HH{(IHXHCE1$D$ L E1M8ICPXMItE1H-HCH5LJ$t.$E1D$ T$E1D$ H=YHH XD$ E1E13WWW-YfDUI1SHQHtH.LHBHt1HKH4H>H|HH9Z[]ff.USHQP=pX{`YHߋkyHu{`kXHqHXyZ[]DAVIAUIATSHHIHI9D$t;HT$H5L蜚YH|$HtuSH|$D~HL[A\A]A^LDuH=LL1H5 UH?,E1Q+Y< u)Y1Z< YW1 YZf.HH&YATUSHHLg@Hu.HG@fGZG\HCP1M6YH[]A\HHLZA\A]H`Iff.AVAUATIHUHSHHHG H=&Ll$LHD$HD$HXH>MH|$Aq>AmXAt1H[]A\A]A^H{0H9XHChLHHC0H+XLH5KHXH|$IHtHWtAH-jhH5E^uHuHHtH|$HMHKhLD$MOL=1BHH@LXHH1HGH=cHt$HD$Ht$DIHtH;sYH9uHB5HL[A\AWIAVAUATUSH8P=pYA`ZEwE9wmZI_IcEH4ˋ~n|$l$ A@AApZL\sIH3AQApYA`YA_$77HHYHD$Eo`1E.Y LZHC<$Iw AHHZMcL9LHH$i:H$LLABPEHAHApYA`Y LEg2ZH`EgE1AA`DSEAwIHKIHTXDpD` I_ L]M#L1SE1ATDD$HHL$t_AXIMXEAEH8L[]A\A]A^A_LqHHH9\$t,EOHtHD $vJTHpAJH|$H4$IIHJ4LD$"H?WH4$HAA`Ew WL0IHEw+L0IHLLL\$@GLLH$qHHL$H<$HD$H,XHHHL$HT$(dHt$1IHHt$ HIHuH|$HHxLD$ L $LT$L\$(IkIM9WL1SLEATDD$HNjL$HT$ rY^I7AwI!IHUMW LLXh L$GIHSULL8FIHu}HUL1x4$LAUHLDD$L$ZrIXZMUUVff.fW@fDHH@WHH1HGH=Ht$HD$HH@SHW5HW{ u1҃{$tH{`uH)[Hb H{PtHSHHH|Hf.HHFH5gAUIATIUHSQHFHMFM,$J<+LKHHt2E1L9~L]HWIcOIL1HHH؍I9 ZH[]A\A]IL$LOHcH4HI4ff.H59D@HHFH5UHSHHHeFH?HHuH3HH[]nFf.AUIATUSHH5fQH蔒H;݂H`FHtHbHI ZL[]A\A]lXIH$FHSLFHHHE1LA0IHtHHhHHXDUSHQP=pR{`R3Hߋkv1Huk1qZ[]HHuf.U`RGH;Gt HMHcLA; kREL]1u-Ã=uՃ/uи0ø.fUSHQ辀Ht(HXZ[]ff.@AVAUIATUHSHZHCIILHL$H'QHsHxLISLAE藕HHPHVHHEgHH9UP1HHMAE[]A\A]A^ff.fATH=SHQH9PHHPL$Iw5ILIHP1LIPLIIPZL[A\PUHSQP=pQ}`P$H]IH}`].R%HIH}`]P&HIH}`]iP2HIH}`]O'HnIH1}`]O(HHIH*}`]O)H"IHi}`]XQ*HIH }`]O+HIH[}`]wO,HIHT}`]P-HIH}`]P.HdIH}`]N0H>IH]LZ[]H} $IHu OH} $IHuOH} $IHuOH} j$IHuFOH} O$IHdOH} 0$IHE+OH} $IH&OH} #IHOH} #IHOH} #IHOH} #IHTOH} v#HHHIHtdOH} @#IHULff.@SfAnfHnfHnfH:"fH:"H0fnT$Hf:"D$@f:"T$PflHOHOH|$XHL)D$ )L$)$2{Ht'fo$$fol$ fot$ HX(`hp8H0[HLRL L11'E\H1L HHAADHLL)LHyщfUHHHtH}HtH} HtH}(HtH] ff.HHfHnfHnfn\$`fnD$PfInfH:"f:"\$hf:"D$XfH:"fI:"flHNHNH|$pH)D$0)L$ )T$)$$yHt/fo,$fot$fo|$ fDoD$0hpx(D@8HHff.ATUHQt< NHcuH=jH?t HEIZL[]A\A]HHCHDhl@l|HSHADjlE[eLCL;fML;BiH L IDLE1LgHI:[pfDLGMt"I@ HP0A@`HJ x HLH6HANHgHI6M%NLMLZ]A\ff.AWIAVAUATUSH(P=p&NA` NA_A9_uwL #NMGHcA`M EiEaMLjHHtN1 L;t;AHAH(H[]A\A]A^A_IwHcHH $LD$uHt-HHnL9MLNLI)L)?ff.@ILIHL I3HMHIsMu$H@Hu#J|IHHK|LHA IISIs MtDEN\IHLHHO\Hff.fHHHBL HLIHHMuLVMZL^HwHVHWI:H>ff.@AVIAUL,ATN$UHSH2LHH?HLH}Hu []A\A]A^I^LLH[]A\A]A^麩f.UfAnfnSfA:"f:"flH>HH|$00)$ YHtfo$HhXP H[]ff.HHHBL HLIHHMuLVMZL^HwHVHWI:H>ff.@Q/HtHZff.@SsXHt[f.ATIUHQHFH9Ft0HHHt+HLXuHHHZ]A\HVHu1fATfAnfnUfA:"SHf:"L$0flH==HH=IH|$8H)$WHtfo$L`hHXP8H[]A\ff.@HGHWH@HHHj=Hz=H1He=f.UfAnfnSfA:"f:"flHHH=[=HH|$00)$VHtfo$HhXP H[]DUIISHLVL; Bt L;D=H 0 HcHIqI9su4MC0ItMQ0ItM9uHLL[]IQI9S|HDHH[]IYI9[~HLL[]LLDHHstLE1EL HA1E1IcM,7IH9}M|EG8EuA?tAADD9|IDT$HtLDD$yiDD$t$L 0uLs뵅6M_D$IH݉t$L\$DD$HD$HcT$HQ6H8H9|"E8HDT$LDD$LsE|$VLL$ILH9HH5H5HML LLH,L lH5vHL NH5aHL 0H5SHҞL H5DH贞L txH59H蚞L ڙt^H50H耞L 4H5!HbL t&H57HHh4A $L xD$p4fHHtH?5HW1:tHJ9uHAH56:H9pt1DHY;H8HJA@f.AVAUIATIU1SHHI H|HtLLj]5HcHt9HHFHo@8tULm1HSLHrtH5mLtнjUL1U1AG@AWE1HA AVAUIH1ATUSHHhHl$H6GHIHtGII~C1LLH=?fI:")$QHHtrLЦH;-t|HHH05HI誦I GM GM9GMtHS0HtLHS0HhL[]A\A]A^A_xULIMGfDATSQL'MFHIHt.Hx H޹H@(1H LHILZ[A\f.AWAVAUATL% U1SHQHcHt^HH9}ALlAM w+Ic4LI}FI}1Z[]A\A]A^A_ø1MuE1IcM?FML9I}W4FI} FFI}5tFI}#(FI} mFI}WYI}?FI}03FMLIyEA1E@AT1IUSHHPHHHL1HCH辩H{HCHHT$H4$ӱHK|HiHHw~IH|$tH3HPL[]A\ATUSHHHHHC8HHx (HI蝣L[]A\DAWAVAUATUSH8LoMHHHH;=IJH eH5;E1L1ILJD{ MeEU AEU EA utFH5FsJ>tFHcHH)gAPIHt HYk>1ZHATH8LgMKL{KMd$8LA\AWEAVAIAUIATIUHS1AQEudHt'L:xKHH9}8IItHuLtHiH8!>KT1Z[]A\A]A^A_HRff.HE1H87HJAHtLI EQ$AJDDAVAHAUIATUHAQHG8HxH!HJLHILIMJHU8DHAXL]A\A]A^rfAWAAVIAUATIH=XUSLHHT$eHTJI4HH@JLIHDLIHtHT$IILLH3\IH)HL[]A\A]A^A_fDAWAVAUATIUSHH(L$ DD$DL$HL.ILcE1O|LT$AIAE1E1M9~JD8EDIE1E TI9~HtLyIHI\$8|$`Lt(fLE1AH(D[]A\A]A^A_Ët$ LE1A1HTH3:*HI9uLIHH1HtH~HI|HI9u|$`H|$~MD$8t$ HcLARHLLOAƅHLE1詗ML$8t$LA AE1c1I"E1YJl}HLD$zHD$t'IT$8t$L狊DIM9|$`}Ml$8RLE1AAVu(Ht$IL$8LJ>t$ 4HuLкI|$8t$L^5GL3LH\IHcGM\$8HT$Lt$ AFDFFFff.@SfHnfH:"HHFH=H)$Htfo $H@ HX(HH[ATIUHH~SHjHFHHH[]A\ff.fHJ@AAu=zDzH @t3@t<@ t:DJPAu!Au A D tuI ԃڃ ƀfDHHHtWHqHt~tZHqHH=Bt(HLkLJA HHDAAu HRHuMQAztMQL^MtLMRATUSHOGHq=1IHAH~HcH9}HcLD1 CA(E`[]A\H?HHH{ HHKCfUSHH(HT$Ht$H|$蓁k(H{8f(HC@HhHx>HPH5jHHHCZ[]DHEHHH9G4HH$HDSHH$HLGIXhHNHH{(CHH HHC(H1[HG(HuҏHH|$H|$H鹏fAWAVIAUIATIUHSHHFPLxHt`MuaLH HLHGHU8HLdE1҅AHD[]A\A]A^A_Lnp1HM8L9It$PyL\H}8LL$LIxL$H IAHE8AHU8LL$Hz8yL$Hu8?GHcоHGHTLHIf{FLH5gL$[3L$i*Hx@LDL$ L$5yL$ L$_FAWIAVAUIATUHSH(t$ HHH]E1K$HHE1I9}J|?I1L9|fE1I9}JtLS>IIMIU8LE1䋊HcT$ HjAH(D[]A\A]A^A_ItH>LH1E1{HE1L9~iOtI6HXLHILH9tILH1HL$HtH|$I>LD$ HH|$H1HtH]M'E1IcMGI7H9}ITLHr4HALސHHHE1M9}O\IHJDIHLHGH討I}8LcL$ IE1䋏LLA|$ 6H,H];HsLydGM1E11L9MtI>Mu"M]81ҾiLArIvLIU8L:FE1HpMt/LLLLL)FM}8AvFMU81M侎LE1AA[IPgAHjT$ALZY'FIQHHLLL)FFEEAWRAVAUIATUHSH8LfHF(HN L~T$H^LHD$H $pEH<$6AU8T$LH:HD$HELt$(It$HHD$(L-EI4$LHEIt$HFIt$LHI|$(HHH=BQHT$H50QLHUHT$(H5DD$T$LLHxD} EHNIHH5HHDML$M EML]8I$MSPHDHMd$IKXMDI$IS`E1MAHDL3M9}JtHLDIԾH$Hu8HHLnIEHRDHT$LHH@DLE1}HuE1H<$u+M9|~H8LH[]A\A]A^A_xHH<$LE1H4$McH>I9}H $HJtDCAHdCL$MZAC D$LM8HAK@CIEHVHH6LH?CHWHH7LHBLE8fHABHL$H=tӁHNHWBBB@UHSHQH6_BHsHKBHsHBHsH#BHs(H_Z[]Ht;AUATIU1SHQL.L9| Z[]A\A]HtLtH׸f.HtPH6=Zøff.fAWAVAUE1ATUHSHH(Lf0MtI<$7LcMtH[ E1E1IcI;<$|yMH(L[]A\A]A^A_1ItHAAIcI;$|HS0HAHHM8fHRAAkHL MLL$Mt`LU8I0IzHHAMHLHD$H|$D$|$AHt$H&@ALM~ɎLHΆH@HHJ@H誆Hu8LHt5IHD$OHT$HIO@H@HT5@fAVAUATUSHP=p@{`k@HDcHHuB{`Dc7@HHHuxDcE1DODL[]A\A]A^H3:{`Iu H=Ht:H+{`HuLHHd:IHu?H9{`Is:H{`IYH޿?LLHH9IH7?$ff.AUIATIU1SHQHcH?HH9| Z[]A\A]HtLLHVH6Vt݃ff.fSfHnƾHfH:"H)$> Ht fo $HXH[HuAUATIHHG8HL$HxHH$ IH>HL譼>L IT$H4$HL$>LH $H<$tHHA\A]>AWAVIAUAATIUHSHA$lMD$M<>ILz1A|$M@E@ljL$ @81L9ItL$ LHL$Z=L$HHU8AoD$ IL$HtHL{MLH=AH}8Lsdw=HHAAH[]A\A]A^A_A|$uEMd$AEKtDLH=M9tHm8LmpMeLepH}8L$ IHeI4$.Hu8?L_8Adx.Hm8'mxH5n--------wHGHc H1HwHFHHf.AUATUSHHHw 1($H-Hs H1$fHnfH:")$Ho-Hs 1#HHX-Hs 1#IHA-Hs 1#IH*-H{ 8Ht$fo $H@LhL` H@(Hh0H[]A\A]ÐUHH?HtpH}HtpH} HtpH]wf.USHQP=p,{`, HߋkHt H1HtqZ[]Ék1f.UHHGpHHtpH} HtpH}HtoH}(HtoH}0HtoH}8Hu H],moDUHSRH? H_vHHuH}oXH[]vHPHH5H8.1Zf.AVAUATUSHH9VZ,HDIHDHt~+HuHs&u;Ht D&Eeu;1H[]A\A]A^HLLILHKHHDE]lAlDtfEtAWAVAUIHATIUSH8tt8IuLLH,L=IH8L[]A\A]A^A_cIHJ, L芲HD$H,Ht$1?HD$H+HD$Hx+HH(HL$1Lt$,LHvIHLLUH|$t$,H@t/LmH;l$|IL9W+IIII)M9'+N\ L\$Ht$H|$n*HL$HHyHT$IHY(H\$;L4mIH*H|$Hb*IuHL$LHJ6*H|$lL=I]LlLE1lH|$l;DAVAUIATIUHHXHD$H9*IH+1HH*LD$L4$1HIULHILL9LMI9IN*H|$AtHHXD]A\A]A^AWIAVIAUIATIUSLHHwHHo(MLL)HLL)H9p*HLL$]IUH<$HU*Im(H)Jt%H|=L)B1H~ LHs&ubHt E7DuuBH[]A\A]A^A_MH}LHLEILHLH)H +H)HH1EdfDdED]ElDlI}0LD$H $FL $LT$IUMu2M)M(I4LL $H4$M)1I}tHIm(L)J|Jt%L $AH4$LIudH$y-)H-iH-HBATUHSHH(HLe [L]A\)AWIAVEAUATIUHSHH8dž DL$ HD$(LEHD$ ML9BAEMJ<\upM@L9vQAI<\uxM@kL9v(AI<\uPFML9wLMM9WE1M)EHL$xLLLIMAtgLML9v^A9}tUL\$DHL$$$Ht$8VDD$,HLL$HH L\$8ME1LL 'Ht$(HALl$ MI<$H$HT$pLL"HHt(I|$H|$WH|$xLF*D$ q|$ uL9v A:<}IL9vA8}tE1Ht$(HNL >띃|$ H}uHHH9&D$ H8[]A\A]A^A_M6I|$PMWL=gJ?}D$ tH?LL1I0@-IIAHMM9Ht$(H"L^L9%ABMJUH5$H@~%I12L1HD$HU%HP H@LfHnHT$(HD$fH:"l$8D$pk%LL H|$0HtNHD$H6%Ht$H H|$H):_$H|$|$H$H@]A\A]D~4SH5{HE1H=1HMHC0H$1[1@AWAVIAUATUHSHHHL$M$L=L-]PAIHt}foAID$HH$LD$1 HH5H;Il$ It$I\$(Mt$0MD$8Ml$@M|$HuH;-u L ML$HL[]A\A]A^A_ff.H*AWAVAUATUSHXH|$HL$H9$$HHk1ItIH$HIH#IHL9s# \tbHuHMHL9rHLD$H11L)LIHtHD$HH#L!cHXL[]A\A]A^A_H{E\HUL9#K#HHzHHI9v ;yHH1H)IH#@ H5P;AAA "MVH@"MFE1Ll$HLd$ ELt$(MILH\$0LL9|7L1LLt$(HLd$ Ll$HILH\$0Hk H&bAu'T1H|$8HF5H|$8H5:H A:"T]AWAVAUATUHSH8IDD$,AL$(LL$)LHIMiL.I9 ME1E11A<\n J <[<()<# <' <" M AHNAHI9LCHHCI9:Lfomfo ufHH>HHH$HHtLoHFftff8 fsf8 f8#f8#fsfsfD8#f8#fDffADoHfDtfDfE8 fAsfE8 fEofE8#fE8#fAsfAsfA8#fE8#fAfEfAfo(Hftff8 fsf8 fDofD8#f8#fAsfsfE8#fD8#fEfAfDfAH9k@Do opH@fDtftfDffE8 fAsf8 fA8#fAsfE8 fA8#DohfE8#fD8#fAsfsffDtfsfA8#fDfD8 fD8#fAfE8#fEfDfAsffE8 fAsfE8#fE8 fA8#fEfA8#fAsfEfAsfA8#fAfA8#fffffDooXftff8 fsfD8 fD8#fA8#fsfAsfD8#fE8#fEfAfAfAH9foLfsHfHfofsffA~L9/HN> I9~ LFM9~ L^M9~ bH~I9~ HVI9~ HFI9~ nHNI9~ NLFM9v|~ 2L^ M9vi~ H~ I9vV~ HV I9vC~ HF I9v0~ HN I9v~ cLFM9v ~ H4$A(LDT$ AD6)訵DL$ HILUE1 L$H$DL$ I LM BUdHALI LAMh7H$DL$ ID^EEL<$DXXuDNEH\LL|$ L$*L$H|$ HIH<$LLT$ _H|$ H<$H8=A8!-IL9LE18:A:}6Ld$ILI<$EH$xH$L$H$xD^P0H} $fDn4$D$fE:"p fDn<$fD:"{fElD)<$-H fo,$H$pLxDhLph HE1H8[]A\A]A^A_IIMAIhA9 t$IyE1<<E1EA)AI9v5HNMAHI)I9MCIIv I9oE1\E1AAuAUA9AAAAAAAiAI8.AE11LHQH1I2$HT$H:HHpH3L9DhHHE]AAaHHH!H1H3MArDDHHL9fDo-HL$ HDŽ$L$L$HDŽ$ LD$P$$$L$LDD$HDILH  H$LHHIHLM9L QH .H1I1H<$LLT$ [H|$ 5H<$LsAF}h6L5 HHHHDCuI9{HLL)Ll$IEH(HIL9A8OA8OH;E11LMAAxLWH.H1I0M_M9`Aw@=LE1wE1A9 E1E17ILHH1I0[2Mmƒ߀]<) IFD40A(HHH1H3H lHmH1H1IwL9sA8Gt AA8GuH3AIFD40A[u<]lA{i<}Z\n~ff.AUATIUHHIHHJLHL]A\A]wSHHGHH?HHWH+G(HHzLHI9LLHH)L9J4fHnH{fH:") $LLKI fInLK(flf$CH[ATIUHHHBH;B tHHHJ@(HHL]A\H׾HT$ HT$tHBff.AUATIUSQHHfH* }X^U}f/H,H5HH9wI9l$L,LAT$@HHIrL1HHHIt$MT$HtFMM,LMIM9t)IHtHHLAM!JH8H9HHtLAT$HIl$1I\$Z[]A\A]\H,H?)HƒfHH H*XfUHSHQHG0HtH~HS8Hu HKHHZ[]H}ff.AWIAVAUATUSH(P=pA`'AOLL$ZIHAsApA`EwRHHHD$Eo`1E L7vHubEwIw H2IHMcL9gHULLLAkAqAH([]A\A]A^A_LxHHtH9\$t(H|EwHcNLMVAO {L\$H|$HLLH4HD$\?HH|$H@AUATUSHQP=p/{`HDc#HHtHuHubK`Dc{`HV#HHt|HS 1HHDADHZ[]A\A]HbIHtHH5趤rHS HLHHuDcff.fHnHfH:"H^H׾)$FHtfo $H@HGHt$HWHxH9P~H@HHHWHRHGHGH)M1YDAVHAUATIHUSH&fHnfH:"HĀHfHZHD$@D$XHD$`D$ )D$0L$HL$hHHIMLl$0I<$L$H\$ HT$hA1H5&H=%/"H|$PI+ALExTL%<I$LL1HH[]A\A]A^I|$HKvŃTIX,H Ht$hH9[,H2ff.USHQP=pR{`8HߋkqHt HY HtqZ[]Ék1f.AVIAUIATUHSH HIHtLLHhfHnfH:"A$[L]A\A]A^ff.AWAVAUATUSHHP=p{`DsMMHHDk`DE1AEAHApa{`&HpHu_Hs LDsIHxMcM9|aHVPDEZDHL[]A\A]A^A_H#HHtM9t,DsDJtI9JDIVAJMHt$HJ49IHWHt$Hff.UfHnSfH:"HHHLǾ HՉ)$Htfo $HhXH[]ff.AWIAVAUATUSH(P=pA`AOLL$jIHAsApA`Ew(KHHHD$Eo`1EE LnHubEwIw HIHMcL9gHfNLLLA@dAqAH([]A\A]A^A_LHHtH9\$t(H|EwHcNLMVAO {L\$H|$HLLH4HD$7H8H|$H@UISHQHH.LHHt1H9~HLHqHtHZ[]ff.{ff.UHwHdH]FDAWL=SH!AVfInAUfH:"ATUHHSHHjfLbHD$@D$XHD$`D$ )D$0L$HL$hHHIHLl$0H}L,H} qÃwMH}H`pAăIKHT$h1LH ADt$ H5]IAH|$PD1IL?1HھEHcwHL<+HĈH[]A\A]A^A_AMLqfHD$@D$XHD$`ID$ Mf)D$0T$HT$hPHALKmHT$R1jjDH HH}Ht$PDD1AH}Ht$ 6@AT1IU1SHHPHHHLuwCHI{CHT$H4$JH2Hx'HcIH|$tHpHPL[]A\à fE1fDAWAVAAUIATUHSHH9HFvIHLDH!LIċD$ &LH?|$ u`HL[]A\A]A^A_ÄtH5#IH>G|$ ;ff.@AVHؙH=~AUfHnfHnATfH:"UHHH~fH:"HHfHDŽ$DŽ$HDŽ$HD$@D$XHD$`D$ D$)$$$)D$0T$HT$hHlHbIHVL$H}LzLd$0H}LaIL$T$ LLA&IL'L'HL]A\A]A^ÐAWEH^AVL5lLDAUAAǃATAAUHE ASAQEHDEɃHN8HW8EEH51H= mH{ t H}H{IEhHu H{ m ALE%HHZ[]A\A]A^A_fAW1AVIAUIATUSHXL|$ HL$Ht$DLHT$LLD$@HD$(MHtHT$HMLD$<H êLH@uMHLL93LC@\uM9DKLcEQAnAHcHHHD$Eo`1Ek LaHEwIw HIHMcL9HALLLA[WAHH LjaA`A~AH(H[]A\A]A^A_LIHWH9\$t(LDEwH(NTM^AODHT$HLD$HHH4HD$*HLD$H1AWAVAUATUSHH(P=p{`HT$HHD$`*k9kHsHc̓{`HWHD$(IAYAZHLt$HLRH(L[]A\A]A^A_Ã{`Dk EQDAp DsD;s HCMcJDjDbHHHH;YH HD$HH蹳IHi1HH5蜎PsH{OIH DX It$ELDHs ASL$sHD$(IA[A\HL {`Ds H]Ht&H$IHtH]H${`Ds4 H]HtyH{`IuhHx]HtVsH{NH D@DH VLs DDd_AXH Lt${`Ds% H]HHA{`Iut H\HtbsH{NH DH D@PDs DLZYHs LH"WH DADkHD$USHQP=p{ {` Hߋk\Hu#{`kh H[HJ yZ[]ff.UHSHQH6-D HsHu Z[]H, AWMAVIAUMATUHSHHHG> LaD$ @TIt$H$,@ HUL$jTM AN,H1QAv(LVEN$LEF rx^_ A>LEA  A|$EHL 1H=/1IH HMLHAdDI\DAXPDY`AS5ZYU L3HUHJPI4$+HME1aPMd$IcM6 I<$H9AMcL;MLHs+ H]Dl$ HD{HAAE D{HH[]A\A]A^A_yA t; AEGL6ItHD$*^ D$A6ALH*Lr LMNtHAIPI6* LUHAbPIvABT* HEIN1hTLcH HI9|A~ At$ JtHH $7*| t$ H $ ff.fATUSHH8蠹H HHCHHxdHI1L[]A\Ðff.AWIAVEAUAATAUDSHHHWHz8u$1HT$HL$HA8HCHx82 H{8LHHtVEADDH=T 1IHHsH~8HL=11H[]A\A]A^A_fSfAnfnfHnfA:"fH:"H f:"L$0flHHH|$80H)$)D$膷Htfo$fod$ HXX` H [ff.ATIUHSHHHt HՅu H{Hu1[]A\[LH]A\DUHSQHWz@)Z[]AVAUIATIUS CSID$A|$ %I9I9&I\$ImHH)H9AE H|@t]ED$ AA@tgD9ABIHt+E1I1L1HE1I1LHL}[L]A\A]A^Ã<<EAAAAAEErL/HPH5b1E1I;>AVIAUATIUSHWH.LmE1IHCH9}It>tiHIEu"IV8\LHn1H9} It>tyLRH۸[]A\A]A^EH=HH)HI~8L^LxnABHvf.BAWAVAUATUSQH 2HH9OmHH9N`HvpHpAԺt6U9Su.u9su&}9{uDED9CuDM$D9K$u DU(D9S(t%A L-PIEZL[]A\A]A^A_Hu0H{0"AƅH{8hIHH}8hIHHLLA,L,EHu@H{@AƅzHuHH{HAƅ]HuPH{PuAƅ@HuXH{XXAƅ#AL-ġAWIAVMAUATUSHHHHGHW8LL$D(H A  DaHI~HٺDC AH<$LAzIw8oC Lf~AXHEu{:1ҍufLk`P11LULL$`LLD$LZY6MO8SLA*uLuMW8LIMrIEtM1LLL舘zL*L*L,$LIuNIW8A}&DL膓tqIO8LjtLtH[]A\A]A^A_VL11jLL$`LLD$&_AX/d_ UfAWLcAVIIAUIATUSH8JH8T$xL$ LD$LL$MI~8IMI~8H$MI~8HwMHMSH<$HH?H6|$O|I~81Ҿ|HGPLi=I~8Hھ]D$ LOpMaLgpé LHI7LMMWMt!E1MHHLMM9HHՋT$LcM;}|$pHt$LLQMn8T$ LAHchXI~8L<$L_pM{LpHGpHhHopMLq٨Mv8MfpI\$I^pH8[]A\A]A^A_e|$pHt$LLMN8VLAMV8LA袐;]|$p4|$psHt$LK2Ht$LKIv8|$ HcLgHKLLD$(HT$ Jt1JL HLD$(HT$ IIwLJ~Iv8LD蟏bZPD$xLLPLL$(LD$ L$sZY1M;}I~8 Ht$LyJ IN8DD$ LAIcfAWAVIAUI)IATLIUHSHHLt$MHIHFIM9JTHtp:ukIIt$L{HJ4I}I|$J4HIdI~%LE8HAeHL9|I&H]8HT$Hi{e@@H[]A\A]A^A_I~HM81ҾiHCeuIM9} MT$HKtHIH|$x&IHHpL9} I|$HLDHMHILNLH\UL8$HU8HHT$df.AWAVIAUATIUHSHAPL=IAHtL-HLHLHLIHt9HULMLEL=L51H[]A\A]A^A_fHH9UHLLLH|$ D$ ]D$ AUATUSH(H?MHGHH5SbH(HuKHH\HHHHHHH([]A\A]H5aH1tL$@HLdMIHL(/HIEHHt&HH)HHHdH[ifATHhHIH5d[O[HH1LYA\fQ*tHHIZH=,@ATHgHUfHnL LLSfH:"fInHH H=fInLL{fHnHϾHH!H5fHnfI:")$fI:"L%fHn)\$0HKH fH:")d$@LLjfH:")L$LfHnfI:"L%fHnHXH5L$fMnfMnH=L%٭L j)T$ IfH:"fH:"fL:")l$P1fM:")t$`)|$pD)$D)$I4HׇKHHu1Hİ[]A\H=*@U1H56HSQH_ ؁HCHHHpH51H见HHHH@H51HwHCHHHZ[]11 H=4*@H?ATUSH9UIHHHt-L.H1H9HH)ʃHHHtjHtHHt&HHt A@@0HHt A@g@0HHt A@K@0HHt A@/@0HHt A@@0HHt A@H@pH9Hyt;HA@H@0L@t LA@HO@0Ht A@HOApI@t A@xzHOApI@t A@xaHOApI@t A@xHHOApI@t A@x/HOApI@t A@xI@@pH9[]A\A?HAɀ@pDHHt A@xH@p+fDUHH=SHQkHH+IؾHHHTxHuZ[]H&1fATHH5UHHEfHnSH HfHnfH:"fH:"1H0H=A~ )$IH=fH:")L$)T$ I4H螃6HHu1H0[]A\ÐATUHSLg HI|$Ht HӅu*I<$Ht HӅuI|$1Ht HH[]A\[]A\USHPHoHGkHkZ[]ÐHHWHAHH H HALOLFAM LOI8H~H7fDUHSHQHH~HuHH8}Z1[]f.P1ZfDATUPHL8wZ]LA\fATIUHSHHHt HՅuH{H+[LH]A\ATIUHSHHHuIH}Ht LӅu&H} Ht LӅuH}0Hu'H}(1Hu[]A\LH[]A\HӅtLӅtff.HHHHff.SHgHhHtHǃhHHtJHpHu HXHtHǃX1[Hǃpff.HH|$ t |$ uHAWfAVAUATUSHhHGXHW`GXHOhHGhHD$ HT$HL$H6AHL$HT$HHt$ H|$uHHH\$L|$Lt$LLLd$ fInfI:") $MEtELH=_+LH=_LH=_H=_IHPLH2MAVMH5H1胿ZYxufo$Lt$P)T$@HT$@E1LHǹqHH` LX H|$HtI H|$HfHh[]A\A]A^A_( Efff.AUIATUHSHQuY{ DCLc$L)EL1袼HHHuMC { LktWHC$HZ[]A\A]HйHHHHH)HL9|I)z{LX LLHL+{IE tvH;E*LO LHL)9g,VUHH Ht$HT$H|$HPHHT$Ht$H|$<HLHHt HHt HPHt HXHH`HHhHuoHHPHtH H`Ht7 HXHuAFI6MtL;=tH5LauH5LNu1H=ȥHtH3H=HtHBLDt$ LDzDHA8H=eHtHUH=1HtGHG>L?I|$e|$L%GAPL I9EI<$I4$L)*I8HھI8HLLGpMpILwpLVIt$HkMO8LAmjDT$ HUAMcHHI9u7LeE1IcMzI4$H9}1ItLFLcADHLMg8WLADŽ$RmMw8LAnxoE8A,Io8L mI8Ln褄I81LGpIXH_pLlL9I_8L{pMoLkpH[]A\A]A^A_L'UPKFAWAVAUATUHH=ASHHyL8UH=IFMIHHIHHL_HHIXHzHL1I9tPLHHHH;fHH;tLH2skLHsLyILHH[]A\A]A^A_8DGuAVL5AUATUHSXLcIxGHUJ *Ht1L!HQHqI$L'HHLI[H]A\A]A^nAUATUHSHRLnHMeL9uLcHHHKHfH}I]MX[]A\A]fDAQHwH8HHHuH kxHPHuH[xH0HH=1AXSff.@UH5(xH9XHE8Hi9HU8HiHM8HA@@]fATH='TUSHLH=TH=HHtKH;-~wtBHAąu3H=SHt$Hl$H HH E1HtFH;+wt=HAu1H=FSHt$H\$HHHIHD[]A\HH vHH9tHtHpHtHfDUHSVH8Q#HH}8H¾sHHTHHE8wH?HM8HHQpHZHYpgHu8HgcH}8HgDLE8YHAg$LM8HAY[]sgAUIATIQ`LPLL1fIHtHLIMLZA\A]ff.@H;=)utALOAtPH5uLcAAHiI9E ZøUH5 SQ[HCHHM H21Z[]AWL E1AVAUATIUSH(Ho1L9~KDL9HH=qf.ATSHQhH8,tFHGxx[H{h1t;HHCpDHCpH{hILZ[A\c t;Hub%@SHwHtQH*{ u HMrH[H{Pt3HCHH$Hs@H)ƺHHCPHu1[1{$tH{`tff.SHH$t HW`HuHqfo $HCXH[HwXH9tHGHH@HH)HH)HH9}H)HHs8蛂Ht)HcHCXHCXHCHx HS`HsX1QHzHqHpH9GuZ1ZAWAVAUATUSQH>pH8H]t!0L}hLmXfHǃ0Lu`HEhEXLLLHIbǃ0ZL[]A\A]A^A_fUHHHtH}Ht HEH]H@f.ff.HBAVAUATIUHSHHBHM,$L{E1E1H{8{,HH{H5 nHH5jLH6HHAw"{ tLK0IjLSPIH{h1cw6{$HCptH4HH@AHDHHHHCH1IH{ tHCPHCpH{h[L]A\A]A^H{zI|$]"Aă${.AƃH{@MI)MEuRHCHHH)IIM)MHHL9M9N4L)Ls@L[L]A\A]A^CICHjE1"E1 HAT1SHHH|$H=vHt$TIHtH;kH9uHRHL[A\H= @AUATAUSHHQHtIcH;8IHH{E1HHH51dWHILMt5H hLH0*LHH'Hk0ZH[]A\A]HATUHSH_ H=iHH1H51HaHCHHHDg1H5SH{aIHHHgL1H5HCaHCH1H5H%aHHC[]A\fDAUHBATIUHSHHH{HM,$~6I|$ƒ}uHLH1[]A\A]f.SH@,HH)@,u.HHH,n.u[fK{@f ff.@SH`1u3[ff.fSH3u[H3HG H3HG 3fAWAVAUATUSHXHGH|$(LXHD$ MXhT$ sHL$ L=VjH5JOHpL=Ld$ Dt$ H-<H5aXHEI$hHuL|HuHHuLt$ L%HD<H-{|$ LKIhL?HHHIhL%LcHMu1xIHH=eI9}HT$HHL$@HD$8HT$H\$8HL$LL$HH5eIy5|$ HMt[H|$H1HHHt$@H¿1 IHHLdPLH|Ht$@LLHL$HT$HLvCL dM9ML>Ll$(MuIpIHHXIpIHIpHH|$(tHt$ x@ uL8Mt MPM9MML$HMidI|$NIC MsHhH}~DL9t?H HT$ H;pt)H;ht HE|$ H"H/IMyL|$ LL|$ Ih!Lt$ 1Ip!I`Ll$ ufHI`HWH9}AHwLH5cIzB3tLHtHx HtH@ 11LD$ IXIǀX\H|$(HX[]A\A]A^A_rff.@AVAUIպATUSH1H?qHmLt$HILLHHHt=Ht$LSHH]L9l$8LHHHHHH[]A\A]A^H(HF~ 8H;cHt$uHH|$5HD$H(-fDUHN5H}(ueHEHu7H}HtH}0HtH} Hu0HMH]L@AHP`HtHx8~H} tH*H.ff.PzZHc鱉APHcHxY雉1ZAWAVAUATUHSHHHt$Lt$E11HHH5دH=ȞM~ LLHI(LI͛Mu:38CLH^HH8HL[]A\A]A^A_LL莶11zyDAVHBAUIATUSHH HH.HIIPIHM0M'L5ULLL_L9UL6H\$HLD$HH&H5L\$6AHH'E< 1< )HQHILLQH|$H$H []A\A]A^LfHuBH bI9IT$ ]MT!LLH&LkH VbI9tL9H\I9FIt$ 1HH5UH= ɍHMPHy>H LLH[]A\A]A^8!ff.H aSH8HYH{[WSH_0u(A11Ҿǃ04ǃ0[SHHt2H{HGHW@ǀXHX-HG1[fAWIAVAUATUSH(P=pA`QA_A9_YLoMWLcA`OEcEkDd$Dl$ L\HHEAFAApA`EgIHHD$E1A`LHHYEgMXL,AA`A_uhL豽HHt LHdA`A_L|HHtQAAH(H[]A\A]A^A_A1IwHcH<΋oDGl$DD$ A_AAG`1USHQP=pW{`= HߋkFHuk1qZ[]H衼Huf.ATSHQHGHt2HPXHt)Hx8~H tHA<4HEuH{HHCE1!DZ[A\fAWAVAUATUHSQ-Hv]H;BHD%EHEHU@H A EXHXH}P`;ddH}P6ZD[]A\A]A^A_HG HxHtRH@E1Y1ff.AWAVAUATIUSQP=pA|$`yEt$IH=1A|$`AtI9Et$IHLHHuEt$HEl$`EIt$ HIHu7I4MFAI4IcH9|LA$A$LZ[]A\A]A^A_MLJ4IHIDLE1lA$ff.@AVAAUIATIUSHH1HLVLDHLAŅ[D]A\A]A^fDATIUSHo HH}Ht HӅu=H}Ht LӅu5H}Ht LӅuH}HLH[]A\qlg@ATUSHP=pX{`=HߋkIHt) HU HtL[]A\Ã{`ku0HIHukE1Ⱥ H޿8uff.ATUHQ4ͯH&YD EDZ]A\f.ff.AVAUATUSHP=p{`DsD9sHsIcHHIcLLI ZL[]A\A]A^A_ff.ATfHnUfH:"HSHH) $]4IHtM fHnI$Hfo$H I\$HID$0AD$A$HHL[]A\ff.AVAUL-ATIUSLwLHL9tAH I9 t!Ls$HtH8Ht HHu[1]A\A]A^H{uH[LH]A\A]A^LHff.fAWAVAUATUSHHP=p{`Dc]HH[Ds`E1AE4HHHuMDcHs LpIHIcL9|=HHL[]A\A]A^A_M9t#JLDcILDML$AMMHHL$J4NIHiHL$HATUHPLgHA$@ZL]A\fAWIAVAUATUSH(P=p{A`8LA_Hu~A`A_&LHVA`A_L(HAA_E E1AEH(L[]A\A]A^A_LHHnAqApA`EwH_Mf(HuL9HELhIUH9uCh1H5H1KyH8IIDžH=@L%ӊL&Hy0Md$8HA8HtHA0 LMuHcEH]HOHwH4@H4HuH4HtHǃ4H.H2HI;^(uH=HtHӋvHH=HH=HHH-dUFI;^(tH}0Ht HE0H8H}uI;^(L=`MtwHD$Ll$Ld$Hl$$H|$w @*LMHg LLLHLJuL訃H=HtH|H$)HH8')uHH&HtHǃH&4H謊H@&HtHǃ@&1 HHt H+HtHDŽ+HHtHǃI;^(u HH%E1wH&Hǃ%ǃ&vL(&Hǃ&ǃ&KHP6HCHX6HHH`6HMHh6HRHp6HWHx6H\H6HaH6HfH6HkH6HpH6HuH6HzH6HH6HH6HH6HH6HH6HH6HH6HH6HH6HH7HH7HH7HH7HH 7HH(7HH07HH87HH@7HHH7HHP7HHX7HH`7HHh7HHp7HHx7HH7HH7HH7H H7HH7HH7HH7HH7H$H7H)H7H.H7H3H7H8H7H=H7HBH7HGH7HLH8HQH8HVH8H[H8H`H 8HeH(8HjH08HoH88HtH@8HyHH8H~HP8HHX8HH`8HHh8HHp8HHx8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH8HH9HH9HH9HH9HH 9HH(9H H09HH89HH@9HHH9HHP9H#HX9H(H`9H-Hh9H2Hp9H7Hx9H<H9HAH9HFH9HKH9HPH9HUH9HZH9H_H9HdH9HiH9HnH9HsH9HxH9H}H9HH9HH9HH:HH:HH:HH:HH :HH(:HH0:HH8:HH@:HHH:HHP:HHX:HH`:HHh:HHp:HHx:HH:HH:HH:HH:HH:HH:HH:HH:HH:H H:HH:HH:HH:HH:H"H:H'H:H,H;H1H;H6H;H;H;H@H ;HEH(;HJH0;HOH8;HTH@;HYHH;H^HP;HcHX;HhH`;HmHh;HrH ǃ4HtHǃ H HtHǃ βH HtHǃ 貲H H LHǃ 'H8HtHǃ8kH@HtHǃ@OH(H;X(YHhBpHp6pHhHtHǃh HpH HǃpZ[]A\A]H{I}jI}Hm@kHǃ 4諱Hǃ(4薱Hǃ04聱Hǃ84lHǃ@4WHǃH4BHǃP4-HǃX4Hǃ`4Hǃh4Hǃp4ٰHǃx4İHǃ4诰Hǃ4蚰Hǃ4腰Hǃ4pHǃ4[Hǃ4FHǃ41Hǃ4Hǃ4Hǃ4Hǃ4ݯHǃ4ȯHǃ4賯Hǃ4螯Hǃ4良Hǃ4tHǃ5_zHǃ5JuHǃ55pHǃ5 kHǃ 5 fHǃ(5aHǃ05\Hǃ85̮WHǃ@5跮RHǃH5袮MHǃP5荮HHǃX5xCHǃ`5c>Hǃh5N9Hǃp594Hǃx5$/Hǃ5*Hǃ5%Hǃ5 Hǃ5ЭHǃ5軭Hǃ5覭Hǃ5葭 Hǃ5|Hǃ5gHǃ5RHǃ5=Hǃ5(Hǃ5Hǃ5Hǃ5Hǃ5ԬHǃ6迬Hǃ6説Hǃ6蕬Hǃ6耬Hǃ 6kHǃ(6VHǃ06AHǃ86,Hǃ@6HǃH6HǃP6HǃX6ثHǃ`6ëHǃh6讫Hǃp6虫Hǃx6脫Hǃ6oHǃ6ZHǃ6EHǃ60{Hǃ6vHǃ6qHǃ6lHǃ6ܪgHǃ6ǪbHǃ6貪]Hǃ6蝪XHǃ6航SHǃ6sNHǃ6^IHǃ6IDHǃ64?Hǃ7:Hǃ7 5Hǃ70Hǃ7+Hǃ 7˩&Hǃ(7趩!Hǃ07衩Hǃ87茩Hǃ@7wHǃH7b HǃP7MHǃX78Hǃ`7#Hǃh7Hǃp7Hǃx7Hǃ7ϨHǃ7躨Hǃ7襨Hǃ7萨Hǃ7{Hǃ7fHǃ7QHǃ7 Ht$ uLT$ Ht$8H=HLT$8woHH\vyMrUSHQHGhHHHHiH{XHH{`H=H{hHвH{pHt HCpH{xHԲHH_H{HfC8HH{PH+HHHHHHuLMt HZ[]AX[]HǃKHǃ9@AWAVAUATUSHHP=p{`mHDcHHuG{`Dc/H\HHuHDc1~H[]A\A]A^A_þH#HHtHH1kHxHT$HLk0L|$L4$I}HtLLhtIH}gJHHHôHH}MUDM DEPs 8ZYH,-ff.AUATUHoIHH5yA&HHFALtHÉIMRLHLI聙HyMLh1]A\A] IfDSHSHGHH H>HuqjI1L;Cݰ[HK1H [DAWAVAUATIUSHHF~ HC{DkEH H9S HHyH{0I${\M|$t H{P>{X4E1{YAHChHqAD$ @HsI9t$H= L ~.H9AL9AEuL$L9I$LCpLHL9HLeHKHHLH9H5 H9wHaJH聗HLHH;{E H{xHCxH1HHǃHH[8HuSHL[]A\A]A^A_q1HTHHH谥HAEG߯H=.HH$HiHHw裖zHǃH_H~fH:"HhMHLHHNHU[î1AL LHE1{YAƀ{XIL$1AL E1HAvHҷETLs H=.H1HL4$n@HHtU聕{\t LCPME1{YAE1{XAHHVH5EfH=ѤH1[]A\A]A^A_H(H韮f.AUATUSHPP=p{`DkAIAAp] H!H{`DcHH{`Dc{HٺHuf{`kBHHu{`kHH>kE1DADLZ[]A\A]ÃHOIHt霭fU1SHR9k CX[]H;HcH<tdff.@ATUQH^HIMHHuLHǺaHA6DZ]A\ff.USHQP=pL{`a HߋkvHu"{`k1HWHuk~Z[]ff.ATLfUHSHt*Mt#IH}@HCHHE@H1[]A\fU?HoH5H\خH5NH[]fHt7)D$P)L$`)T$p)$)$)$)$)$H$LT$ $0D$0HD$LT$HtHItIIAS$1HfAWIAVIAUATULSHH(G`HD$`Ll$hHt$LD$H$IH{< XH<$L aIHѭLAzޭ{<McM9IrI:H9H)H3IMs{< L I tLLWIHL I PLLULL$MH=n1ZYIHH¿1L_LI$MH|$LNLL{< H(1[]A\A]A^A_HLWHVLcC\M)L)#H<$aHx IyHIf-stringf@: H<$LHD$`LL$H4$HIy L $CD! HH<$ŕ_I I D IMLC@AWHBAVAUATUHSHHHHHL}HD$_L-,\LLHD$HL%LLHD$HH H8HT$Ht$jIHiHD$ HH|$LLHHHuZHHH_A1H.HH?HEIL1H5IH=kH|$(IHA_-L1HkH5n>HHL蕍L荍LS LLLT$0IHLPLHH5BH=zx1APM50ZYԫLhIHH|$(HL$HP Ht$0LIMLHIHD$8HHHqAH5wHL$8IHH#HI}HH5taH而HxLpLLpHD$ H|$QH|$GH|$HD$ HH[]A\A]A^A_L=iL9|$(L=HީLpLH5hL~Q<LHLH谯jHH踋L谋Ll$ KH|$蜋H|$蒋Lt$ M髩j饪@ff.UH"HEH]H@AVAUATUSH@HHޫHHT$(Ht$ H|$xHHuEHUHH DiLt$8Ld$0 <H]LLH赺 uHT$(Ht$ Hl$HH@H[]A\A]A^SHH?Hu$H{Ht HC H9uHCHC[K贐fff.UHH@Ht HE@H]ff.fAVAUATUHH(H3H83vu&H H: vH(]A\A]A^L5gHT$Ht$H|$nwLl$LyIHH=&I1LHgH7HOL\H|$HtMMtL@H|$Hj鄪ff.fHHGl pHGHH(H|$HHt$vH=_Ht1H=Ht$HD$H[HHs蘈H=l_Ht1H=Ht$HD$HW[HH;VH$Ht$H|$H(鯃ff.@AW1AVIֺAUHIATUSHIvHH$Ld$0HLHHH;1HgCHBH{1L<CL˩IL$L$II]H|$0L$L\$@I9AM4M} MI H$LHLL|$vLL$HuCLk IH$tHH|$8tLHL[]A\A]A^A_HD$ IH1LL$H)6HLl$HD$Hx Hl$LLd$IHLLt$ IM)M~2H$HLLyHtLLHHIIILLLd$L|$Hl$LL$LHLL<$E3DyHH1HD$H)5HHL $H@ Hl$DLl$H$Ld$LIM+LLIQHt HLLL)LpIIM)MLLLd$L<$Hl$L^M9I'L4$H|$HLLD$E6L<$D/QHIHD$ H1LL$D(4IHL$LP HHT$LH\$H,$LL)IE*IIzLHtHDH)PHWH,$IPL $H|$LHLL\$AL|$$xIHTHLT$H)HMZII9RM1I44H#LD$HD$Lh LIH\$Ld$Ld$Hl$LMLL)HL|$Ld$LLHl$4$HLHL$ OHL$ HtHI9HLLL)LpLHIH{IHHLH$dL$IxL$L$I]H|$0L $L\$@I9MOMI9~LCHH)HIL9LH|$1ILD$L\$H2IHL\$LD$MU LH L$LT$IIKLLMKLHBM9Ct5 HLI@pLLD(HxH$H|$HLLL\$L|$qLD$LL$HLT$HHMH)M)HHI9LHt$1LD$ LT$ItLL$1HH|$ L|$Lh Ld$Ld$Hl$LH\$HD$HL\$ Ht$ H)M2H$LHHt$(tHt$(HH LDLL9FHK,0LHIIH$H|$LHLLD$L|$tLL$LT$HIHD$H1L\$ LL$LT$HD$0IHL@ Ht$HHT$ LL\$Hl$ILHl$LLd$MILHHLH$LHH)sHtrH<LLLHIHL|$Ld$Hl$LL!LH=`#$E1LHLILd$Hl$HKE1MH4$MHMLLHHL)A:H@x ICM9}GL5 ID A:@yHE1MH4$MHILHff.AUATIUSQEHDhH;z(u EI$p;IpH}EHt HE~H]HEEH{Ht HC~HkHCCH}Ht HE~HEHk0C0H}Ht HE~~HEHkHCHH}Ht HEU~HEHk`C`H}Ht HE,~HEHkxCxH}Ht HE~HEHǃH}Ht HE}HEHL9H=谋ZD[]A\A]DHHH9WuHHwH N-ff.GfcfDAWAVIHAUIATIUH/HgTHǟL$1ILH[LMßHzLH8HJ8qRHHtLZHİ]A\A]A^A_ff.SfAnfnfHnfA:"fH:"H f:"L$0flHǠHHHՠH|$80)D$)$ Htfo$fod$HXX` H [DAU11ATIUSHHxHl$ HHL CH]>{H{h14-H{8HCpU{,;HSz={ tH{Pu{$DH{`9Lk@HsxHL$0L)H9\Lc8Ht$ MHHI$ID$LDHHMD I)LL)HHLk@HL$0{$t H{`LkXI̓{ ILk@L;k`~Lk`LJUIHCpH{h64H|$(tHF HxL[]A\A]HtDE$kD\fE\ Lk@HL$0ZHWL H5XE1I9jfC@HS@H9SX&HsPH'I9頠H-IHҞHy{ t H{Pz{$t H{`iLl$0E1L;kx^{ tHCPM~Ht$ H{8LLM{ HCXLk`Lk@t LKPM9 HCHItHT$0Ht$ HL)LHHII)D]>A<$DLEL Lk@HL$0H!!~@ATUHSHLf MHEH{@HHC@HşIH} ~HHpfHshH{`C`HKPHSHVLKpLCXWH5VH1@ZYYHSHHKPLCXLKpLS`HHIIMtIL[hMtIHwH{`t H{h1[]A\ff.{ff.1IfAWHAAAVAUIH1ATUSHHxHl$ HkH*IHoOHt$II~C1LH4$AH=fI:")D$!HAD$ HthLwH;-,tvH;HH2hHIvMM9MtHK0HtLHK0HxL[]A\A]A^A_IH4$KLIvff.@AWIAVAAUATU1S1AP>$IHHIH(HHFHH?OHUL$Eu"HIHV(ZL[]A\A]A^A_6fAUATIUSHQHtHYH9WHsHu]H{HHtGHHIuI=1H[ LA$0Ht LhHHXZ[]A\A]fUHFH]H{ff.UHSRHH;x(uH_HH}Hǃ@XH[]GAWAVAUATIUHSHHH1HIIH'HLQHE@t(HCHIXZHMHD$LctHu@H=cHEH?TLMHLL$-#IHt H;NbHT$0H5,HÅNH|$0sH5HHD$ HH5\HIHH;H5H|IHLLHH$ysHkH5HAIHH;~ HpLHHD$0sHآLML9]H5\HIHH;!]HLHHD$(rH-H5HIHH;HLHrHH5HWIHtH;HVrH$1LH=QLH6rHtHLAHrHt$8LHL$(H9 $|HtHt$8HH9HOH|$E1HLII95H)H$LH\$IHHHM wMIMAHBIHt | uIL9IO۾ HL\$HL\$Ht H)H9/LH=QL\$L5tLHHD$HQ| MHLHH-PedH1H-OH;$ΚLHH8麟鵠͠QHBHFHǾZ ff.AUATUHSHQH/H~qH}KÃYHHH5JOL8LhHH1!Ρ~UHtdHHIoLH\H5NL8H7L?hHH1!xHZH[]A\A]鐡W?tSHH[fDSH!_tFu-1u1Ht$ HH)H HuD$H[ÅuuDtHHH8A؉A@A@D  HH5H;胏˙fUHSRH_H}HH}PHt HEPH01(H{&HC HS H+H9eHxGHH H9C(uH{ HC(H{'H}0HXH[]b 1PfDHGHtHfUHGAHHPH0EH H] AUATUSQHLgHM۠Ml$HI}%HHCHu?ID$HtHI}&H}t,HH&H9uZH[1]A\A]"HBHCX[]A\A]ff.fAWAVAUATUSQH~BH^HHIE1E1H@HSH9H,1H0IHt_HXLHHMIH Mu}ID$MugHt/H}ܟHEIl$ LZL[]A\A]A^A_KID$ I|$ ußH{(ML{Ls H[HLL$J HLLJ LHuI LLq?fHF8H?ff.UHHH賷H]H7OH*AWAVAUATUSHXHt$DD$LL$HD$@HD$8H9ĝH4IIII##IHHT$8HE1HT$ Mn@@uII9~]LIC4fI\$fvہvk(vwA?IA ?πA΀EAAq@}I9H|$@HH|$8HHXL[]A\A]A^A_?IπAq@}볃|$uH|$LL$((JLL$(D$L9}E^fA(fAdD$E1L9AÃE_OH&Hc4HHE1L)I9H,IOLI+L9~G fEAAHIDELLH9~EnHHDEAA A?AAʀ?DYʀDQQMHT$ILI)LLORM_HHUH|$@HtgH|$8HgE1LHT$ILH)LH,vIoLHHHٸ?LL)HHwHt$@PH HHHAWMAVIAUATIUSHH8H H;=KHT$;HHH&ˍHIHHLIHtoH{H;=uXILHH{H;=ʴIMEI$HD$HH0M&I/p=Lh=1H8[]A\A]A^A_頎ff.fATUSHQHHI1LSH8t A MI)DDHBM~@t t HA9tD)[]A\ff.HGHP`HH֏ܣff.USQH-HH*HH8HøH9uZ[]H'H1HɲHL8HtHNtH1LPaHE11L@PH50HPLH6F^1ZfATSHAPHaIHw H8HJH; uHLY[A\LIHtH{HʲLH;ILZ[A\@AVAUIATUHSHBH;B ݎHPlHUIuHHHHHLqEDK<6IHAuHH~cHE1GM9~.C\HIFH6GdDHAu[]A\A]A^ILSHHHFH;F LHHHKHsH;s ZH~H{6H[AWAVAUATUHHSHHHHHHH}L}eD$LmIUH}XVIHHLIH$9IeHM HqHL$ H}(LGH|$AgLK ImI9HIHfH@@H@0HhP@ HI1AtyItIIt!M]I;>AD$XH9@IEH<>AADXHL9IMHADXH9HH9I}HAADXL9֌MMLsK<>ACDXL9`M]LsK<=CDXH9IELsJ<=CDXH9rHH9qLXHL;=B^Hl$`HL$$LHD$`IT$HHt$(I$OHH|$`Ht$IH$M|$0D|$H~I\$E|$8fMD$PH$I|$XN HL9AyIq[sHĸL[]A\A]A^A_HrH|$HIt$ H~HI|$(wOC@AWAVAUATUSH(H9:L$HHIID$L-EII "H$H9 HCw1McLMAH([]A\A]A^A_HH9H뻍q HLuLtH9֓DHL9wLXHT$H9II)L؉T$HH9LCH4LLD$#œ\$HL$DSB<sHT$H 1%H94DHL;$H9IDI)IM9ϒL[K\L9ŒHHpH9Hx H9HxAAAAAA~@tmH9LPHL9HxHAH)HI9}N ILI)IM9WE1IB9LcD9wL@JH9H92HDH)HDT$I9HH9HXpH9HX ;pJtHHT$*ۑT$BH H9DHL9ʏH9DXII)A{IL9EHxHT$JtD\$HT$t$t`m~HHE1H9ACD-H|0HsHT$A{HT$x5FL L9ݍHEL)HD\$I9IYK4Ht$HT$WD<韍fDATUHRLgP=H@HHA$@XL]A\0fDSHH Hu#H{(Hu)H{0Ht HC0d01[HC S0HC(D0fHFYHG Ht$HH=^HD$Hff.@IAV1AUIATUH͹4SHHH~H?L9 HIMx2HHfvHHT$LHt$LC(HC(FHt$A~HHLD$L9IOMLT$M9MOLc$fnHCfHnHǃfI:"LfA:"f֋HMHLHKHCIELk SxHL[]A\A]A^ÅfL-ҡH5vI}ZOH4Lk(HǃMtH{(E1H-H5vH}OuKuLff.USQHH;>HHHHHHHH=zHHHH1Z[]@SH(HuXH{ HtH/t@HHt3HǃHf3Hǃ[HGP0H(fSHHHt3Hǃf[AUATUHSQHSH]HI>HHH)HHH9ܓH|IHH}MLE('M "EA"A'DIM9r1A HALMuL-(LIIACAEuA3HH}AH}(1UD/A'HA\>A A A EAs@^w?DHHH9|DHrLB)L)}LH)IZL[]A\A]L mDf\xAHME, DjIFDZLH=$\x00Hjf\tH\f\rHNf\nH@ff.AVH WAUATUSHHHH0HD$P1HT$RH" LL$0LD$80_ZY1H|$(H5=HHL` MH|$ H;=H5H6EHHHԑL-dH=ELE IH1H0HM$DD$fHnLh8LL$(LpHfM\$H\$D@@@ILHXH@PH@hHh`ILPpILXxHHH0[]A\A]A^L-HK@ATIUHSHHHH(H}G}HH[]A\xG@AWMIAVAUATUSH8I)nHIIEu MWIIzA6IcAI@A CTIH\=H8uMjHAKAIL 8HAKAIL 8uMjHt|AKAIL 8uMjHt]AKAIL 8Ht>K LD$MrH $L$LHALAIL 8MDIsLD$HI?WL<$1E1:3t\L3IIMAuLHI9}EtIH8L[]A\A]A^A_E^Et鏐Mj1Lt5E< E8<tH9tlL3IIMAtLHH9MjuAtZE1E1Au ԏII9cA;B8|uIM9uJEtI=IL9$$/HAH8H[]A\A]A^A_ff.PHZHcff.USHH-HHHAH8H9tH[]H[]HGH H@ff.AUIATIHUSH8HHHHMHnI,$HHMHHt$AHHHH;D$ HuS1HLOH8[]A\A]HYHRLE1LϦHT$(R1jj$H IHY釐I|$HwHt$詜H^HHD$#H;D$ӏHT$H`H-tTff.AUIATIH5ϱUHSARH_HHHMt$M̐AYL[LHE1]1A\A]7vL%pff.HBATIUHSHHHHuH4[L]A\ HUDAWIAVIAUATUSH8藱IHH4H9Xu*Hxu#IGH9ZH;ÕH;txL茨IHcI9\$t%LLH7H\#L̩HHu/pHL.#H8L[]A\A]A^A_IkGLHD$(HHH@HHHHH?)HЏLl$(Hl$H\$ HHLLwHT$Ht$ LL8tzLHH/LLHHAZ"EyIkG@HD$ HHHLHHHLI?D)HӎLL$Ll$(LL$Hl$H\$ LD$LHHL!HT$Ht$LL8tnQfDHAUIATI?IUHSHAPHuf11 IHtsIuH3HHBz]Hu ZL[]A\A]E1L9m~JJtL`5;I1ҹLH=>L'E1ff.@AU1ATIHֺUHHLl$PHLHHHI<$1L'CL&7I|$1HuyCH%Ht$H9t$`1IHt@LP E1GD IIuE1L;L$`} L$HT$PC B< IA:E1H|$XtL{H|$tHkHĠL]A\A]H H5i1E1H9`ff.ff.AWfHnfHnAVfH:"fH:"AUATUHSHH8H͕) $L8LNHwI9uXHv`H H=H9~xL%0E1L|$ LH5ΪL)D$ agL9t[H8[]A\A]A^A_II`HtHMH9QxuLF`MI9PxtML|$ fo$LH5L)T$ gLUL9StLEuI$LL%L+t.L%4LH)D$LzfoD$&L%FAL|$ fDSHGfH=ȔIHtH@HHHXL[ff.AWIAVIAUIATUSHHHHHT$ H8'IH|$ t4LMLLH'ILMRHL[]A\A]A^A_ff.LMtHWHwL(AUH5ATIUHLl$ L'H;HH͋|$ LHHIHL]A\A]HHWHB`Ht H@PHtPHRH5f1H H921Zff.Lh*f.AWIAVAUATIUHSH8HLo(IWHB`HHtwL5LI6m7HHD$MtHt$Lf1HH9]M l$1AlH8[]A\A]A^A_H; H\$ Lt$(LHL$HL>L\$H}LHLoIMlL9tI|$H5Ž^u`LVIt$DH=Lx~IHGHLHLD$ D$ "M|$MMd$(MtHt$(H;t$ IMH}0ߪMu1H|$Hy&IvHL$(HHHQH|$HT$ HHt$(H\$(/HWHH9HItL)IL H|$HHuM9|IH|$(H9L)Hϲ0E1Ht$(H;t$ .Ht$ L%VLCH\$(LD$ HD$I9E1HHT$ MLHPM9ňLT$(E1G< IG|LT$M9|1HVH) HIt=H)L)I|=Hu"eHueD$MtHt$LxtGH]I>H5e{9H=ԋH5}cH?]9AE1AHfSHHHt$ CHtH=w#AHD[eHtE1H^H5H88E1ff.@SIHH~LHtH)[H[ÉIHL9s8tHU1H0HHrHH=HHH1HsH1rH=3H1|sH0]UHHHSHHu;H~jH%HH1HH0uHNH[]HPHYHRAL HHT$R1jjH HuHAWAVIAUATIUSHH;5HLl$P1LHH|$`H\$PM1H$HD$M~1L3iIHuHx[HH(I~`IV(LD$IwMH9H3M1AIt{ItdItLIt4ItI%D B4 @4HDB<@<HDFDHD4F 3D H4D3DH<D;DHL9DF4D4DLB4 @tDDB<@|DTFD\DtF 3DLtD3DD|D;DTD\F4DtHL9wHt H|$P3Mu+HĨL[]A\A]A^A_DF4D1HE1H$Ht[F F IIuH4$E1M9~TB<IDŽ1HL蔡11L$GIIuMIIxHtAIMI)LL蔬鴄U1H0HHnH=R}H1oH0]fPH=ȉeZSH藯HtHHH[ÐSHHHZX -HtH+CH[Tff.@VHބHwHFhHt HHtYHVpHuH=f\HZH:t骄HIL L9s*HpQw IcveMI)IAH$HI9)LXLDL)H 1|D9HHuHBMI)IL9ȃHAWfHnfHnAVfH:"fH:"AUATUHSHH8HL8LNHwI9tXII`HV`HtKH=H9yhu>HуH9zhLt$ LH5L)D$ PYH8[]A\A]A^A_Hv`H/LML9FhL%̃E1Lt$ LH5*L)$)L$ Xfo$L9uf.APHHcYt@ff.SH_ H{Ht HC%H;Ht HH{Ht HC1[ff.AWAVAUIH~ATUSH(LVHlIBLHbHL)LwLIHoL;5HhIVvLlHHقH3IL9H<fInfH:"I)$L9H<IMSE1HGI9} OIE1L9tIM)OI1LA0H1H9fo $Lx @H@(HX0p8HH([]A\A]A^A_LIHtNI\$H HHZLPAL}LHL$Q1jj H HHl1HVH5H8.L 1jH=H5H?.AWAVAUATUSH8HG8LgLW L(HXH$Ho0IM(H[I?^IHLT$IH4IE(LMQ LT$H{Hl$ LuHH|$I4ILLLl$(IHL$LHT$MNH~INu5HT$HnH)L;t$IOHT$LL)HH*J IM)LHl$ OH$I3H7M I9}"KK|LTIOTI IH8L[]A\A]A^A_HPIHt,IE(L$1H9}M,OLIMLHLl$(AE8E1ILLT$LT$E1{DAWIAVAUATUSHHH|$HD$(H H1IwHHH9wHIHHI9HUIHxLa fHnIfI:")$HE1H9}&I|HIDIHHkLL9|ALl$1LA0Hfo $H@ @(HHH[]A\A]A^A_LDIMDIHHx:HHD$8HD$0R HH~HHL$0LD$(1Hk;~~Hk Hl$(Hw~E11LL= 1LfDUHSHHHM~HHH?HuHtH3HH[]I~ff.ATUSHH;~Hu!HtwH H9Ft []A\B[]A\lHtLHH=M~HH ~1H0IH}EH@c L[]A\H[f]A\dg@AUI1ATUH`Hl$HI}HtaLx IHtDHHt$賀HHt$MLL H֧HIgLMH`L]A\A]t3IuI} L MLHt$HHIH5 |Kub1HLu)Ht$ H|$Ht$IHx H?|IuLG{1E1HVI8H5DTFIuH|I}(Mff.UHgHHtH} HtH}HtHEH]H@ff.UHHHtyH}(HtkH} H} HEH]H@HR@ATIUHHl$H{LH|H]A\@AWMAVIAUIATI_UHSLHHuHLLHH[]A\A]A^A_I|$k HHR{HH1LA@_t%HLtP<_u݃0@ w Iރ0< v H=x11LLH5RH?HH[]A\A]A^A_LH9u@_tH)LH|$HH|$HX fDATHISHH9H ~uxHHH9vDL c~Cu1Ht$P&H9\$u(f.0zt cH[A\[RHt7zH=wLH5Q1H?1HfyHtwLH5QH811@ATUSHH D$yyt&H|$Ht$HHH9u1H []A\HHff.@AWAVAUATIUSH(HT$H} Hc~E @H]0H\$H]D$$H}Ll$`1HLLDŽ$|H|$H|H5 @DDD$H} o|DM A@oH$A Lus~L}0L\$`O7L$AC }@}IS0H\$(Ht$XHl$0HLl$8IL9<$v~A?DHB4eyLH1[]A\L;%tt>ID$HuyL#1LVH=wL#1L#1H=oH5J1H?L;fDAWIAVAUIHATAUSLH HQIE1E~!LpHAHHE9uLt] HHPHcHCLKH9UxH)HHPLAHD[]A\A]A^A_HI}XuALAOI}Xu*LnI3xEDH&JL1*E~-H;AHHpIH<HI9LLE1VHDL1L nH4JI0d*H-nLHulAąMOIwLCAąqwIIHuL1H+I*UHSHQ `wHGPHt3H+G@H9|H{@HH{8HtHk@Z[]H6rH1ff.AUATUHSHR<-tHIE1<+H5Lu3H5L|%u?H]X[]A\A]LgAI\$H5~HDu(Eu#&DI\$&I\$Lgj1t LqDHE E9t1ÐUHSQ vH_PHu1HUxHu8HH)HnRH~HfHnflEHZ[]DAVAUATIUHSHHHt HՅLkML9H{HHt LՅH{XHt LՅH{pHt LՅH{xHt LՅHHt LՅuqHH-u[LH]A\A]A^I~(MmHt LՅu1I~0Ht LՅuBI~H2LՅ%tttttttttff.fATIUHSHHHD$HtH~I<$Ht$)Rt}Ht$~ HH[]A\MttHG@ tHGHtHÃtHH5{鶄fDAWAVAUATUHSHQH8t,o{ tHS@HK8H{PHL4Ht`H)IHyKL L_HtGL)LHpIIHt LS@O\L[@ZL[]A\A]A^A_H9~tL4E1L9tH{h1Os"1HCpIHM{$tHHHsIII?HCPHIHSsH4EtH9LOH{8N 7IM9IAx uI)LLIH Hk@LLTH=؍L8QLH HCpH{h|LIHGxAsLL螥IHrHLTsLLc@HrL]IHHrI9:HL=TrL]HrH=L`PH+rqkrr@;Pff.G(uHG@u H`%DG(uHG@u Hc\7DPHgH59H8y1ZDHHwAH H$EDAWHAVIAUATUHSHHW Ht$AAA St@sLg0HAE H)ƉKHHCHCCHC DC((LXACrETA>A^A >oE11^HD$II)MArA -w(H HA<#AEEuFHD$AsA<0@@t)0=A>H{HD$L|$HKHLLsVLcȃMHD$H9tpArA<,=A<_HD$ArA<,6A<.LD$L)HquAqC,k(DcEH[]A\A]A^A_Ã;qE11A;fDSAHAHD$^HCHHHK LLHD$ZUHcЃH;pqApHIK I)HD$M)HCHD$EhII)MTDk(AxXpADAMAHIIH IuHxcAH;DH5@1ؾ1{HC_HD$H9eHKE1ҿHD$ EUA%KoA_wC`0HC,HD$H9n{_HbH5?H81"1{HAVAUIHATIUHLSDH HL$HT$HD$LD$HD$kLt$IVu4LD$HL$ALLHtnH Hc[]A\A]A^؋E1M9f~,KTLD$ALHL$Ht`uIHdHH []A\A]A^HdHH-bH}tINH}L1H5N?HI1f;Jff.AUI1ATIUHSH˹HhHRLl$LIRIr I9IHAtJMI)I9|GH9BLH)H9HLI)I9|-I<Gu L~Hh[]A\A]H)H9}L}11LLDL$ L${uEHt$HT$ DL$ L$UHAIHXMFIAMH4zATUSHuC.苶11H迲H;HC=tH4tH E1HCD[]A\É`s^vC.8_H+dH;HCsHs`tLH E1HK륃,u/.,HcH;HCsHusE1iHE1HSVATUHRLgHHt HELJ HXL]A\ff.AVI)HAUM)ATUSHH|$@Ld$HLl$PHl$XNLCHHHs1C AM ffHnfI:"HC(C8K f+-xHK(L4MI0=IM9MMMM)LKPMV1111HD$PAt$At$\H HC0HtffnUfn\$ HK(f8?f~UHC0IUH)L)HHLSI L SLk8MukLHHCHCHC@HCLH[]A\A]A^E1L-HC(AC|6+@{ I$IHsLCHHHrM$$E\$ A@qDMA9DBDMhHC0'-A-A HC(EEDS HC(C -wEEA>u HfnefAnmIf8?f~ewAunH+HLFnKHHLnDHHLmHHLmWH˾HLm'HHL[miHHLe,mGHHLFlBHoHL'lwHXHLl HAHL pl(H)HL AlHHL lHHL kH޽HLm kZHŽHLN kaHHL/ Vk5HHL 'kpHHL j`HoHL j\H]HL jHJHL kj H1HLu HLv-dFH%HLWcEH HL8cyHHLc/H߹HLqcJHǹHLBcHHLcRHHLbHHL~bCHiHL_bfHRHL@WbnH=HL!(bH(HLaHHLazHHLa<HHLla9HȸHL=a8HHLgaOHHLH`HHL)`HkHL `#HRHLR`kH;HL#`YH%HL_QHHL_%HHLo_xHHLPg_gH̷HL18_eHHL _tHHL^?HHL^ HvHL|^XH^HLM^VHHHLw^H2HLX]"HHL9]SHHL].HHLb]hHԶHL3]bHHL]_HHL\NHHL\ HHL`w\$HiHLAH\HWHL"\UH?HL[^H)HL[>HHL[;HHL][#HHL.[mHԵHLhZHµHLIZHHL*ZsHHL rZHHLCZAHgHLZ{HOHLY|H:HLYL=,}HLLmY~HHLNUYHHL/&YHHLXHѴHLXL5ĴHLLXL-HLLdXHHL5X}LHLs X_HdHLTWLHL9WLHLWH1]A\A]A^A_fAVIHAUIATAUAPfH_IcH IH_HHL_HLLrAH$LZD]A\A]A^HAH8HOH HOHSHHHHHHuH{ H`_H[H $HT$H $Ht$t>_ATIUHSHHHt HӅuI|$H_HH[]A\_fH@SH8HwHWHHJ0HHHuۃ[f.HG ^IL %HLL9O t$off.@AT10IHt#H@(f@&ID$HU^LA\DATIUHSHH_1HHHtXH|P[]A\I4$HtH KHy_AWAVAUIH@ATUSHHO HHcH|$1D$0H|$Ht$4H|$HD$诀IHD$,Lt$1A1H(HII`cI]cL9cE<$HILNHHuLHuH|$LzHH[]A\A]A^A_ cbff.ATIUHSHHHt HӅu-I|$Ht HӅuI|$ HcHH[]A\cbf.AUIATUHIHt,LHbID$HHbID$ L]A\A]ff.ATUSHHHoHHHE} /cE  @bH}0LE1E1M9~bB</AIEIEH[bHEH{PHH5=H9wHt$ Hs@HHbHH= 1IoIH~HL[]A\H{PHuH{@HaH[]A\oHH=H9WuHt$ Hs@HHza|aaaa#bff.@AUATUSH bG LoAAA @teH_0Iu Au[;]HT$H|$LLIAY>H9Hl$HHD$H :LL$LHIGHMI_ L)ML9IG( H}\M\iIH\HT$H|$LLIA.HV\Hl$HHD$H`qLHIGHI_ H\$LH)H;qIG( Hp[H(H[H]HA\1A]A^A_HEIoHIG HHIG(HEIoL IG IL IG(fATIUHAPLVLr3M9t L%~0M9uYHL]A\LLuLLuLLIHtHHLHILZ]A\ATHISHAPRK[HHLYH5L[A\韶ff.@HWHHt'QHN![H;VZHDHZHIHH;=Z2I[L1uaALH5uIEoFHHt7H@QXHSHH=$1HbHHSHHZ[]HsH>Y[]*f.HGHpH8N 6XG @t yH5ef.HHH>Hw0D:DHDNF DQHD^B<@yHDFF DIHDVFDYHtl~D:DAHtYDNF DQHtED^B<@yHt1DFF DIH tA FB<B<IL9uff.HWH H/HHGH|HH7HHHpHOH9rfHHG HL$PHVE1Ht E1H|$ADHAWAVAUIATIUHSAPHVHHt\IHt6H%HHVHHH5N{ǸHA Ex-HLL=HMtLZH[]A\A]A^A_rVDAWAVAUATUSHH~H(LVHRVIBLHHVE1HL7H5\H>IHOVH5\H#IH4VH5\HHHVLH5$IHUM MFM9M9@VM9VHLD$E1IHUL\$$MVAUKDHKDIM91MLIIHkHt$蓵LD$M9~Mu0H,HKDILfH(L[]A\A]A^A_Ik(HLD$H4/LVLD$HuHULD$M9UIU cULo_ff.UHSAPHHUHHH~jHHHH9lUH蹽IHtQLEE1HxMMI1I HLH9~#E1M9~JLJ IH^[]L@ZL[]H)H9EnHEIff.AUIATIUSHHH-H8}HTH~I}Ń1U1HT$TvTH %H9eIHL[]A\A]ff.ATUHRLgH(HtgH}0HtYHA$@XL]A\BfATI& TI$LA\HWHHTHzH+x郍AWIAVI)IAUO ?ATIUHSHHIII$I9}$ODLIpTITL舴IHTHHH9}ItHHH>HHyLLTLNID$8LL羜H[]A\A]A^A_I+TH9|1I\TI\$8LiL狋h@@MlLLL$IuVSIuLSLL$ISHDHu1I IHo1I9wE1Md$M`TMoMI)Iuf> tL9tE11I9wM;gtEofE:EX(Ax@tA IM'A6E1I9wF$MHLLD$rLcELD$IH5L,MP(M [AoH(f:AIX(HLM)MAVA AH8MHEaMX M9I@H;D$s 8A;x8GHII@MX IHTH4H9AHAEJH JML$ MHA|$E1HI9ILLL,M9AMAMM9LL$(IHE1H;L$9LD$ HL$LCA}D$>C;D$LD$ rLt$LL$(IL.IVIPJMff.AWAVIAUAATUHSH8HHHGH)IHD$HGwH|pZHHHfom HULsDk@E1HKHS9}LLXAAHqHSE1Lr:'LsDKcL{@LStysLUALL#LSMsLIulH8L[]A\A]A^A_ËBIAtHHHHHH9sHLH9pHL{MG AbL;Uof:S(LHL{L)L}MHGXL[K@J7HHHUEL H@ OH@L@LSE1L;T$.A2HzHT$LT$ L|$LD$LAGIxLfHnM4fI:"{tLKE1L;L$rA91IHfInfH:"s9DoLLfE:L{8DK(M H{?GL{`qL9|$vA7H ulHsH HKHK8MHilAMupq tH|$H)HH9ZDAAN LKRLLL}M)MIGspHLS[@LHHHUMBL H@ L@X@HMM5oof:K(AAwAC8L[ESLs M9:ZLCL;D$WK8A9KLHLEL)MHGhJ7HHHUL Lc[@H@A<$X@M LH8MLSHsHLUH IIHHLHa~S0fH:"S(HCHC L[AKULLLSM)MLUIGUHLHHL Lc[@H@ A<$X@IHPHUbE1H{8LgHT$E1HSH;T$:HT$<LD$IxL{L|$H|$L LX EOHwfLnOfM:"DKH{HD$E1DRH)HI9!H}E5lHC LsE>C<kof:C(M!m{@t TLUAIILCLs xE1L9Uu iAWIAVAUATUHSHhH|$(HHt$LD$LL$ }VD$4Ld$@HL$0HD$@HT$4Ht$8MLHHm|$0HT$8\1bHH|$@?(Ht$H1H=H7HHHUD$Ht$L$1LIL{fIH1_IHlHD$8E1H$H$Hc$H)HHIH$H)HHHM9}?$LLH.lLHH$H<$AʕE|$HEIL;5 t!LLjL$菕4$vL$E1HD$8IL9$AL$D$<H|$fvLHDŽ$X)$ gHL$H$LHqXH$HH?kH+kL$M9~CH$$LLpIHjLHyL蟔LfH臔E11LH$$HHVI|$j$LH*IH/L'MH|$ HhL[]A\A]A^A_HED$\Ht$H|$(L$HjHHH$LH<$I谓MiHE E1L+#IBHD$H9D$8!}HT$8LH=j1I4H>'HA1Ҿ\H1H5WiRiiHiff.@E116fDAUATUSHLoL'LL)HH9~ H9u%iHHc,HHM,ًFL©u L9sf9tNHL)HH[]A\A]LLL9sf; tHLHnL9s3HtHHAUATUSHLoL'LL)HH9~ H9uH%8jHHc,HNLL9s9 tHL)HH[]A\A]HM,LL9s׃; tHLLHnL9s3HZtjAVAUATUQHjIH=2eH=IHjHI1LI.MjLLZLIMjHLTLIHZL]A\A]A^ff.UHH1SHAP,KjYHH[]fATSHQH0uIHt4HCPH{XH4uIC83CHHH3CPI1M1IiLZ[A\ff.H Huoff.fAWAVAUIATUSHH8HoLNI97>jDV FME,EMAOd^H+LHǃHL9L}IfEv1L;ILHL{MDA袬HM9MItbIt.L}fEv1LL;HL{DVHJIfEv1LL;HL{D(HfEvIDL;1LHL{HM9IofEv1LH+HHkDëHIOfEv1LH HHKD蕫HIWfEvLHHHS1DgHu_fvI@AMAUHuwAuAu,ǃM$AL9sD:m&HL9u1H8[]A\A]A^A_MEI)M9|AAM)L9LCMEL LH)H91AuHH9uI4ԿĨI)IAM)L9nAE L9^H:EuL9LǃAHL9-MtC8Eu1IL9uIJTI)HIL[EO$G$ L\HkLEuH$L1HƩH$fvHHǃIHL9uL tHk1LHH+dHXfEvHD1HLT$ HL$LL$LD$H4$&H4$LD$fvHLL$HL$LT$ qfI9>eF DfeMAI)IM9ME]AOLAA3H+LHL $L<$fvǃ4L9THL1H+HHkL<$tL<$fvHtI9>eN DfheLH)HH9MA}MLAAH+LHL $yL$fvǃHL9HL1H+HHkL$2L$fvǃIuLL $unHL $L9r1EEAEIA}L4AM,ǃL9;}tBHHI)L9LCHk1LHH+L $HcJt5HkH3E<$1HLK<$fvHhlcMUNLH)HI9<LAHH)L)H)HL4H4$Lt$M4L9AUH;UcL9ǃA9EbHI9HL9HuEEAuIEmEAH<6AM,ǃL9ffD;uHt=HkH3EOH<$1HLzH<$fvH&[bHI)L9LCcL\$ L\$LT$L$IHL$(ILD$LSLE1LHLD$LT$fvHL\$ HL$(zaH,MUNLH)HI9w1AgHI9uALALH)I4L)I)H?MH$L9-AUHf;U`L9ǃHL9HtAf9U`HI9uH<$JD5HHH{E`ǃIL9`1ff.HBATUHSHHmaHLeHL;%BtMt I$L[]A\HwH8H~P`L%hI$4aff.AVAUATUSHHIHH6L4LLAqJIH@ ƒ fAW`@I@0HHtH9HHHHH|L H9AL9AEHfo Y oEIoUIfffgIt0I1Io\] od]0fffg\HI9uIIJJlL9t-EHHBMJD]DZDUDRH9wHLI9w;[L]A\A]A^DeHHD`]XDmDhUPH9wuHH@p뮄_IxH@_HH?[]A\A]A^LHItI@HuAVAUATUSHHIHL4J7HLAnHIHP Ѓ AAx^@M`H^IHLJD5H9ILME1I)MjIL9NMBIML9MBIL9v AmIIfAl$HI[L]A\A]A^Äm^@Ip0IHHI%HHJDODJDWDRD_DZL9rML]E1I)IIM9JIBIHM9MBIL9hEuIHDpV NHHDNDVHH HL HL HW?[]A\A]A^J]@IHH]HHLIpHfHHIAH)HHEىH96f Pf Pf P1HPH9 DPfD P fD P fD PEAHPH9pf pf pf pDAHPH9DXfD XfD XfD XAHP H9DP fD P"fD P$fD P&EAuHP(H9vap(f p*f p,f p.DAu]HP0H9v?DX0fD X2fD X4fD X6AÅt62f rf rf rDAuHH9wHL9su?HHЁu ADúAA{vtʃ[ADHAH)HHH9s%DD OD OD O AuFHAH9s,#uHttAADÁtu AAwff.@ATH5G IUHHT$ HZ|$ HLHHI~HL]A\@HH|$Ht$H=7Hff.AVAUATIUQHZL55HIL"HHt2HUHxHEL9$uLHZ]A\A]A^#H~Z1SGHHkZHLLvUZHHiH8H5ZHtHHH|$`]H|$HHYHHff.@SHH HT$Ht$H|$4koHtBHH54HHt+H@tHwHHxHOH9u1訁HT$Ht$H|$H [oxff.@AT1USHbHYHH@@Y1HKIHtZH5 Hu0LHH=eN%HH|LIx|L[]A\HsH=ve1%H Y@QH;=tHlHtHZHulHuXH=tHPlHuZfAWAVAUATUHHSHHHXHYHYIHYILu1IXLd$0LHLKIH1DIHXHt$8HD$0Hc$H)HHIHD$@H)HH$LHHH:LHHA{E/XLL$0E1L9L$@AD$LL$@HT$HH9T$@fvLHDŽ$)$xMHt$@LHt$0HsXHHWH~~H{HHu&LL4 HH3|W>|HHkWE1L;{ILLL H+XJD,WLPLHL[]A\A]A^A_WfDUHHHH]H f.H1nfDHAWAVAUATUSHXHt$DD$LL$HD$@HD$8H9sYH4II13I3HT$8HT$ HH9YL9LH)ب(IHAD=p(‰Ɖ ??ɀʀ=#?UH΀E@uMI9;fA?LUI܃AɀHUEDMLAJAD=D(AAÉA ??D߃ɀʀ=v{A?HARAˀAEZMI9IH[ADvx=vP(AA ??Dσɀʀ= UH@}MYAă?HAȀAEDe8EH,H|$@HtWH|$8H\WHXH[]A\A]A^A_Ã|$uH|$YD$L9}AD-=WDL$1L9@AAvAULOOcMA\UMHL9H1L)I9H RHOHsCtHIAA?AA ΀A?ADOAʀDW@wff.AWAVAUATUHHHSH8HHRWH5WIH)WMB} "XD] LmDL$ A A@nLe0M|$ _LcLOT%E1ILL$11MM)Lt$LH)ȃhHtpHt3 L9VHH ^ UHD A L9VHHA (A HD1A OL9oVHHA A HL9 DqHAHA L9VHHA A DqHA L9UIqHzA tgA taDpHHA L9UIqHzA t7A t1HHL9t7 tcL9ULNHWLH׃ +1HL9REucHcH8[]A\A]A^A_H?ɞÃUTL|$HHII)HT$H9ULLA닾A@#Ta8HH@ NT@=TLG0H|$LcAދ|$ 1E1E1L!D +IHA t`A tZIM9tVSG A uE~LMHHH|$ II)к LD$MmH|$H|$ E1H|$0LaIRE1LHT$0R1jjXrH HHW1LeH|$ SLcE111IE1MM) t1IM9?C4D lSL9SHH u1Sff.@AWAVAUATUSHHHHHHTH:TH0THH$THD$HL?Hl$01LHIHAIH1:IH0TLL$@E1HT$Ht L9AfvHLL$)$HDŽ$CHL$@HHsXHL$0HHSHLL$Ht$8HD$@Hc$H)I)HHILHH$LH[H`SLHHD$bH|$ApE:SE1L;s|%LL$01IL9L$@@Ɖ$LL$@I1LHL HRHLHD$H|$D$pD\$EyRRHt$8Hc$L$$I)LHHLH|IHtvLHLoeRHAHL[]A\A]A^A_HIHQHLIHD$]oIQRfAVAUATUSHHOHRHX!,IHID$H5ML2AD$ ID$[L]A\A]A^HIHHH9HHH9HH}!+IHsQHhH5H2ID$AD, HSHuPMtKDC I|$ IrALIIHHACE1FIM9r.H%Mt$ Hs L:MH[II<LI)I9LOLLMH9|H-H9ouWNH5SH";NH0H5]HNHH5-HMHH5-HhMH@H5`-HJMHpH5}/H,MHH5l/HMHhH5X/HiMHSPH58/HNMHH5+/H0MHxH5*/HMHH5)/H{LHS@H5/H`LHShH5.HELHS0H5.H*LHXH5.H LHSHH5.HjLHH5.HLLHH5.H.LHH5w.HLHSXH5W.H|KHH5H^KHpH5C.H@KHH5+.H"KHS8H51.HKHH5/.HbKHH5.HDKHH5.H&KHH5$.HKH8H5@.HqJHHH5.HSJHH5-H5JHH5-HJHXH5*HrJHH5-HTJHH5-H6JHSxH5v-HJHH5^-HIH(H5H-HfIHH51-HHIHH5H*IHH5 -H IH0H5,HgIHH5,HIIHH5,H+IHxH5,H IHSpH5,HyHH H5,H[HHH5,H=HHH5,HHHH5,HzHH`H5k,H\HHH5t,H>HHH5`,H HHS`H5N,HHHH5:,HnGHH5&,HPGHH5,H2GH8H5+HGHH5+HoGHH5+HQGHPH5+H3GHHH5+HGHH5+H~FHH5l+H`FHH5d+HBFHS(H5~+H'FH@H5(+H FHhH51^HdFHSH5D+HIFHH5++H+FHH5*H FHxH5*HvEHH5*HXEHH5k*H:EHXH5Q*HEH H57*HwEHhH5 *HYEHH5 *H;EHH5)HEHH5)HDHPH5)HhDH(H5)HJDHH5)H,DH0H5)HDHH5c)HiDHH5J)HKDHH51)H-DH(H5)HDHH5(HxCHhH5(HZCHXH5(H<CHH5(HCHH5(HyCHH5y(H[CHH5^(HĿ=CHH5I(H覿CH H5((H舿CHH5`HjBHHH5'HLBH0H5'H.BHH5B HBHpH5HkBHH5'HԾMBHXH5'H趾/BHPH5h'H蘾BH(H5S'HzAHH5ptH\AHH59'H>AHH5&'H AHH5'H{AHH5'H]AHH5&Hƽ?AHH5&H訽!AHH5&H芽AHH5&Hl@HH5&HN@HH5&H0Z[]fATUHRLgiHHt HEj\HA$@XL]A\S\HHHHV@ff.;ff.SHÃ(@%9uJ19@[ DA(HHBB@uH} fAHBB@uHN f.WHwǃ?HctY鉝?@AT1IUSHHHPHHz?Ht$I\$HH)H9?HLx?I|$HT$H4$t&I|$(H:HqI$HPL[]A\H=qATUHXHH)xIHt$1Y IH+?HT$Hx CH?HHXL]A\E1AWAVIAUATUHHSH8HNAH AHAHH@L}IW?A B?E1H AF(>?I~OL$*? ?AF\MneH$$Iv8IH>LJHH]>Lp H|$LQIH+?It$`H|$6HDL$EQAv ABzID$HHIHH=} @?A{>A~p>?2d>LMIcLH<$0<|$H@L@ID+|$H@L 9ID|$H@H=oHDD\$A[sABi;UHSQH>HHtAo@8oKS HK(PXHHH>HsHHH`HhHHEHEZ[]ff.f>@>~#D@A$wL'EOcMAHHÍH wHH%u$u%t'HԹ~.>Hff.G(uHG@u HP/r`fQG(uHG@u\=HWhHZH ]H53H9uHZUG(uHHGH@u;H`SIHtC}\Hu8=LExHMpHUhn=H]AHH53H:[uE1L]?@y=H8v=xl=AWIAVIAUMATUSHHH:HL$L$uIHtE1H}HtJOH}HtE,HH,H'HHLHH5s*i@HA>ES,HcXɀHH;,LHH5B*+@HAp>E,H`HN,H-HELHH5?HA.>E+HhH+H\HHLHH5?HA=E+HpH+H-HELHH5)\?HA=EF+HcxHH.+LHH5Y)?HAc=E+HH+HHH$LHH5!)>HA=E*Hc3HH*LHH5(>HAHAHA^"f.T ztnuxIU}1HH#!HHMu!HHH/1[]A\þHHL-y OvH @AWAVAUIHLATIUHSHM$H$H#IH#HM<$1IuLHt$Ll$0BHL$ILHLLp IHt6HuXL蒘HuH#LLHiLIHL[]A\A]A^A_I|$Ht?DHH.#H者HHD$C(Ht$H #I|#I|$Ht$DHt$HII#HHt$-LH'HHt$#ff.ATIUHSHH#1HHH|PH&#[]A\I4$HtHVHy#ff.ff.AUATIUSH;ILHH"ID$ Hx@MIHtL轱H"ID$H|$A襱H"ID$ H$花H"ID$(H$oHv"ID$0H$THK"ID$8HĘL[]A\A]DUSQHoHHEH9e"H\"HHHE<P"H<&HHZ[]Ð[Lff. fAUAATIUHSHAPH_#V"HsDYL[H]A\A]H9wATIUHSHH HۃH9t ,HEHHHEL9!HcHIH<*(HEH!H}Leu1[]A\J<1H}1ff.H=9d:@WHPHc/%vY gH<8WHO%v1YHzHuff.AT10IHtOYfHnH$foN AD$ID$ID$8ID$@ID$HAT$(LA\fHiATHtHHHPL$LA\ÿ&IHb$ff.ATH {HUfHnHHfH:"HH8HD$H$HD$ )D$HuHLGI>M$I#HH}HE@#Ht$E1HuYH8D]A\1HL$LD$IHW#H<$H;=LtHt@H#Hy#HHH#"댐ATISQ/HHH#L詸IHt(1HwAH#HHTHLZ[A\ÐATIU1SHH9kHH[]A\HtLuH1AVAUATIUSHH9LNL=IM9H5I9Ly/LLf/L֦HHu!A_HLlH!H%HHuH!nHuIL$IT$E1It$ H)HH9HD[]A\A]A^IEH$HI;D$IELt$H,L\$LI+ISHEH7"H!Iu(I} LHuL TH< HQH4HMHL[]A\A]A^4LLIHd!H H AH[]A\A]A^=ff.P ZH>Q=@a!1ZHfUSHHHHHT$'A!:HHC Hu8H{Ht$!HkHC 1@H[]H9kuHPH9 HDHS HfSHHS H H9C HBHC HuHCH{HH[DAUHHATUSH8H HYHRE1LECHT$R1jjH H!H L(MHHhHE1HtL`H5 L H5 H H5 L H H8H^LH` \ Hp HqE Hh LZ. H[HH8[]A\A]HhH4HtAT4A1EA\1Ht8SHHH?u1Ht$HHHt$H;H[s|1H1H|$ H|$HfAUATUH1SHH(ILLHA8uHuH(D[]A\A]HE H7 1Ht$HHSZffH*D$Y%H H*L$XCff.RH)H/IHH8HNHwL`Mt I9I LXAff.UHHHFHt$ HHHH;D$H5 Ht/H5H uh uHH= ] HH=t ]HH2H5H=% H+H1]HH5sH:J<QHtHZff.@UH'6HAH]EDPZHca]AWIAVAUATMUHHSLH(H}HD$Ll$hLt$puH $耍H4$HHEHD$`MEI>HHM$fHnfI:"H:IL)LLII6H4H}~HHHP HHL$HT$1H5rSI>胄HHHpL@ L3M}M+4$M$ILH4$LL)HL$HT$H<$HH9PHGHt$LI$LNII)IkL9\$H$H|$I}Ll$xHMe1H([]A\A]A^A_GPH`H$ILK(L9\$L$AAB4~ AA@L$L$MH(IC E9{rIKMI)HH $H)I9&L9EI)H$LW,Ht$f.PHAQIHH5SAPIHH81HfAUATUHSHHXKcH{@HH{HH}H{`H^PHC`HKHHPHS@LKX1LCPH5ZYH{HHS@E1HK`HwHHHHXD[]A\A]H ff.HQH@UƄ1ZfUH7$HEH]H@UHH@Ht HE@FH}HHt HEH0H}`Ht HE`H]XH=T,@AVAUATUSHH~H^IIHHHH8LrA A9 oHHIT$LAHEHKHH]M0Ic I LmH؍OA H,HH[]A\A]A^ff.@AUIATUSHHHo(LgL9c mH[0H9~ 1H[]A\A]I|HtHT$HAHT$uH@AUIATIUHH@Ht HAԅu/H}HHt LAԅu&H}PHuLLH]A\A]`ATAUHSHH*/HP AD$w!HMH9 uH9u#1A[]@A\;H4H[]A\Ëu89s8u]}H9{HHSPH;UPuKHHuXH{Xu:Hu0H{0x(Au AA[Hc]A\ư1119DUHH=$H HL$HT$HD$HD$LD$HD$tK} HL$HT$HAHt$HHtHyHZH5H84H 1]H ]qAWAVAUATUHHSH(HLaII\$PHA1LTHD$PjjuH HHLuHULmM<LHH}Hs/IH2HxpLI=IHH-RH#LH3H3L;-$6Lv_HLLLH([]A\A]A^A_HZHHIHH-Abf.HHHt$ HXO#|$ Hff.fAWAVAUATUSHHGHt$HIAvII `IHtUM9mKHO HT$H HHD$HiLt$PLd$(ILt$M;t$$M\$H|$I,HEH}LmHEH} HM(IuHU0Lu8tD$4H9GD$8H9 HL LD$HiDT$HHI|$4AE@A|$8{ML9L$`gLd$(Lt$PH5L莮H5LwH5L`1H=_zH$8@IHH<H=z1sHHPI1Lj$HSLD$ HL$xHt$@H|$(K]H|$(H IJ MLLnLI+ L# ML HIH H|$ L L$$MtL H|$@ H|$ Ht HL[]A\A]A^A_Ld$(Lt$PI96HDŽ$8Ht$@HHL$HHL$HD$8Ht$(HT$HHL$8HL$8HT$HD$4 AWAVAUATUSAPHHIAHHL5*xHLMHHu`VHHH{KIHHLH~qL~ 1EnZ[]A\A]A^A_H`H9Gu5H;CuLHeH &VHt ATAUHH=wH(WHQHE HkH8HJHX%-IHLHT$H^LLd$H(L]A\fATfHnUfH:"HH}H9G=HH=v)$H?HH8HHA0HD]A\DAWHBAVIAUATIUSH8HIIHD$(IH&H5@{H9s!Lt$ Ll$Hl$(LLHHtBHt$HNLAu;AHT$ LyLE1`H8L[]A\A]A^A_H~JV  @tLH0>DIIHtHT$ HL<LD$DL$E+rHHInHU} E1I-HD$(MIHHKHH}H9{S D$E AADD$ 9@L{0 @xH0E1L\$(L;[|$GC<#HHD$Hz|$ LT$(B|GHD$ HHHt$LH|$AH|$ E!L\$(IgINHqHH5aE1H=MAE  J@9Im0E1LL$(M9MuU>L:wH5aI:%sHwH5aH8%Xy DI>H=vH5`H?O%HwH5`H:4%ff.@1T@ATIUHSHHHt HՅu!H{Ht LՅuH{ Hx1[]A\ff.!ff. ff.AUHHH8ATH9ifHnfUfH:"H`H-4, D$8Hl$ HD$@)D$L$(L$HH3H*H HHl$H?H4HT$H1H5!H= |$8IŃ!H|$0ALαEL%zI$MHH`L]A\A]ÐAUATUSHHHD$H$HH;Ht$H{HH\$L,$Lc =LIm H1LH5MHH=-HLaL%FyI$HtMILMH<$HtHL[]A\A][f.ATH5wUHHHH$HD$vWCH<$HHG 5'H<$IoL$$MHT$H5HWHt$H<$HtH<$hIH|$HtH<$HtHL]A\I{f.ATIUHSH_H8H_LH8H[]A\ff.fATIUHSHHHt HՅuAH{Ht LՅu/H{Ht LՅuH{ Ht LՅu H{(Hu1[]A\[LH]A\ff.@AUHHH 1ATUSHHD$ D$Hl$HD$ID$ P1HT$RHGLD$$64ZY|$yIHhHRŅVH=OHc\$HiH;u8#Ll$ t$ |$LIH{ &LLD$M$H{LCH H4vDL$ fnMT$f:"D$HDKLfCH[]A\A]fDQHHp98HH9u?Zff.ATHIUSHH|$H$9HҁЁ@$LHĠ[]A\fHH鴨@AUATIHUHH$HMHDH:M1I<$H(gL,$LLH5H=UI1艠%|LHHLcFIL?IH<$HtSHL]A\A]fDH(HT$L$H=$>H(ff.@HH(HHHHHH?'ƒƃHc>H(AUATIUH@HF~ HIHL訋MD$1LL&tL9H@]A\A]L1AUATIUHH0L9uH0HH]A\A]RIHHLA>E1LKtU|$(nwDv.HOHu#HUHr H0]A\A]Åt%uLLH݃ff.fAWfAVAUATUSHL~ n(D$ )D$0)D$@IE1~HIAEA`ngf.& z%ExrRHL$@DD輒IH<LH‹K +tK tFH{u?{(nt9{u3LLJLAHĸD[]A\A]A^A_ALHH$CLIM[AE H$Ɖ @@IE0E1-8-AED4$HL$(LD$$LLHT$; {(nHT${Hl$0HT$H vH|$ Lt$P1LWLSUDD$IHH}HsZHHLHH1LHA EH,gHH[]A\A]H5Ƅf>eHgHff.@AVH(UAUATIHHUHfHnfH:"HhHtH-" fD$8HD$@Hl$ )D$L$(L$HHHpHgHHl$H?HHT$HH1H5uH=PIt$ H~2IH6AH@XHxHL1LHA|$8tM^AƃxDILID$X@I|$XtYH`HhL]A\A]A^Mt$0Ma.LI#LID$XI|$Xunf.HHAWAVAUATUSH(LgXMH H诛H}XISLIxMMt$LA|$.IMH}ZAT$I $H@ T$HxHL$0IHFu8fL}0@@ 7@@MLjMHJ|+H@LD$IH*Ht$HH]A|/I<t/I|LnH}0tH}H~LLLID$>wID$LI|$H}8I|$DL$LT$EL$0MT$8H(L[]A\A]A^A_HbA|$.HL;THE1=볉p@Mt3H}H躙u;LLE1ID$EI|$HcLL ID$",AUATIUH@HFH~ H#IHLzMD$1LL膞tLIH@]A\A]L'1ATUHRLgHHtH}Ht H} H H}(HuLJ&HXL]A\ff.ATUSHoXHt5HGXH蓘{8ItHH[L]A\N[]A\fPHaHZff.fATUHQLgS LJkHZL]A\f.SHH HT$Ht$H|$H{X H{HT$Ht$H|$H [7IЉO HI@  @t Hp0L.HpHAVHH pHAUHATUSHHD$HD$$P1Ld$ATLL$LD$(^_Z Ht$H|$> H|$贃HH. HS㥛 H9 HH L|Aą H=Q H=;g Hع@B<HHH1HI1HIHH Ll$ Hd1L):LIH H}ILD$MtIH=pLiH LUD$D%TDL$H=HILRD CDLL-ML5N1H=HH H^HHĐ[]A\A]A^ff.ʚ;)fHH ff.AUIAATUHSHHH~H5[*Ljf.D$fL$DH*YD$D$cD$T$f/ \$%  f/l$E1H,HuHD[]A\A]LAHHt1H?HHH9-HHHH9|HHM'3Ht H=^]H5<AH?LB]H5<AI8cL3XH5LA>E^H|$苸HD$HX[]A\A]ff.USPHoH葔HZ1[]fDAWE1AVAUIATUHSH(HGLGHW(Lw8HD$L;|$MdHT$LLD$I$LթLJHT$LD$L9u8LHHXHH([]A\A]A^A_fUHĀHHP1HH5xH=x1茙H=x藚H=x苚H]DUHSHPHع@Bʚ;HHHHiHEHuHHHfHnfH:"EZ[]ff.fAUATIHUH=~H1;HLILc]A\A]ff.HOH1AWAVAUATUHHSHHHH9!HHH9HC8L{1Ls Lc(Lk0H;H1HfInL{fI:"Ls C(H[]A\A]A^A_TDUSQHoH9u@1HGhHGPHH虝HuHVHZ[]H]HiHHGfHnH@GfATUSHWHHHHHC(LdHHC8HC(HSH@tL[]A\HtH+ HC(Hkfoe C(ff.@SHHHH;HmHHHHyH=TH8H_0ǃ0ǃ0HHl赸H[ff.@UHSH5H0HD$HD$P1LL$ LD$(ZYIH|$HT$HJH\$HHTH8Ho0N0MHH.L8IxH8nHE HLL$LT$H](L\$ILMILUML]H=:HHHy0H([]f1ُfATUHRLg LI$`LxID$HUHuH}HHHHIL$LH @XL]A\HGHHxH0ِfUHHޕHEHHxH0觕H]ff.H xfDHGH9HL_(HwJDHATIUSH_pH9B苉I|$hHŅѓHI[]A\ff.@HQHPHff.HQSH8HJ011H=~3ηÅoHc[ ff.fPHHQH8HJH` ZofDHrATIUSHW1SHH`tH1H9]~'HEL$L1HH#BH[H]A\0HGH)HOH9HOH9 LGL9IOb fHiPH8HBPHuHQHff.fHHGHWH~&HLDL9sHI0HIHwIH1AUATIUHHl$x%tH}PHH]A\A]Hn1H}H50NH9t tH;LH8[tH=KHIHtHL#LD$ D$ p1xSHH{ H9CH3NH[DAUHBIATIUSHHHI}fŃH~ I}H;=zOu&1HHH1[]A\A]ҹHWuHt$OIHRHCH;D$)L螵HHudOff.ATUVHo HfLgGHYLHH=C]1A\"*fRozHM1H8HJHh XAVH1HAUHATUSHHL$LD$]Dt$Dl$Ld$ D$ DDLH1H跅x.Dt$ HcH=HD1RH[]A\A]A^8HHH8ȈfDATIIIHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ ILLHT$H$L1A$D$0HD$u:HA\ff.ATIUSHzIHtF@Cfn%f:"-3fA@A$=tAHu[L]A\A$tdIxt]A $)}a)A$Rt4EPEHA E)AE AfAnfA:"fAHAxuA@tA4$AxA@AxRuff.HvHHlvHHHuHLD$1LH *Hn"pHRHD$HQH{@HC@1H,H []A\AUHFATUHL8HHIHHL]A\A]ÐAUIATUSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HEH8HH-IHtKH$HL$ HHHT$ALHL$H$D$0l1LHIHL[]A\A]ff.fH(HFHGtuHwHt^ Ht3Ht(Ht$AQx:HD$H(11 1ҋGHHD$t1D$tD$1ҋGHHHtHHHt8HtHtHt$AH|$9QH|$땺ff.UHHH}H}HZH]D@UHSRH_H;~H;Dt{ t H{(C XH[]fUSRH HGHHXH0_Hǃ8HUHzHr@HHX{XH[]ff.UHHHH}tH-H}DHEfHE]H@ff.Hu1AVAUIATUS薨fHnHQIM(Mu@IEImIE8H)fo AEL9H\IOAU(I)L,L9tH;LcLZMH[1]A\A]A^ff.ATIUHQ1xHFCHZ]A\H}H5 AH9t xu1H?H81thH==HHHtLHHAEy1fATIUHSHHHt HՅu)H{Ht LՅuH{1Ht [LH]A\[]A\HWHH0HzH+x鳥AV fI~ATSfH~HH5>IH蜎I\$LMt$[A\A^fAWAVIAUATUSAPLhLHLHLII1.LšIHtIHuRLtnՖHHt'MuTLHL}HLFLZH[]A\A]A^A_LHd(HILMjgHHfAWAVAUATUSHHLwMI-KHcHILYIED$4HH@(LHT$(mL=frRHtLL'I|HHHLNHH*L9|ID$4~N)LL}KLHH[]A\A]A^A_HHH=[]A\A]A^A_H5չLxy-ff.HHHGtBHWHt5HuGHùHt$E1hKHD$yHc1H=U;H5kH?HATUSHHfZ(T . wGL$ `t%1Ht$ >HHHu1H[]A\HHfT f.} wff.UHSH1Q{HL@LH< HuHtH}ZL[]@SHͶtIu11u+Ht$ HH)H HuD$ ZH[ÃuAtHAMcLD ADE AL8H5`I80x fDAVAUIATIH5eUHLAQ/Ht'LpHI*AXLLLH]A\A]A^Z1]A\A]A^AVIAUATIHUAPH1HLIHHtKH@H}LuLILMHZL]A\A]A^LH5H=1_L]MtLE1Mff.QHtH7H9G~HlHHRHIZDATSHHHu&IHt HI\$HL[A\ÿHt$Ht$HItHHI\$~HtID$ ff.fATHBIUSHH HI,$HU} 1H0HLe~HHtfH LH=S1[]A\I|$H;=!;tHOiHt$;HtHHD$H;D$'Ht$H 1[]A\AW1AVAUATUSHxHOHt$$HD$PHD$H I`AD$ AAA ,Mt$H@tMt$0Il$E1AH?1@H)L)H9H1LHrHD$`HCH HD$XHALxH5 LLDLL$HL\$PE1LL$L\$HL$XHI9IM)ALKO ?HLHIHDž~e0PAffAD!DXfAD!DXfAD!ft*f1pHHfqPfQDXfDYH9rI98HfHfyDPDffAD!DXffAD!DXfAD!ft7f1pHHffqPffQDXfAfDYH9rI9v;8HffHfqف\I)IIM)MHL$XI9utHt$XH\$`Hk H)H9smH|$PH^H|$HHFHD$`Hx[]A\A]A^A_Ë $HT$XHLHP"f@ HT$XIMLH|$ PHL$pQH WAWLL$0Ht$8H|$(LT$HQ,H IHLPALT$(x MKAC @LD$hLL)LHIKAC @I{0 $HT$XLL\$0LT$(LD$ L\$0LT$(LD$ LLT$(LD$ 耿LD$ LT$(lbKJ4H9IDHAAADfAH fA$f@(fDYfy룁vKAfHA f$fA@(ffQfAfDIH98Hfwf9HfDH.I4MI9SIAyvILAIs LHH|$XIHHD$XLHALȾLD$hLHHL)HH~H|$`L|$XHHw I)HwH)HHH9HH|$`L\$8HLT$0LD$(LL$ 跷L\$8LL$`LT$0OD9 LL$ LD$XLD$(cH|$`lH)IHI)IH|$PHt5H|$HHt&H|$`H51ZQ?]ff.fE1 ff.AWHHAVHAUATUSHHT$L$HD$XHD$0HD$(HD$@Ht$8Hu HLD$@L9H H-­AHND$L)1HHl$Hl$`HHDŽ$HIH$HHtH詛|Dd$HL$8HT$@HHH)HDT$pHt$hHyH$AALl$`HIIEAE @H9sGF4"F,AE LjE(EA(AwD0LHIE1H)LHT$@H$EuUHH99H<$t H$H+D$XHH|$0HTH|$(H<HߠHĨ[]A\A]A^A_A,A A1DH脇/LBI9 Iυ~SMIPMhLu/IIՈMxII HH0DpDhPI9vMI9LMIHMhL1HIΈ(MhHI(HH8PDpHI9vLMpHHD$@HCH{HuXfDSHHsHSHsH;2Hu1[{@SHHyHsH;u1[ATH5_IUSHHT$Hl$HcLHH5_L$$ML;%@u;HH=@1PHHzHLoHH[]A\H=_sHHLotHLH=ؙ1PPHHH뙅x$HH=1+PHHHyff.AUATIUHSHQHQH(H9(u&HzHȵu HLH5j4L1Lh A$0IHHtHI\$HaIl$ LH=1ZOID$H-7ID$0H1L?HH11H=jH耸HID$8CI|$8IuL;Ht ZL[]A\A]fDH>H~ff.AVAUATUHSH'HI|IHH10HHL`Hs8HiIHH{0LH边LnHsHL蟹HOLG[L]A\A]A^ff.QHHH9FlH~uZH (HH5vP1H9r1ZAWIAVE1AUIATUS1AP3HEHLlHA觤ETWHI9]~IEH,L9uIYL[]A\A]A^A_~SHwHHHxZHHk[HCHCHtHCH1[DATIUHSHHHt HՅu4H{Ht LՅu,H{ HuH{0H[LH]A\ff.SHHHt&ΐHH{HH9[}[UHHHuHEH]H@8fDHAUATIUHSHHHHD$H$HL.HhHWE1H9HHNI9J|Lj)L/}H[]A\A]@HFUHH~ xH~ HH]鉒HUH H51HRH9 pH1]ÐH=@ATHyUHSHH7)HC>Ht$HIHH,sH;D$LeHPHHP趡1H[]A\ff.UHHt HxHF1]fAWIHHAVAUATUSHHHYx(L@0H3LH8LX@H$hHPH|$D`HxPLD$DhL@XLL$(DpLHhL\$0Dx LXpHT$8X$H@xH|$@LD$HLL$L\$ HD$PHu HwRLE1L HT$hR1jj膠H IHH<$trI:HIzHIzHIzHIz HIz(HLT$XHLT$XvH,$FE EEE|$^PAH51SH=AWAVAUATLD$PHL$HHT$8BH0t$PDD$ADDDAPEt$0t$0t$ht$ht$ht$ht$ht$PSHPH[]A\A]A^A_DU1HSHHH5HLD$D@t'HQH|$H0茺HHuHt 1H[]HfUSQHHMHH9FHIH1H \H5nH=nAHSPHuH1LBHL9H}0HH]0HgY1Z[]USQHH8HWHJ`H5H'H1薹Ht HZ[]H}XAVAUIATUSHHtH[]A\A]A^HMIH\$HHӐHsHnL4HL)HMLLH1=LE1nI<L5CLHHH1H)HI؀}(}H=0LH?载$IiHmL1L'nI<뗐U1SHQ;k{ uZ1[]H;fAWAVAUATUHHSHXAŃH=bzL%V$HT$0LH&PH|$0tZH}L)IHIHbHH|$0I9t$H|$0IHXL[]A\A]A^A_AwHUH8H5#H"IHIHH5#Hu"IHctIHSIHsHH5m#8(LIMMK*IH1H}1HIH9M1H"HT$8H5p(HaH|$8HkLmt I}(HHVL0MJI~?IIH5u(0IH7HH9HxHtILMH5hI LF tIItIIY I9MjOI9SIzLHU7L-IE ;H-HELIMLL1δLH蓙LI舙L耙LxHphDHIUL5MDHIMDL1+*HLIMRIMHHHH5 %HIΘMI]H{訚IHgHIH9HUHt$@H=&Hl$@HZkHH$HVHHKH(H fHnHHD$fI:"Ht$@H=%)D$@HjH|$H$L$MfHI9IJeL觗L蟗LuIVH H51H9?eLwLE1ldH|$8IUM]L k HR1E1H5I9d#HLIMRIwIWHMoMw LIEIҖMEADMNA IHI~LH5c#LIxMLHuLL11臱LILLDM?L$uH $HILQHD$@1HD$L$H9$MI}~1LL1H $LHەHH $IhLH $迕L$HyHT$HL$LHILLD$LL$HL$Ht$@HHHt$ LLHL$(LL$蓩H|$D$EH|$ ;D\$HL$(ErL$L;QDHIUq(A<72$HY HIH8HqHXLI4fATUHS蔍IHtHHALH膔IL[]A\ff.UHgHE11H1]@ATUSHGHH= H^IHtgHxH@LHH#H1HID$8HI\$HvfHAD$AD$(kL[]A\fAUIATARLgMtI|$H5ztIQH:AYA\A]gIAH=OL(DAXLH=HLA\1A]HH@ @19~fSHHH HHNHDHH8H8HpHtHP H [H HH|$Ht$H=fKHff.AWfHnfHnAVfH:"fH:"AUATUHSHH8H) $L8LNHwI9uXHv`HLL9FL%@E1L|$ LH5L)D$ qL9tH8[]A\A]A^A_Iy`HN`HtHIH9WuHbH9Qu$L<VL%AL|$ L|$ fo$LH5,L)\$ LUL9SsLgEuL%yI$LPff.AWfHnfHnAVfH:"fH:"AUATUHSHH8H) $L8LNHwI9uWHv`HuLL9L-E1L|$ LH5/L)D$ "L9t}H8[]A\A]A^A_Iy`HN`HtHJH9uHH9u$L}L-AL|$ L|$ fo$LH5L)T$ LUL9SuLEuL-,IELRff.@HWHwHtHO1H=qH=1cUHHSQHHt?H}Ht'|H;H(HH9HOHEHHZ[]UHtff.UHH 5HHHHH$ILD$H81H|$ HH~[H]HYAVAUATUHSL8HNhH5HIHH#LI舎MLLHlHVHTHU@tHHHiHC[]A\A]A^Hf.HH1ILD$H$H5k/TH4$H|$ HfDAVAUATUSHHGLM@IHIHI<$Ll$LLH;tHu H$HHH*IHtbHLufHIPM $LLL詉HH,$HHL$Hu2I@(MH0MvM$HL[]A\A]A^HAfHnfH:"A0A@(Hq0HCLA0fAUL-7ATIUHGHL9t H;uH}t[HmH}IT$L9MH;@HELHI$PHIEL=L]A\A]E1ff.@ATH%HGHH9tH H9,HIHAI|$t HLA\LE1辋ff.H?~H;=tPHSH5dH8D1ZUSHHH(HH[]ff.AUATUHSHQ0H.IHu7H5"1HH1IH HLLgHHuHLɊH-HEZH[]A\A]fUHHH H]AWHAVL5[~AUfInATfH:"UHHSHHHײ fD$XHD$`HT$@D$ )D$0L$HL$hHHHtLl$0H}L[bH}ڴAăHA\$ AHT$hDH5hcH=x}DE1,@|$|$y ADAHEdH[HEAHIDLmt$LHHIEzHkMVME1LT$LeM9HL$J<LD)9l$v8HLJHDI H,)@oMA OHL$MI)ID\$F\L1$IHHH 1MMMLHIMLl$II)MMIH IF|3H1MAAEF &EMHBAUAv @t$y1IH`HH5hH;E1H H5ahH9E1L6IE11IMM9}kLT$L19|$v@E 8HuLcM9tHLH-HX[]A\A]A^A_1L=3L%^`AML%L`Awff.@UHHHSHHu;H~jHHH1HH0uHNH[]HPHYHRALHHT$R1jj(kH HuHAWIҺ1AVHIIAUATUSHH^L$L|$0LLHLF HvHE1MI^1LT$Ld$HLD$HD$(IHHT$L\$L` In H|$H1Mu'uIHE3D8ET$HEHyHt*LLHl$(HH[]A\A]A^A_HhI9FuILjLt$(H;5(tS1LLLT$tL$H$LT$MZARMbI E1M1H$A  HH=uH|$LLL$HT$Ll$LL$1LT$L9}AHDŽLLL$ILL$M1A8AMXIEMIxUHuMÿHOH~M)H|$(LbHl$(E1L$GIIufAWAVAUIHLATIUHSHMpHHIHI$E1HILHT$Ll$0HT$ILHLLp 8IHtKHL$@HuXLDŽ$HL$09HHLLH LI9HL[]A\A]A^A_I|$HtLHT$HT$HHHHT$HI\gIHT$dIqI|$HT$褃HT$HIhHHT$FLH gHHT$HYHRE1LHT$ R1jjTH HHaHIH?ŃŻIO 1I_HL$IH%1H9IA tIL9tiGL A uL9IpA uEILH)H|$IHcHLHL!TLzHHH9LMM9_ LL踲uuH(L[]A\A]A^A_HH)HHH9FLT$C| 5Ip,1I'E1LY鑺f.H ĺHt H5DHʺfAVAUATUSHHG D$ AAA LwH@H LoI9Ik UHHwDLD$ HLLӋt$ HHIH@ H Ht &M\$H@<HIMHI9ILME1I)III9J<IGIII9MGII9sA IIfAKLHHfXHL[]A\A]A^<tHHMH\ H9rYILUE1I)MIIL9J IBIIL9MCII9sAUIIASM\$08IHAyDPEQDpEqHAIxLw0LAV EIIA^AFHH HH HL IUfAWIAVIAUMATUSH(HL$uI>LL$LL $L $E1D9~-fCnfAn]L\$If8?fA~]fC~Tҋ>1҅HLcL9}ruaELHLL $%Ht$L $1N91ɅHHHIfAn fAnEf8?fA~EfA~ Hǃu!E^H(L[]A\A]A^A_>Euff.AIP@@u D¸AÉйH5\ IH4HcHsu6tAH>AI9IyN\HO\I)DL)HDAEFDGDf.AULiATUHLSH(AtH(D[]A\A]IIԶFdmDHt$HL$HT$HT$HL$Ht$uDHt$HL$HT$ HL$Ht$LiZHT$L9 uQH([]A\A]øP=FdmDHt$HT$^HT$Ht$uDHt$ Ht$I|fAI5P@@u D¸AÉйH5| IH4HcHsu6tAH>AI9IyN\HO\I)DL)HDAEFDGDf.AT1USHHPHHH8H;$xAătnH{1HuWCH}R9HT$H4$D4 HH R'HH|$tH_HPH[]A\۴fATUSHHHHt$ (4HkDd$ HH9HuHXɴH{ŴHS(HjD$*HH[]A\fAUIATIHUDHHMH1LL:HHKE1HKD]A\A]ATIUSHHHHHHrHHfHtBL'MtHt-Hkv*HsH{ L H[]A\ùE1fDE1xUHHH5H(HD$HD$HD$P1LL$LD$(ZY_LD$HL$HHT$H ]ff.@AWAVAUAATUHSH8HT$HL$LD$XHLL$L-M9MtLM9QH|$Ld$HMtI$MtIHWHtU@tLHT$Ht$H|$8Lt$HT$Ht$LME1ɺLHXH8[]A\A]A^A_é@WMRLwH|$Lt$IH|$uLt$HD$IHH|$H05t AIt$H;5$t H;5H L8H]MwMtILsLD$LHL$HT$I_slCl@4$DPD$H{DClHtHCH$HH$MwLH$HH$HH}GPLO@GPHIJLHC>IL[]A\ AG @t H5_f.H!HVHH81 AWMAVIAUMATUSH(H|$HHHHH)McfL 2I)11L9}EI|u7MVHLL$HT$I|`HHT$LELL$IHHLEHEIuPHH HLL=ISHPH|$(1I7kH=XZH(H[]A\A]A^A_AoZ)\$ f(T$ fXT$0)$$L$`pH@]Aoa)d$0Ht$ H|$y闭DUHfSHQLIyu&H5~hL31Z[]L,f.f zt1HC1ff.HBATUHSHH+HLe~+HuHVE~ %[L]A\}1ff.@UH*H]ff.UH跚!H]! HHGK G ƒu$Hw 3LGH@tLG0LHHHIHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$GLMu HWHLAKLMHII9ˬHtI I)IcAS IHD$ L$IcS$LD$McCID$0HD$ASARkXZ1Hff.@ATUSHԆHPHH HHwHH9HNHHHL`n8L[]A\fDAW1AVIֺAUHIATUSHIvHH$Ld$0HLHHX H;1H" CHr=H{1LlCLG=0IbL$I]IL$L\$0LT$@I9QMMIIHȫMu(LLHLLL$L4$&L$LL$HuCLIH$tHH|$8tLHL[]A\A]A^A_HH1LT$ILL$H$H)HHxL$H|$Ht$tiHH(HD$HILd$IMLHl$IHLL)H~?LHLH4$)H4$Ht#LLHLHIIH HLt$Ld$LHl$LED$H\M}($LHL)HH1HD$H)HHHxHD$Lj(Ld$LIHl$,$HT$+LLIHt HLLL)LxIIM)MLLd$Lt$LHl$L'H{QIHSHfLH$*5L$I1L$I]L$L\$0LT$@I9MB^M9IL\$E9LD$HME(HDLLD$HH$\L\$H1E+萇IHHxL$HT$LD$H@(HHHI)LH,$D(HHxHLHHDH)HD(HxL-:MI9~LCHH)HIL9L1L\$ILD$L$HIHI}L$LD$L\$IE(I~Mn(OLIIMLLMjLIQM9B 8HLIJLLH,$IHIE(H$H<$LLHLT$L\$LL$h"HHHLD$Ll$H)Ht$HLHL)H9~HHt$H|$1LD$ H4Ll$虅IHHxH|$LL$L\$LT$ tLh(H4$Lt$ILd$MHHl$HH$LH4$H)MmLLHLL$(Ht$ %Ht$ LL$(HH>LDLL9QHK,8LHIIHMU(LLHLL\$LD$LL$L$%H$LL$HLD$L\$EH1HD$ HT$L\$LL$L$jIHqHxL$LL$L\$HL$LT$ ]H@(HHHLLLL4$Ld$MHl$LIHMMHHthLLLHH)T$HHtKLH<LLHH,$HLt$LLd$Hl$H4$gLHLIL4$Ld$Hl$AE9D<$HM}($LHLL\$LT$#IHHD$HD$LPHH)HII9ڣM1L\$I4IH HxLL$LD$H|$Lh(Lt$LMLd$MHl$HHL)M~p4$HLHL$ HL$ HtSII9jHLLL)LxHLIE1MMHMLMHLHL)Lt$Ld$LLHl$A;LIRA}M9}/B48I@1E+DiH{H(E1E1MMHILIuLH=tHKff.HwHt H(~H=DAWAVAUATUSHH<$HHHHIHHHH"H/HHHeJIHHLH-HH $LyLi HeH5H9YHt$01HHt$#LD$0Lt$@LD$M H9HNHIIH1H9HT$ILLALHI<LHD$H)LLT$HIH rM\$IHMHt$D6IH_IoE1HIHHME:t-tHsH)I|-JHI IT$JHIIH뢿 H9HNHiIHdIoE1HL9HLʤEL5LvCtLItCT5AuIH9L)K|5HI I|$JILzLHaIHI aI|$N,IM|$LQ)HĈL[]A\A]A^A_H5mHH<$LLo rHLLIHH IL$L,HIl$LQyXkMH|/HLIH"I qML$KIM|$LPH|$HLLT$3LS*LT$mHLAL5AHHLHD$܈HD$H)IH5HHLHD$裈L\$2L)[HYHRE1LHT$(R1jjf)H HHiE1%H$HßH9BI|$HHhHLSL8)DHLL)xH$H-XH9k2M|$HIAPH(H5LE1H8IGE1h霝針AWAVAUATUHSHH|$HHH.HŸHHHL?MHfH5vHH|$H_Lw I9Ht$P1LHt$袵fLD$PL|$`LD$MA L9LNIyIHT$D:IH1E11II9}WHs OII9tG:<.uLHL$H)LTHL$HI LYKI}IILHH9;HHL$H)LHHRHL$H JI|$HHIL$H|$蜶HĨL[]A\A]A^A_HNCIHHLH&HٝHL$HYLq HڜH5ȝdA L9LNE1I|$E1IHL9I9G H5 MhBtMI9}C<.HuIMu I9kLK<L)HeI IL$JIMpIHLt$(E1E1Hl$0H\$ LL9l$0t`L\$(Ht$ ALHT$IM4H)L/HHx-LI,;HI fIL$JIHH|$(Ht$ IMIH)ILIH I M\$O4IMl$HLHD$8趃HD$8ƛH$yLI9}H }CII9uI|$8LHl$HԚH9E/MD$HEI(XH5IHLHD$HD$H/$DL9tHH|$K<L)IHH|$H GID$L,H?HHHD$ HL$蟂Ht$LT$ ݙLHt$#HL$BLT$LM9ZI\$LIHLHYHRE1LHHT$HR1jj"#H HHE1>LT$H~I9Z)Ml$IMUA HLсKL"L5-H5QE1I>CHLHL$莁H"HL$E1I鿘f.AWAVAUATUHHHSHHHHHHHL'M™HDH>IHH2LH!HLuMH L}(Hy HI9Ht$01LHt$9JH|$0Ll$@H|$M H9HNHIIH[1H9HT$ILLALHI|LHD$H)L%tLL$HIuH jMT$IHML=H H9HNE1HIvIHXI9@HLVA7HnAtHHtA /AuHH)I|/lsIHٗI  I|$JIHLH8sIHI 9M\$OInE1HHHxPHH~GE:,/tHsH)I|/rHI MD$KHIHHH|/HLqHHΖI hIL$JIMt$LD+靖HLLL$P}ŖLpLL$uHXHE7BH7HL|LLuM%H 6HI!HLHD$|Ht$HHYHRE1L~HT$(R1jj}H HH_E1L ֏H5E1I9<> HL<|͔L\E1_HL|YH4L=H QG頔郔fAWIHHAVAUATUSHHHVH HHHL7MHH9IHԕHyLIII_HH Io(My II9 I9INE1He1IH;Ld$IL;|$L9DL=LLwCtLM9}HF\5L%Cu4II_IHNH-oH IKLH)HnIHI HCN$ILJHt$@1LHt$(aH|$@LD$PH|$MMn MI9INHIHL$1@t$3H$HD$IE1E11LII9dHMWD\$G:\=t II9uLH)LmIH1I )HD$HPN$IIILrIM}HĘL[]A\A]A^A_~IHlHl$ E1E1Ld$MH\$LL|$L\$ I)I,L9t$tXHT$LILAH HHx3HM<lHHUI IEJ,ILHLlHH(I IUJIMuH|$(MLl$H90H)LHllIHCI bI}JIMuLH9LL=AtnHH9uHLwNH'I_HGH II^HHwcL2H92H)HHkIH>I DIuJIH|$H,w:LLHYHRE1LHT$8R1jjH HHFE1HLvH^E1|HLvLHH5)E1H;k8 H-WH Ȏ.H-DI0ڏՏI%Ll$TATSHQHw1^jIHt'HSHHs(I|$I|$(LZ[A\H~;H QHE1DDFTLCBDIL9ff.@HBAVIAUIATUHSHI> 3IHHsLHzHI =HuH9~iHAH)HH!HIHHH4[]H)A\A]A^MNIyH5Yt IyuIQ( [H]A\A]A^cLHH5gH=' f%[1]A\A]A^8LH= t@AWAVAUATIUS1HHI1HAPHIHH  IHw1IAHHYhIHtrM~IxA IP(HHIL$HIt$(IxɎMH(ILM~#IxAMP(I\$HILZL[]A\A]A^A_HHwHtH(H=_DHAWAVAUIH=ATUSHHHLd$PHL$HHD$HLD$@LHD$@Hl$PH jHɎ1L谡L\$PLL$`H|$@H9H\$@HHt$HH MT5H)MIM)IeIcIqI~A M,2ICT H8;HAKAIL 8uMyHAKAIL 8uMyHtzAKAIL 8)Ht[AKAIL 8uMyHtK @l$MrHL$Hl$LHL HH 8MDIsl$HI?E1E1B:3J 7@:)usH E{F8|7u]H E{F8|7uGAHtHD$C;B89u IL9HD$I9uEIL9$$t0IBL3IIAu{MIM9XEH8L[]A\A]A^A_BL3IIAtHE~E鰉MjMj1MMjeMj{A4MtA!E AHIDIA IHIM A8LDHuMJ'D:uHED8u1Hu MtBL'MIAtiIyIMtBL'LHÈM)uAt8ADEN$?IL9sIE:$uI)M)AH8L[]A\A]A^A_fHAIAUE1ATIUH,7SAP IM9}HxHH)/HuZL[]A\A]ff.@AWAVAUATUSHHHH(HHHHHHH?6AŃ`LcM;L{(IcM1E1HHH)H9HA t@A t:IM9vGEA uE~HLt5HHL L9II)LHH)L92I1HH)I9L1 ^IHHxLP(H{وH[(1McA2HIz@ tU@ tOHII9v}3@ uEHML׾ HLD$II)LLALD$J<01HiHRE1LHT$ R1jj H HH^E1H(L[]A\A]A^A_A[ff.@USHHHHHoH$HuZ1ILD$H OH;tIHuH<$x21H0HtHT$H $HHPHHH[]HjH$1fUHHHtY HEH]H@AUATIHUHHHpIL LLHrHp]A\A]AU1ATIUHSHHH:HrHHT$HLIH$I9HT$IfInI4LfH:"LETȉM uJH}$@E1%G IAM)A?M9MOIFT $I9|H[]A\A]HL)L9ILHHufDUIH1SHAE1I4H9}OI<E1B<tA8A8u#HH9uI1A8}LV1LL)MӺI1HUL[]AVILZ$ATUSLBLJHjL)H:Lփz LM`1L)H9L9LHMD4D84t$B ?E4 AtMHI9LL1LHL9}$D4D84tL)1HD8uHL9|L)[]A\A^L1xLHH)jB LIXF4A?G$3A݄LH9لB8 uMaM9}B B8't M)JD I1D4D84HL9|L)aff.fHHwHH( f.APHAHF9RHt%HHtYtH5xH5dH8&1Zf.HwHH( ff.fHt0HtHHH9v-LM~AuHzHH0~tHzHff.HwHH( ff.fHt0HtHH9v3L}AtHHzHH}tH{zHff.HwH6H( ff.fHHH9s0@t?x1HHH#Ou"HHH9vH9tHHyHHsyHfDHwH‚H( ff.fHt0HtHHH9v-L|AuHyHH|tH{yHff.HwHNH( ff.fHt;Ht*H1H9vAHQ|uuHHxH7H=%|<zHcrfHwHځH( ff.fHuH{tHxHHtHH9vL{AtHHwHff.HwHfH( ff.fHtdHtSH1E1At;t?AAHDH9vNH5{D AtЅuADE1HcwH7H=z<QIcIfHwH€H( ff.fHt@Ht/HE1H9vEHzuD HDHvH7H=pz<ŝIc齝ff.fHBAVIAUIATIUSHI>HHH^HHJH I !IuH9~MH)L1H[]A\A]A^MNIyH5tDt IyuIQ( [L]A\A]A^OLHH5SH=JR[1]A\A]A^nLH=!٣tATSHQHw1~SIHt'HSHMHs(I|$II|$(OGLZ[A\AV11AUATIUSHHPHHHL蒍CHm~LcH4$Ll$Mt^Ls(M9ALLu2LK<.L)RHH|$tH9HPH[]A\A]A^LLRH1L5&wff.AV11AUATIUSHHPHHHLŒCHE~LcH4$HT$Mt[Lk(L9BMI)K|5u.LLQHH|$tHhHPH[]A\A]A^LLQHL-Yv1ff.HHwH}H( f.APHAHJHt%HHtYHpH5H81Zff.HBAVIAUIATIUSHI>iHHH[HHHA}I !IuH9~MH)L1H[]A\A]A^MNIy|H5(qAt IyuIQ( [L]A\A]A^LH!H5H= [1]A\A]A^|LH=itAWAVAUATUHHHSHHH|H|HH|E1HH]Hi|1Hm(IH1H9HL5 t tHH9uIH9Lf t>EIEH)HbOIH{HL [{L+LI9}|5 uLfHYHRE1L}HT$R1jjH HHE1HL[]A\A]A^A_H?&Aƃ|{INff.AWAVAUATIUHSHHhH{HHrM<$H$I9HL$1LHHL$׈H]Ll$Lt$ HT$HLe(1H9}A4,LLHtHt"HHxA4LLHuHHT$L;<$tHfH)I<,HMHh[]A\A]A^A_H]HzL=qAL-L<$[1zDAWAVAUATIUHSHHhHzHHoqM4$HD$I9H\$1LH談1u_L}Ld$Ll$ MHm(1L9}tLLHtHMIH\$L;t$uGLJ|=L)LHh[]A\A]A^A_L}MyL5pAL%Lt$Hzff.ATSHQHw1^LIHt'HSHwzHs(I|$szI|$(LZ[A\E11 EtC HH9}KD LqGLAuAtEt(H mpB E1L qAC A@ATIHUSHyHHUHHrHt\ID$H9 [L]A\H)1ҹ0LHHyHxyHP(H q@u 0[]A\myff.AVAUATUHSLwHHHHHL9UyI1MLJH}I*yLU(Mt"MtE1E1IuA2I|$ LS[L]A\A]A^I9tI|$ LLILM111E1[JH}Iuff.@ATIUHSHHxH~I<$ "ƃx[H]A\xfUH5vxSHHHT$LxH|$xHKHxHS(~HsLD$H=q1#8H[]HH豨HHsLD$H $1H=37ff.ATUHHSHHFtW~ MxHi1H9@fIH9u HL[]A\H3xHH~YLHIHHKH5E1H=^ff.AU1 ATUHSH8} ILt$wE Lmƒ @ wH]0LLD$ HD$HHHt$$HHHN+7L-k AD <we{AT=HHЈFL9s'L mDCtD[HCuI9wLH8[]A\A]E nH=ogDHWHHvHzH+xHH f.AUATIUHSHAPHvH|LeM}vHL6vI9-vH}0H}?vHE(LH<HtH)D/It$Hx]YA[]A\A]1I<$K IHuHKLHHuLeMuHVHZ1[]A\A]ff.fHHwHuH(AH ff.HHHu1Hff.ATUSLg MuwHGHHuHPvuHH5wRzHHuHHluHSHH=1耖HILc MtI$L[]A\ff.@ATIUSHHHHuHuHGuHH;uHtKL'MtHt6H;tHsHzuH{(LH[]A\ù׹E1ff.fAVAUATIUSHHH H5uHuHJvHH>vAE1HuC(uHKAuHsH uH{8DL=H []A\A]A^L*f.QIIHH5_/tIqHuIy(LX ZsAWAVAUATUSHH|$8HT$H{H|$p1IH|$HH$HL߉$DŽ$HD$xsIHguu DŽ$HT$HzHwpLH4$AHD$`L $M$uIyH$HD$t A(uD$4H\$8II;%Lkt4L%LIHtH)ILHLL)HIHD$h{@%@@(D$ LE1IoMDHAPwH5bDNcIAEA*EDyüMcLCD{xA./zHyAIAM wHHvHt$H|$HT$`LT$(>LT$(HIHvAg~XAMw"HA tW H-[LCD1L+D$8DH5\ H}+'sAD~EEA"wH+aNc IAIzIMGMO L|$hEsA M9MMMIpzH|$LIVLL$@LD$(ŠIHrLD$(LL$@E1DT$ AwM9SuA EtErIspAME9E<$AtG\fG\qHl$H9l$`} H<$q|$48uH|$LdHĨ[]A\A]A^A_I1LI4$K|LK|I|$HH)H)LHHMM9tH<$uH|$hHIwH;5^zIzAzDL$ AzAX|L_EmAKcELA$%HHIILl$H$HD$`MuLt$ H|$LLH$IHpE)E,$GLGLLLT$(UHD$hHpLT$(4qrvpssff.LI9}IHH HyHLl;ff.HIHHt$ j}LD$L11觮n}HD$HDAUIATIUSHHL}I}}HHH)CHHH|}I}Ht$ v%}Il$Dl$ HH9,}HuL~|I|$}IL$(H|H9HHNL$H)H|LuH\E,$HH[]A\A]|fDATIUSHoH|HHHHH9|HLH~|I|$|MT$(H|I<*AI9}LHII$L[]A\DSHH=%fHSHHtHKH=1[&H=1[&fSHHAH:|HSHtH9|HJH9HOHCHb[H[ff.AUATIHUSHHHHH|HM |M,$H$|Il$Ht[HU5|HHt$r[HH|HH;D${Hu1HLHH[]A\A]IL$Hq{Ht$H[HtdHHD$萴H;D$9{HT$HuH-HYHPLA1LHD$(PjjH IH1bHff.fAUIATI1UHL(HtLLHH]A\A]]1A\A]DSXHtHcHH\sHH[f.ATHBIUSHH HI,$HU} z1H1HLeHHH LH=B1[]A\|#I|$H;=YtHOzHt$YHt@HHD$H;D$wzHt$낹HH=ք:H 1[]A\zff.HWHH^zHzH+xPz齻ff.fSH H7zLGIXhHt H{(=zI@pHt HxzLH=rH [ff.PHGH5<H SHP1H9oHZfAWAVAUATUHHSQIHLhLuMzHX(MzL}(BHHt^HAILLLHHbzLL(311HE311HE 3HE(,HzLIZL[]A\A]A^A_fATUHXHHImxPHt$12IHt)HxHT$7zHx(CH pzHoHXL]A\E1AWAVAUATUSHHHwIHLxLkMyHP(MyLs(HT$HHt\HT$ILLALHHyT11111HE1LLHE 1HE(+HyLIHL[]A\A]A^A_HLL1LI<HEH)I$Le o1HE(F+Hxff.AUATUHHSHHt$ txLeT$ M'yLm(LLHHxH}0ZntIHHu9LH:HwI MHuH9~4HAH)HH!HIHHH4[]H)A\A]A^[H]A\A]A^8^MNIytIyvAI H5NO9vLHcH5%H=$[1]A\A]A^vLH=~tfAWAVAUATUHS1HHIE1HAPLIHL vIHw1IALH؊IHt9HP M~ HHDHMH<Hu M~H]LDHHZL[]A\A]A^A_HHwH AWAVAUATUHHHSH(HlHuH\vHHPvHH?PAŃuLeH] Ic1IH1MII)L9uHA t?A t9HI9vFDA uE~HL47HHML9uI)LLH)H9uH1HH)H9iuH1eHHLH 1McA1HIy@ tU@ tOHII9v|3@ uE0uHMLϾ HHL$II)LLHL$J<01HYHRE1LbOHT$ R1jjH HH1H(H[]A\A]A^A_A~fHHwH HwH HwH cHwH HwH CHwH HwH #HwH HwH 3HBAVIAUIATIUSHI>yHHH%5HHHsI 1IuH9~H)L1H[]A\A]A^d[L]A\A]A^ZMNIytIysAI H5KusLH/H5H=[1]A\A]A^_sLH=wzt ff.ATSHQHw1ΆIHtHSHs Hx LZ[A\ff.fAW11AVAUIATIUHPHHHL1dCH rLl$Mt$M|$ H4$M9MDHLI9T$t/LLIH|$tHeHPL]A\A]A^A_I$LLذuLK8uLL9IHKI9T$t/LLIH|$tHdHPL]A\A]A^A_I$E1ff.HHwH HBAVIAUIATIUSHI>IHHH1HHHXqI 1IuH9~H)L1H[]A\A]A^4[L]A\A]A^VMNIytIypAI H5GpLHH5H=[1]A\A]A^pLH=Gwt ff.ATIUHSHHpH~I$[H]A\/eHJfDATIUHSHHnpH~I$[H1]A\dHJfATSHQHw1IHtHSHs Hx %LZ[A\ff.fATIHUSHFpHH-0HHHtRID$H9 [L]A\6UH)1ҹ0LHqHpHT  q@t[]A\ÈH 0oDAUIATSaIHt,LHA1HH53LIPML[A\A]@HWHw 1H=f.UH=`cHloHH_{HNo]@ATUHHHHFtL~ >o1H;-HIu HL]A\H/oHHFLHIHHH5E1H=V HHFHn~ nHAWAVAUATUSH8HGoHoH|oG  _oLgH@iofvH|$0@H9)D$HOH)D$ H}nfA<$@E1E1ABnC4DVcntAA B|,t:|40t(AMcI9}2uC4DFAvnD|40AF\,AA@AADm@mEED\$ AAMcMcK|?L$IHmHH5NFM]8T$ LLE}4L $foL$AU0MEK43AMfoT$ AU IIME1PmG tAt6EDA CHL؀8t)ADHLcI9}uG 4D8AH8L[]A\A]A^A_IIHLJDHHUMA<$@AVHBAUATUHSHHHAmLmIUA} mHH}L5kEL94mHOimHt$EIHlHSH;D$mHmHuL9t8LLImHHlHHH=1[]A\A]A^=1E11lff.fAWHLAVAUATUHSHAPL:MoH9Fu;LAIrsI9 sMZ1LGd Z[]A\A]A^A_:SIHrH;GDrHPH3rHI9sLHmoH;LOL D= L1f.HA AstFD2= sH|8rDR0ADHD8r1HHHu1Hff.QHGt HrHHrHZHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$ H$D$0HD$HT$Hff.@AW1AVIAUATUSHHXLd$ LL耜Ht$DLD$@HD$(HHD$<HL-CA%tUMHMwH CM~A7Iq1A.EEtA%tEBqE1AlE1A?zMAM)LT$0MZL\$0%y@@IcDLHL\HX[]A\A]A^A_DEgEA/EALCDIAH5C1LLHHLLHHquLT$0LHLLHHHCL要EA/AEALKDIIH51L肜g;/HS;DALT$0HDE,D3A/EALCD3M0H1A<HH9uDEE,A/DAHKDIHH5w1L进;/HS;IH5-L1莛s3/ALK3IIH5{1L[L$Xox.nA@dt @unIA[AWdt unIAFLT$0HE%A/DAHKDIHH5l1L踚LCMPLSxHSHBHC*H>H5C6H;H|$ Hm1LKMYL[HKLqLsuLCIpHsA/w;DAHSDIHH5v1LHSHBHCNHSHBHCLKMYL[aHKHyH{A/w EALKDAIH5uLKMYL[D3A/wDAHsD3IH5HsLFLCIADBmQff.ATISHHAP}HtHHLHZ[A\DHG(H+GHHGHtHw1H ff.SHH=%<PHSHHlHKH=1[ff.fSHHd"HllHSHtHklHJH9HOHCH2<H[ff.HWHHFlHzH+xSAW11AVAUATIUSHHhHl$HHL.Rt%E1H|$tH'THhL[]A\A]A^A_þCHkHt$Ld$ Lk HT$LsHt$MkH$IHtH$ILLAL蹳Hy$HI_nLIG ILIG(IHLH$sLL$L$LIGIMMO L)K|%ysIG(HBkfAW11AVAUATIUSHHhHl$HHLPCHkHt$Ll$ Ls HT$L{Ht$M8kH$IHH$ILLAL薲HjHLH$rLL$L$LID$IMML$ L)K<.urID$(HRjH|$tH"RHhL[]A\A]A^A_E1ff.QHvlH8H9FlH~_lZATISQdlH8H8H69I9u11TlHHZ[A\LH5ey0lff.ATUH- SHNLc@H;tHHL9u1[]A\H}'HkHfAUATUHSQD-EkH7IHH5;1H81sk1HM0H}8HE@H}PHEPHu4Hu@hu%I9u LH8AEtZ[]A\A]H4.H5 ,H81fW$;V$g19~HO0LF0L M; uHMu1f.G$HW@HHgHN@HgLG8HI9<gF$LV8E1HvHI94ADff.fQJhHK2HZDATIUHSHHahH~2I<$[HHiHHI̺I{H{8h{,thHH{h1r?hl{$HCptH)HHhX{ tHKPHgHCPH4HHgHgHC@H{8iHHCpH{hxsH[]A\gghH4hH.HfSHH8UhH{Ht HC蕹H0H[H f.QTgH.HZDUH Hl$Hig1H|$H"mgHD$H ]ff.@G(}gHG@ogHH_ff.@UHHHH]H@SLIL7HIHHL؅u,HHfPKfHSfPKfHH9rHH_1H)HPHHHH9HGHHH9HGLH4I9I)E1MI9MBLI[HHfPKfHSfPKfHH9rHH_1H)HPHHHH9HGHHH9HGLH4I9w(I)1MI9ICHpfHH?DAfDHHAVAUIATIH5lUHLAQrHt'Lp HIAXLLLH]A\A]A^Z1]A\A]A^AVIAUIHATUAPH\e1HLIHHtHH@AeH}6eLuLI茶L脶H|ZL]A\A]A^H=1LH5PLPMtLCE1ff.AU1ATIHRUSHHhHl$HHdH;1HCCH_>eI,eH{H;=,eHwdHt$a-IHdH݆H;D$dIuhH|$Ht$ LD$LHL$Ht$D$sHT$HHtHH=1HH|$tHDHhH[]A\A]H{ cH|$Ht$ tE1LD$x1믐ATI1UHRSHH`Hl$HHadH;1H6BCHddIH{H;=+BdHw]dHt$,HHcH菅H;D$cHt$ H|$H2xHT$ HHt-H=Y1IH|$tHCH`L[]A\E11ff.@UIH@H-i'H|$HHt$H;cHt$0H|$4xcLT$HIz cAoZ)\$ f(T$0f\T$ )$$L$H@]ffGfW )D$D$L$ff.fAUBATUH H|$HHIH5&AHm5cAoQ)T$L]Atrff.l$zt*E11AD9uJL-.(IEH L]A\A]D$IHtHDHzLHXIL-d'H5&LA…uCH5%LtsD$f.EM`Z1f.L$DDFLl$HDfInf.'!ff.d$AL-$IE ff.fSHcGLG M EQMYD融)lj> ~Y M9AQMYttD։)E1҉ ?H M9rAD H [fHnEQ D)É?H M9sGEAHDAD Dց?H 1҅tD։1)E1ҁ?H E1븐HaHWHB`Ht H@8HtPHRH5!1H #H9"~1Zff.H$HH9WuHGQAWAVAUATUSHH~HHLVLHIHL'M`HIT$HoIL$L-u#L9HtHuLIHxH!ML$MY`M8`E1IHtL}MW`MIcLLLhIE_MLE1]L$fT$H.H}LaHQhIHWH LD$蟮D$E $1Hf) $0IHt f(4$pHHL[]A\A]A^A_L-!L9tu1L9AtL莲HHtf(觊D$,D$ I"f.CAHf.D$w"fTf.wd Y L$ςD$뺐ff(f(Hf$f(fD(fW=z fD(fDWg fL$f(4$f8f(f(f:fE8fA/r[f.zfD(fD(D^EfAYDYfDXf\DXAfEfA^)4$$L$HfD/rBfD(D^EDYfDYDXf(fAXfD\fEDfE^D)$Y%+ )$蜁fE!D)$${ATIUQTHZLHH-HADZ]A\f.ff.ffD$fL$f(T$fW )T$L$D$@fD$fL$f(d$fT$f\$f\d$)d$L$D$f.AVAUATUSHH= H9GZHIHHYHxHT$HHD$YLt$MtyIH=rIHYHHXHEHhIMt$ LAD$()H|$Ht躧LHOYHL[]A\A]A^H=H+rIHtHI\$HEIl$!YfHSH8HHt[HtH[AT)IHtID$HXLrLA\HyATH8HJ3u6H=vqIHtAD$(fID$ AD$LA\L33I|$ H3LID$ _jff.fATL%hMt I$LA\BIHt1sID$H#XH=hID$ uI$L%h@ATH=_pIHtH@ fH@BLA\ff.ATSQHWHHH=QmIHt-1HHXHx HI1H]pLAD$|pLZ[A\@P ZDH t5ATIUHSHHDƒWH{I[L]1A\tff.AUATIUSHQHG IHTWHxLHHCH9WH}HE轤Lc 1Aof:C(Z[]A\A]ff.ATIUHSHHH D$oWH{LLL$I1IHVH9CV#HV|$HS L`u HP H []A\HQjHVHH 1ЃVZff.HG8ff.AVAUATIUHSH0HGH;XVH0[]A\A]A^ff.@AWIωAVAAUATIULSHHGT$$AՉt$(ALL$AA^!DDkLT MuNL\$MZLLLT$ kZHt$YH;l$xYLIHtHEJHRHPHHCP1HHHHEH9RO1Z[]fATIHRHGRHLA\UHSHQHHHRHSXHǸHOHHNH9HOHUΕ1Z[]HHwHwP1fHwP1fHwX1fHwX1fH`f.H` f.SHH4HRH;HH R'1[AWAVAUATULSHAQB AAA RLrH@RII1I9}KAC  QcQAMM)I9QLIgLIHt/L=\H9}#Au@ALL1HgHIZL[]A\A]A^A_AtQC VeAiQA^봁'vA^PANfAWIAVIAUMATMUHSHH>uXHEHA|$ LD$XHL$PLMLLI\$/-IuHH} HHH@QHL$`1HT$HH5APHt$HVHPHL$`HHPH9TPHKPHHHD$H[]A\A]A^A_1PAUATUHH H LNH0L>Ht$H QHt$HDPHIHPHt$1H+t$'BIHPHsBHT$I}HMM0H)L\$L9\PAM AȃA @t4@"PEP@HpPDVA#OH}HLE1ÑL軑H L]A\A]HLH2,&PHt$HOHt$HbOHHHlOHt$LD$1L+D$HLcL9|M5Ll$E)OLLCHH!OHT$H=1LI2DT EyLl$fA$fETMHHudOfUHSHH5;QHH7HPOHUP1HHHH@HHHH95Ov1Z[]ATIH(OHG7OHLA\UHSHH5QHHH'OHUXHǸHHHOHNH9HOH1Z[]ff.@HHH5_`ATHHHFNHt$lIHtH`H;D$NLY;IHLA\ff.AV1AUATUHSHHRH`Ld$LHNH}1LCL蜔NHNH}L5/L9NHwNHt$IH9NH`H;D$NHNHUL9tTHt$ H|$Lg HT$ HHt1H=e1 HH|$tL H`H[]A\A]A^11먐AT1IUSHHRH`Hl$HHI<$1HCH耓NH~EI|$H;=t7HwNHt$HHM_H;D$MHt$ H|$?HT$ HHtNH=d1IH|$tHH`L[]A\ùHH=#0 E1ff.AU1IATUSHHRHxHl$ HHMI}Hw1Hr?CHMM1HUH|$ Ht$01Ht$wHT$IHtHH=c1IH|$(tHHxL[]A\A]I}H;=tBLGA MHt$HLHHD$y]H;D$LHT$HRI}HT$HT$sLHL$AH|$ Ht$0IE"Ht$IH7HL$IuE1HAHE1 AU1IATUSHHRHhHl$HHLI}Hw 1H/CH譐-LHI}H;=@LLGA}LHt$IH_LH*\H;D$6LHt|I} LHL$AH|$Ht$ IELHt$?HT$IHtHH=a1IH|$tHHhL[]A\A]E1H|$Ht$ 1Ht$IHtHL$IuE1HAHE1fDAU1ATIUSHHRHhHl$HH}KI<$1HSCH.LHKI|$H;=KHwKHt$/IHKHZH;D$bKHDKI|$<KH|$Ht$ JE1HL$LHt$D$$IHtHT$HH=8`1vIH|$tHsHhL[]A\A]JAU1ATIHRUSHHhHl$HH4KH;1HCH|KIjKH{H;=QKHw!KHt$IHKHmYH;D$JIuhH|$Ht$ LD$LHL$Ht$D$HT$HHtHH=_1UHH|$tHRHhH[]A\A]H{蛲JH|$Ht$ tE1LD$x1믐AU1ATIHRUSHHhHl$HHJH;1HCH蟌rJIJH{H;=2JHwJHt$IH)JHXH;D$JIu[H|$Ht$ HL$LHt$HT$HHtHH=]1HH|$tHHhH[]A\A]H{XIH|$Ht$ t1HL$1fAUHBATUHSHHHEJL#IT$A|$ IH~zH{H;=UJHO"JHt$HHtJHVH;D$&JHLMl$DkHHtHLH=\1[]A\A]1H1[]A\A]lIff.ATHBIUSHHHJI,$HU} IH1HLe HHIHLH=4\1[]A\nI|$H;=tHOIHt$uHHyIUH;D$tIFIATHBIUSHHHII,$HU} IH1HLeHHIHLH=t[1[]A\I|$H;=BtHOIHt$HHPI4UH;D$tlIIAUHBATIUSHH(H}IM,$IUA} IHI|$H;=IHO_IHt$HH7IHTH;D$I1HIIHLMe聿HHHH(LH=RZ1[]A\A]tIxIATHBIUSHH HII,$HU} _I1H511HLeʹHHnIH LH=Y1[]A\I|$H;=tHO{IHt$H#IHHD$SH;D$8IHL$wHff.@AUHBATUHSHHHuIL#IT$A|$ IHH{H;=2IHOHHt$[HHtFHRH;D$)IHLMl$HHtHLH=X1[]A\A]H1[]A\A]1HAWAVIAUIATUSHHL$HSHwHl$`1IHHH$DŽ$n`HI9WLt$(Lt$0HD$PHD$X A HIwAG Ht$ HMgH@CMALl$8AH|$AADAAE!L5wHD$(LT$8II9S8EdDD$pAyH$LD$h|$tM IE1I)IMADC4T9:HA4EHHIItA4D9+HCA4HH0A4t9 HA4EHH^pEA4t9A4pHHXA4t9A4pHQHXA4t9AtHHQHDC4\9HJA4HXHL9yH\$(H$H|$PHH|$XHHdHĨ[]A\A]A^A_HAHT$hH$1Hf4JHI9DDC4\fu@tHD$(IH$L+L$0Ht$PH DaLL$@ILL$HRLULD$8APH|$pWLL$hAQHD$hPH|$@LL$hLD$`bH0H|$PHt}H|$XH}H9|$pA;AA4|HLJxHD$(3EtH\$(H$LT$(H$vHL$ht$t!L$HH\$(F4IL$H\$(I9XD3G<4EA9v|$t)EHl\HL$ht$tHĨ[]A\A]A^A_.||O.H\$8LD$8Lt$0L-_H\$H\$(H;\$8;臾HqLHHD$H|$I1|Mu~L%]I<$lh7wH+\$0Ht$PMH\$@HHrH\$HPULT$8ARL\$pASHD$hPHL$hQLL$8LH|$@`H0DL;%-It$LAuyAwCA|$ YCI|$HAD$ ƒ C@uCML$0A1H HxDLH{H\$(LH=H=HGyLzH|$PHtzH|$XHtzHD$`HHz1CCMD$H@BA0?LlzXA4LL$(+A4EHHHHItIE1IUH{*?My E3@AtFA?E?1MIIH{Y[]A\A]A^A_NI~EAǃuf?ILCM)M9?MHk?IVfAUATUSHH~HLVHOLbMPAL-LHL$Q1jjsH HH?IH/?HIH?HLItsIL%HCHL|H]?LHlvHI?LH=H5?H{HEHkH>H LkxHHS v?foқ HC`H5HC@CPH9s>LvL9EAA{,1CH[]A\A]IBMHp>AUHBIATUSHH(Hp>MeIT$A|$ >HI}H;=K>HO>Ht$HHq>H6CH;D$H>1H>HLMl$HH6>H(LH=H1[]A\A](_>c>ff.SL IL7HIHHL˅u(HHKPSHKPSH9rHH_1H)HHHHH9HGHHH9HG1IH4I9AHHHKPSHKPSH9rHH_1H)HHHHH9HGHHH9HG1IH4I9vAHI)1I9[NLBMM DAV1AUIHRATIUSH`Hl$HH=I<$1HÅ"CHju=I!=I|$H;=i=Hw3=Ht$kIH=H@H;D$L$IHt1L9|ZL[]A\A]A^A_HCLH4AH.IT$HHE1AVAUATUSHc8HI 8HhHc HHH?IHIc|$8YHHHHL[9HZIc|$HRHc{$ϔHH>I$HLЖ>HpRHc{(藔HH>I$8HL蘖`>H8RHc{,_HHK>I$0HL`(>HRdHIHP>HkH>HEI$HL=HQsL袨HH=I$HLӕ=HrQH`aIH=HsLHHj=I$8HLzA=HQHc{@HH1=I$HLA=HPHsL$HHE1M9}J|HJDILyNfHnIfH:"H>L11I0L9}MDH1MLHItM01)d$LA0H=foD$fo$@ XI$L`0H([]A\A]A^A_H_HH9B=HRH~HHuH5%wIH覘HuAL ҾH5[H$I9WlH$L%HH$yKH$k#=ff.UHWH HtIKH}(Ht;KH}0Ht-KHEH]H@ff.AUATUHSAPH~tJHHE1L9c ZH[]A\A]JtHFHIHtJILJ1HHY[]A\A]ASHHrMA|$ HAE AT$ ImM\$@AAȃAA4$DL$D9L9 zF@Mu0 G@IL$0HL$t$94$6A9@DAD$ @DM H9HNHI&Ht$D$ ?IHHI\$ E1Ll$HIHxLMtGIHr;A:.uH)I|.H I I}JHIHLD$MMDH|/LHeIH:I : IT$JIM|$LmT:T$9$`H8L[]A\A]A^A_Eo:AtAJ MBF H9HNH~IOLd$E$DD$IHtH1D|$Ll$HMIHxHrE;<HsMHl$MMH|9LHpLL$IHl:LL$I ;M\$KIML$Lol6:AM <Im @::M}0A L9LNI~ IH;Hu1Ll$H4$IL9HA<7@9LĽA<8tHHnHt"E /E9LC< uHH94$H)I|/4HI MFKIHb<Mu <:MuHpL\$( IHH\$H\$(E1Ll$ IL9|$tZHT$IHHALWIHx5H<HH)LHHI mIUJILLL$ MMHLBHH7I I|$JLHI\$L_j6HLע<9HC{MHx*LHA/9L A<t`HsIM^LiE8MtM|$HL|$'MLHHD$PH|$9nC@HHLH$FL$HII >MVOHFI9PML$IMLM9Y5=It$ILE1Mu0M0M0+22M11320Ld$31AU1ATIUSHHRHxHl$ HH=I<$Hw1HumCHB<1HUHt$0H|$ E11HT$0HHt/H=1R~IH|$(tHOHxL[]A\A]E1IL$H; tLAAVу,A ?A%LD(5AHH}8IH=W-1QHH(H[]A\A]A^A_Ë..롋.Ht$L28Ht$L+8L{IH 8LHH8HSHH^8Ht$ HA5A#8HHc|$ L|$HH\$HLH)H97LH)H1HH7HMEHMM0DLȮI9/HLH=71+HI4LLu4AU A҃A 07uZE7@M7A Z(6AwIc4LfHHbfHf@E6@L6 L3I|$L1DfAAffHfHfHfH|ff.H@H5$[ff.SHH<u6O<t6w<0f6DGA-t A_6HDA8A1tpA3d62Z6DWEA-HD_B<e(66?8bl[À65Wty-t _5HO<e557D0Abt:Alt551[A_D5[ø[ø[ø[Z5ff.t+w w1 Á( 1Ã1øAU1IATUSHHRHhHl$HH5I}Hwu}1Ht!E1H|$tHHhL[]A\A]þCH665H4Ht$ H|$HT$ HHtH=:1xrIHt$虨IHtHL$IuE1HAH褿fUHHs4HUHz4]HBAVIAUIATUSHH5I>LIHHuLH:0Hh5E1I35{H5{I4A4Hy:E4Hs4A`4AM4HkH[]A\A]A^F Et4f.ATUHo8SHHMC0IHt*H4LH4C0L[]A\ff.ATSQH?4LgHGLLH#/ILZ[A\ATI1H=UPˊLHHݜHI.LZ]A\f.AUIATIUHH@Ht HAԅu=H}HHt LAԅu/H}`HtLAԅ 4LLH]A\A]b44ATIUHSHHHt HՅuH{(1Ht [LH]A\[]A\DAU1ATIHRUSHHhHl$HH4H;1HtCHO33IH{H;=3Hw3Ht$QIH3HH;D$W3IH{_X2H|$Ht$ 3E1HL$LHt$D$w HHtHT$HH=[1nHH|$tH薼HhH[]A\A]E1H|$Ht$ LD$3ff.@H ff.AWAVAUATUHSH(HLOH0Lp2Ht$H豛i5Ht$HT5HlHH@5H=5L|$E1HML9d$E ‰ 4U44LUH@4G4bL\$ HxL\$LDH|$A3HHH)L9| IIaLLd$\IH1@ 2@2Mn0Ht$ M94LH="L1}HI+H(L[]A\A]A^A_E É c112H]H@1B{Ht$HkAE\Ht$uuIUB1HrAEuAAA AHAB<A}LG EMALAAC (Lj H8ZI.1*32DH ff.AWAVAUATUHSHHLOH0Lym2Ht$H4HH聙4HљHH3L,$H\$H LH)H93ILuHLM01M9wWIH3@ x3@Z3MD$0LuHL}0A I9LH= L1{HI )HL[]A\A]A^A_U A׃A 22E2@L53B4` 3c 32'33HIE ‰ 211L@1 _fA&#MX 1c1z1'^1'A&1110AD8HAD)EBMcHMcC;MAWAVAUATUSHT$,IHAF(IVBH Mf8H9NHl$PHHl$0Ҵ{HL_kMn`H|$OLH2Hu(H|$N|$OH1@_1DD$NA811E1A_1McV\T$OL]Mf8E1INxIvpLM@MvhHE8HL$L4$E1LL$HD$Ht$ AkHl$8MMGH|$L1H|$L1IL<HD$ HL$IL(L!H$L;2|Hl$8tw|$,L5H;l$0uH舵L@H8IHĨL[]A\A]A^A_J!L5Ә1E1I9ua|$,uZL511E1몃|$,t7F(uH^CuHn8Ht$PHt$0,$1E1 $tL5cO|$,uI9uHt$PL5F11Ht$0E1&Hl$8/|0fDAT?UH20HH5HcHD]D8AAH]A\DED9@@ff.H1fDff.APH1I10tHW HwYA^ff.H1HILff.S1HGI1H{8PH{XHt HCX#H{`H~1H{PH_1HH[ATUHQD0HWHH9B0uV0HHI0u:H}`Hu;H}h+1H0H ٖHQ0Mt ZL]A\0X]A\E1C#뾐USHRH@)fHk0HC@HCHHCPC0HtH}H]"HH`)X[]f.AWAVAUIHLATIUHSH8M]H0H0IH0HUE1HILHT$SHT$HH/HHT$~HI!IHT$r/I~/H}HT$ >HT$HIv/HHT$~LHq!HHT$J/MxIPHA1LC$HD$Pjj!H HH.ff.@AVIAUIATULSHIHtAHxILLH@HǀH.HLI\$A[L]A\A]A^fAVAUATUSH/HHd:LkLp .ǃH{(.HǃfvLHC(HSLHCHrXI mHH@.HsLLLNaMt1HkH9k(Hk(ǃ[]A\A]A^ff.@ATUHRLg@,HH}Ht HEHA$@XL]A\zf.HG(Hp H8HG(HpH8AQH-HtE1E1HLILZL9}LFff.ATIUHSHHHt HӅuI|$H-HH[]A\q-fATIUHSHHHt HՅu4H{Ht LՅu,H{ HuH{(H--[LH]A\---ff.UHSHH-H;5wH,HF+-IHH 1H5LH=I,HH}81H]8H,H[]D ff.U1HSHHH5~H(LL$LD$HD$趾,HH9D$u HD$HT$H9,Ht$H,HH([]ff.@QHH8HuH5D=ZH5J=HOHW1HwH=,ofDSHHCHKHSH= H[1fAUIATUSHQL%zHL.`,HC ,U,HHLIHV,H{L_AL; Nu L; LMm0H[0-@uz@uuH3I}+tZMmH[ML@H@H uAEE9u2L KIZL[]A\A]Ek+L 'E1+UHHdH]d@ATIUHSHHHGHD$Hj+H`{HLd$~P{I+Mp+L;c }'H˾O+LHx<+Lc HL[]A\\c+v+fATIUHSHHu+I\$H1LD$LH5 M誻toH.4H8HH=+H|$HHxHXH@ HJH9GuowH+HE H:HH[]A\Ld$*fAVAUATUHSHLwHHuHHmIu2HS HxfH H9MuYH;U}SLdI$[L]A\A]A^LIHtXE1M9}HCHJtRiH]*KDIHsH[]A\A]A^*iHH=KtNE1뇹H=Kxt8ff.@ATUHRLg%HHt HEHA$@XL]A\AWH=gAVAUATIUSHHH1L8EH)HHHI9L5gHHL ha)H5mgLeIH9*H*1HLS~u)H=I)H=L)~u9LLHg(HHHHH[]A\A]A^A_I$L(UHSHAPHt HjH9tHsHu%HS HsHY[];HH=GLruH=G谺uZ1[]fDATUHHSHH:fHnfH:"I)$Ht$1H0HT*fo $HIHHL[]A\fUHHH1*HH]Off.@ATUSHHHGHtMHgHH9Pu!H{1H;HH}H[]A\HHIbM)1Dff.UH"HHt)H}HtHEH]H@f.AWHHAVAUATUSH8H*H)H)HH)HL)L诚IH1WIH**L-M9nH\$LH@|$HLIOLǛIHHpH;5(tL9u3HLn@|$u!H*MI)L9 LHHWIH)LHLILMv)L=dM9~L"IHu(aHo)LH8L[]A\A]A^A_HL藋LH\LTH(IL>)aHu H\VIMAVLH\$T$ L胚HHt(LXM9P'L$XHHL$L`H'D$qI&'DHfHnǺfH:"H=H)$HHfHnǺfH:"H=ԜH)$hHHfHnǺfH:"H=ĜH)$8HHfHnǺfH:"H=H)$H11"HGHD(Hff.ATISQHGH;(I$LZ[A\ff.UHSQHCH;HtHFHDu 1Z[]uHH(H;HsH+1]ff.H5I@H5@SHHP(HsH;1[c1fSHHE(HsH;[0fDvfDSHH*(HsH;[FfDAUATIUSH(H H; (^HuH-KHEI,$1H([]A\A]ÃSHH(HsH;[SDSHH(HsH;[DSHH(HsH;[eLDAWfHnfHnAVfH:"fH:"AUATUHSHH8H) $L8LNHwI9tII`Ht HH9Qpt\Hv`H(H=H9~p(L%:E1L|$ LH5L)D$ kXL9/(H8[]A\A]A^A_LF`M (I9Pp>(L|$ fo$LH5xL)T$ XfSHH(HsH;[UDHfHnǺfH:"H=H)$xHAU1ATUSHQHw(HGuj-fH{HQIHtQHs H{,HH7(H{H$HIM (H{LkZL[]A\A]E1ULIIHoL9tH;-€tLHtJIjL9tH;-tLHt LL]7H5HuHmH]H5`HtfATUHQHIHtHHHHH' LZ]A\@AWAVAUIATUSH8HD$H9LNL; 2HH5I9tLM9tLIEL|$(Lt$QHD$(HH(L`HELHHl$ Ld$#&uLHH蟔&H/ Iu(I} LLuL L-9IEH8L[]A\A]A^A_LLgNH{LsIH;HT$L|$HT$Lt$(Ld$ H Ht$MLLLܑt@Hl$ HT$HHEHH$ #%H$uHH豓t%L-qIE3H)L-XIEff.AUATUSHQ IHH{H{ HHwH9Gs%HH9WHwHO(AHe%IL_ IkHHkL,Hx H|4%IuHfWHHAoMHH{ AL$HAEHo HkHyHCZL[]A\A]HE1 L~H59I8+H HO,ATIUHSHH6$HsL[H]A\ff.AVAUIH~ATUSH LVHIL'H&HHj$HgHHK HM$LIHLpHF$HH9b$H< fInHfH:"H=$1 HtHH9u1) $LA0H$1I9fo$HX(H@ H0@H []A\A]A^PAL1LHD$Pjj> H HH1f.ff.UHHHt) H} Ht H}Ht}HEH]H@ff.HH|$Ht$H=vHff.ATUQHH*#HF9#H~&#Lf Hv6eHH"HLHǺvHA[DZ]A\AUATUSQHv#HGH b#LmLPIHt)1I9~- H#It$HHZL[]A\A]L;md#HU AHZLR(H#IL](IM"MZAI1I9~IMHt I\$IH HHHQHHA Iʐ֤fDATIHUHHHHT$]"H|$"I|$HH\"H<$Ht$H"H<$AH|$HD]A\f.UIH0H-a{H|$HH4$H,JtqAAD$(L$HIz Jo"Ht$ HxVL$ f. / z+"D$(Ht$H|$0D$MdH0]Ht$(H|$yHD$H$UIH0H-zH|$HHt$HkIAAD$(LT$HIzFIuiHt$ H|$3xrL$ ff.z!D$(L$fd$f.zt+f/f/8uLocH0]AJL$ fT%S. f(HD$Ht$(H|$HHD$XfUISH8H-xH|$HH4$HkHtfAoa)d$ H$HH{LHtyok)l$T$\$D$ HL$(Z}!t$H9H8[]Ht$ H|$y H:yH5H8%1Ht$Hy\ fUISHHHH-wH|$HHt$HG Aoa)d$0LT$HIzcGHt$ H|$\H;zff.D$(H1+L$ f( $?$f./ f(fT-v, f/H,HT$0HD$8HfHnfHnHf(f(r  r uX$L$D$t$fD.- 3D b/ @fE.!f.5- ADfD."t|!$L$N7HH[]fHnfHn$L$nD$0L$8T$ \$($L$AAoz)|$ g녅tG!tJ"sL 2yH5I9"1fHt$0H|$u"LvH5:zI;j"1%H-sH5YH}L"1DfD$~=+ -* fET$fEfL$fD(l$Dd$D)|$fA(fA(fA(ffD(HH9HtTfDYf(fA(YfEYAYAYDYfE:f(fE\DXD)l$DfE(Ef(fA(HYAYAY\fD(DXfD(fEfA(FL$D$ff.Sff(f(H@f.E„tf.Eʄzf.Eބtf.@E@f(f(\$(d$ l$T$T$D$f(T$sL$fH~D$ \$(fEDd$DL$DYfA.z1u/fA(H|$8Ht$0D$0fHnYYL$8H@[YDd$DL$\$*fLnD^D$fL~ D\$Dd$AYDXf.z[5f!f(DUSHQP=pH{`.Hߋk6%Huk1qZ[]HHuf.UfAnfHnSfA:"fH:"H(fnL$@f:"L$HflHHH|$PHHՉ)D$)$фHt fo$fod$HhX X`8H([]DSfAnfHnfHnfH:"fH:"H0fnT$Hf:"D$@f:"T$PflHtHH|$XHL)D$ )L$)$2Ht'fo$$fol$ fot$ HX(`hp8H0[V K@Y@D@UHG!tHE8He]fATUHSHtt;H[]A\H^HtL#1L9}uHtH|$tiH|$HHvHtH|$kH|$tBHuHtH|$OH|$t&HuHt8H[]A\ø1ff.HHHGH=g`Ht$HD$Hff.Gz fAWAVIAUATIUHSH8L-tHt$AAD(ANIADuAHt$(1LH4$:f.& H4$f(zH\$(L9ED EQA1H$f.;& $zsLt$(L9BA߀JI^f ADEt)usHD;CD)$H)H;\$uQ1LA$0Ht f( $HH8[]A\A]A^A_E1AfAJuf(HfpH=lH5sH?1=GHHlHt$$H;{iHt$$A6# ~@EAAJxI^fH;+S# LsIFHLkD$$I;D$$H@+th$ IYff.@ w&wntfv't\1Á_ w0' w1à w,1HH10Ã1øff.UIH@H-IlH|$HHt$H<Aoa)d$0LT$HIz;AoZ)\$ f(D$ L$8T$0fYT$ f:fYf)$$L$,H@]@UIH0H-lH|$HH4$H|;AAD$(L$HIzX;Ht$ HCxlL$ f. ! z>D$(H|$Ht$!L$D$H=jJH0]Ht$(H|$rHD$H$ff.fAUATIUH@HF~ HIHLHMD$1LL&tLH@]A\A]L1AWAVIAUATUHSHL9L$HHLA>E1LD$EtCAM)wHHu)MvDAIvKHD[]A\A]A^A_H$f LL$D$dL)$)$H$0AH5Vo$=L肮 f(f.zL蒮f.f(zE1$AAEAnD$AD$HL$hDDDf($HD$0HH$DHL$lDDHD$8IHHI-LH"HLI贰H$HLL蜰IHL $AA ƒ -@II09-@ƉAD$ Ht$- T$(ƒ-@/Ml$0A}-@AHAAHT$A-DD$ Ht$H<$HL$pHLD$\AHt$LLHL$xLD$`'$n$L$LL 2 I1H$HD$dH|$HL$HDŽ$PHD$HAWAUL$tQL$HL$0T$HH HH|$D\$`LL$xLT$@H$`M1DŽ$+H|$(ARAWAUASHL$(T$@4H HMD|$HغH$D$GD?McIIIH9A>IE1M)T$d9UHtHLT$ LT$ Hu]D$Ht$ MMt!L} H}DLK4LT$@]LT$@LU |$LU |$u1PE1E1HjAUjHL$0HT$ Ht$h:H  RE1E1LjHAUjHL$(Ht$H H AǃHE uuHT$ |$jHM HYH] >Lu H|$0H|$8H<$QLIL D$D$ArkLD$ H<AjH|$HE z7A^IM)E1MCfnl$dfn$Mf8?f~f~l$d!f.  zD$D$E1Ar1Hu H}LDLT$@LT$@u(H|$ B(HE /Ht$ D)HE iLL$ C(IAM)LHIII)HHHL[]A\A]A^A_Ff(fT% fV%@ f.%8  D$D$ruLE1E1M{ A^tL4 / i % C @HHW IAAA @HO0H9}DADHgBtHAu1<.u HH)A8I21E18LMuHLH/`HrH8^mH5g1釻GOH=E@DLjf.UHHSHQ[ HCHH`H`;1Z[]DAUI1ATUSQH_HoH HH@1HpIHtcH5{H ou6LLH=H聕IHLMZL[]A\A]HsLH=u1KI HG(HuHcHff.ATIUAQHFtS~ Hg A1LHHitCu YH]A\HUIt$HAX]A\HHeH5H=y{Z1]A\@1fATIUHHHD$HuKHE1LD$LHp1觌tHt$HE0Ht(HRjH]A\HH= Fu1H@H0ff.UHH1SHAPlA HHH! Y[]Zf.Hw1H=~ff.ATIUHSHFHHH5t*HuHsHHuI|$[H]A\aw[HL]A\RfAVAUATIUSH@HGHHLh~yIt$H H5<Hl 1L5ܒL9|6M9 H5Hx?HH@[]A\A]A^H. IT$HHtxH f.AUATIUH H;5`HD$HD$ HLl$H5LH ?I H|$H HT$H59H> H|$ HT$H5H> H|$H H;=_ HGo H5K)V H|$HH|$HtH|$HtvH LHrHAWH D]A\A]f.ATIUHQHFtH5\H蚊/ XHL]A\AWAVL5E\AUATIUS1HxHGHl$0HPHHT$wH;\$SHtH5HhHD$IL$HD$ LlL;-]]gL|$(LLL4= H|$(HHT$H5r[L = H|$HT$ H5:[L<j H|$ H;=.^HHw H5IR H|$IH|$HtH|$ HtMHLLAEHHfHx[]A\A]A^A_RLH5ZL<H|$(H%LIX>sff.HHPfHnH(fH:")$H! HT$H=oHڞHH 1H(fHHWHHHzHH9yfATIHUH9HHLHH2H]A\DAUAATIUH@HHVtH=D$4HD$(H=ʪtfH=tWH=tHH=t9H=t*DLH:tHH@]A\A]FPpDAWAVAUATUSH(AHN_IIHc HHvH(L[]A\A]A^A_1HvMNE1A9HH5L覿]IvDL^EH(LH[H5]A\A]A^A_dLnL# A}H5;HL,Iv#f.AV1IAUH5ATUSHPLl$HHD$LHL$LFH|$HH]LLD$0H<$1BHHHǻ HIH<UIHZHHLHجLHHtH~LIMHHPL[]A\A]A^LH蒲GE1I9vfDAT1UHHSHHHuLC LKH1LSL[HT$ WHKHAPLC AQLKARSASmEH0Dd$ AlCSA$DCL {JfnAf:"fnfA:"flCL9MuH}`L%VXL9uH}hL9u H[]A\%/HC0Hu1ӃHC(-H@@HXH5H;1QGtf wsO tc;?=wewtAmDZGAGG HRH5H:E1LeRH5I;E1HJRH5H8E1H/RH5fH:E1kH=RH5.H?zE1MLQH5~I8\E1/LQH5GI:>E1fDUH=ëH|HHdH:%,HNHUVH]ff.@ATIUHSHHHt HӅuI|$ H HH[]A\fAVHBAUATUHSHHHhHLmIHLcHH L5HT$HL,4H|$u8H$HI9MLLLkHD$HfIl$ALt$I9|LHL[]A\A]A^11LHHKDIH}&IHtTH:LHHt;HHtIHHsLE1_cE*Ht*E1QHH= tvAUATUSQbIHthL-EvHxL LYHHt2LyHHHhHH@H@ LIZL[]A\A]fATSHH=#tQIHt H@HH@ HHXLZ[A\ff.fATIUHHHARHEt)HH8HD HtH1HL1HX]A\kHAYHLHH?]E1A\+t4H|$Ht.H;=.Rt%1H2tH$HH[11蠺H$f.ATIUSHHHH5UO0tsLD$D$f.D$HD$D$M$f/ rF  f/v8H,E1HHD[]A\LAnHHu'HEH9QH5*UAH:H -LH569AH9HH|$H|$MH1Hff.fATSHH=sQ5IHHc{HlHc{ID$HHc{ ID$ Hc{ID$(sHc{ID$0eHc;ID$8XID$@CHc=Hc{ID$HH+Hc{ ID$PH{0H5sID$X舺H{(ID$`ID$h%HLZ[A\ff.@UH'H] fHH <LGMtHGLX1HÐAWfHnfHnAVfH:"fH:"AUATUHSHH8HN) $L8LNHwI9uXHv`HH=H9~ L%KE1L|$ LH5bL)D$ 1 L9t[H8[]A\A]A^A_II`HtHMH9Q uLF`MiI9P tt$f/5& r{=$ f/vmDD$H,E1I,HHU=l$t$Xl$\5 l$t$\\$5 Xt$\$t${H DH5sHAH9HEH=c?HEH5d,AH?ff.H rfAVAUATUSHHGHD$H$ HVH HHT$LoL3nYGS|#H<$HI9IH MLH=AHELd$I|$AL$H}xDHDHuu;Ht$HfHnfH:"$@H[]A\A]A^HyLLMxqLILl$MH<$H)HH<$H,$H|$Hr]HLHqH`I;)LIPLt$Mt)H<$HH1Ht$HHH<$H1fU1H Hl$H 1H|$H~HD$H ]fSHHHt$AHD$HE1H[f1YfUSQHG HC Hk@tTH6HS H uEHsHx @ @@L@HtL@0LZ[]Ã<<E땀@HsHt?DATUSHGHG HHH9wA}AC @@|ƒdED9,ƒ u"}LSH@gfE$j[D]A\ff.AVAUIATIUHSHHH$Lt$Hty1HLHNHt$HNPHPu0L}MH=;HT$L1H5DH?*H[]A\A]A^H$I9EITHH$HT$zATIUHSHH HH1HWH?H9EHT$HHD$Ht H []A\H=HHD$H:4HD$ fUALʼnSAQHAHHHCH;:JAECADAAtVAE1A!EGNL LكH\ ML>uH]H[]øf.ff.UHwHH}Ht HEHEH]H@DATUHSH_0HGHH9P0aHHIbH~HrH| HtVH]H@M0[L]A\fHHG  HGÐSHH3 Ht*Hs1H9~HL HtHHL HSP[fATIUHSH HHt HӅu-I|$(Ht HӅuI|$0HHH[]A\f.HHybfHH^bfHG(HpH8gAVAUATUSHGGHH(HHuvHLkI9.MuJ<ЁIHHLHs Lc(`@`LHt LCILE[L]A\A]A^HS ``tUHHH~H9H5@H8xx H]&nATUHSHO(1H@HL$I9v>H9wډvH-,6H58U1H}荑,tH谀HEHHH{E :HM(LHH)HHHH9s)DHHDBDPDRDXDZDHDJILIE1I)III9NMGIII9MGIM9sE IIEK} @ HMHHU@E Le@LeM IDHuHE Hu8H}(Le0HE(HE@M 1[]A\@AWfHnfHnAVfH:"fH:"AUATUSHHHH;9) $H8HL8LNHwI9u\LV`MXLM9Z(GL%35E1L|$ LH51ML)D$ d L9HH[]A\A]A^A_Iy`HtLLH{ 1DIHHH59L&LfH{(1 IHHH5LL-H{01ҡIHeHH5LCLHQLSH{8zIH8HH5LlL謿H{@1QHHHH5L3mHsH{H1IHHH5\L'L:H{P`IHHH52LLH{Q(HHVHH5LHʾH{RIHHH5ҼLRXL蒾H{SIHHH5LLZH{THHHH5LH"H{UHIHvHH5UL調 LH{VIH>HH5,LrL貽H{WHHHH5L:HzHT$HHH$HD$LH$H5LH<$-HT$H5LɾH|$H{HH\HH5ۺL萾HмHL[]A\A]A^H1vH{1[IHL1Pff.SHǍIIv1[fDAVAUATUSH1;thHcǃtuHccIHt9LcN,3I}DH$IL$JAu@t@u[L]A\A]A^[1]A\A]A^AVIAUIATUSH/HHH11aHH@HH18IHtHHeH;1IHtVH{1IEHH[]A\A]A^LcLg}cHY1A<$yKYAUIATIUHGHHP`Ht HHuLLH 6H]A\A]o4LH;->]A\A]UHGH *HDH0H8HJ3L33LM H3]SHHHH{Ht HC 1[DAWIAVAUATIUHSAPHGHHHHH9HNH)IH8vHLI$vIHJIWMAHsHt&AAyLTHHLHHMTHH M^H4Hsu_Ht!A^HDLID HHHL&ULI$UHE1Z[]A\A]A^A_AOAItAtD>E~DlEl fHIHIHL1E1ۃHHHHtXHt.HXFA)DC+ ?B4IB)ʉC+ AA?FIB4)ΉC+ ?BIFA)DC+ ?B4IB)C+с?BIFA)G+DA?FIM9@B4MS)C+4?B4B փ)C+ ?BMSB )C+ ?BMSB )C+ ?BMSB )C+ ?BMSB )C+ ?BMSB )C+ ʁ?BMSIB )C+ ?BM9I9YQFMIQIAKIA?@B4DH9MItTIt'DAEA?A@DIQD AEA?DHA@ ΁?4H@H9|gB LR΁?@B4tnF LZAEA?A@FtKB H΁?@B4t,H9}JDLZEBEA?A@D sËA+A?f.HIHIHG1E1ۃHHHt{HtRHt-H GFADA?DB ICB?B4IGFADA?DB ICB?B4IGFADA?DB ICB?B4IM9fDGFADDMS?B C B щΉʁ?B4MSC B щΉʁ?B4MSC B щΉʁ?B4MSC B щ?B4MSC B щ?B4MSC B IS?B4EDDщ?I4M9I9)!FMIQIAIDA?AB H9MItFIt DEA?ADIQDEA?D HADDށ?4HAtzH9|YDLJEA?ADtXFHJDށ?AB4t=DHEA?ADt!H9}9DHJEA?ADuË20A?DH'H8HJHcpҋfHHHH1H(HHH?:H'H8t =5HqpH(HHfLG`[f.ATIUHLSHH}ML$HXHtbHALLWHHxHTHL9tI9t HHL(LL9tM9HHu1LHӅ1[]A\ff.SHHHuH{Ht HCͯ1[HC輯f.H G LG@ @t-HW0Iu?u$:@x(H'<8HxKHWHуtm:vHcE1Mt4M9$u6B< wH E'<9tIĵuH$HHÃBOH\$`HLL0KHt$XHD$b0T$KHD$`HH8LLnOH\$`HKL9KL0BKHt$THWD$/L$ KHD$`HqH0LL_NH\$`H KL9JL/JHt$PHA{/EJHD$`HHLrfN=JHLRflNHHuxL5fONvHLf/NcH(LeNXbHLeAŃMYrHLeMNqHLeM^H0LreM\HLRelMSHL2eLM$gHxLe,MV_HupLdAŃ MW^H LdLvHLdLcHLdLNhHLrdLPdH`LRdÃjLHL0dJLHLd*LHu`Lc L0NHLcKOHLcKKHLcKLHLLpQL|$`MyAUIATUHSHQHHL]:yAątEE1ZD[]A\A]HL]yxEAUIATUHSHQHwLt]AąHLQ]HL1]AăotE1ZD[]A\A]HxL\?[HL\AăCHL\1HXL\AăH Lx\HhLX\AăHL5\tzHL\t^HL[Aăt?HPL[t#Hr LH5HH81cAE1zoE1aVE1H= E1/ $ E1 E1 DAWIAVAUATIUH-zS1HMvI$H9};MlMvAAA;OvAu\vHc|HH[]A\A]A^A_MuHG[H5ZLh3v1ɺLLnvIuLAAA/tH7cvff.H~H?~AVIAUAATAU1SHH~HH9|[]A\A]A^HtH~DLtHATUS;GAHHQwH5JHcLIeLA.?ELHjwHĠ[]A\A]A^f.ATIUSH萬HHHt$ HWHHD$ HsHIAA$H[]A\ff.ATAUQ=D1ҾH1@fHAU>E)DZ]A\@ATIHLUHHSHMIXHAQLE1HT$R1jjH HH#H8Ν…x*L@H(Hc+H[]A\ρfAUATUHHSAPF0< ށtҁ< tf@0<@@Z[]A\A]Pff.fAUHlHHATHfHnUfH:"HpHf)D$ HD$0D$HHD$PD$ L$8L$XH-HHHl$ H?HMfkDd$ HT$XA1H5jLH=0<;H|$@I\ALToHu"LHsAHD[]A\A]H= H )Ht$@H H{GyoffH*T$HY H*\$@XS%fDATIUHSH Ht'L+e1Mx9H9]~3H|LHIH5gH9p~pH L[]A\DATHW$UHSHHH9uHuwHuHH}HHto1 :fHnIfH:"Hp1)$H0Hpfo $H@ @(HH[]A\HH=7Kr1ܹH=^1ff.fATSHQHHu3HKHQHtwHC HqL$HH9~9HC I$LZ[A\xIHt{(uH{Hto1輼HuH{HtHCo|E1UH'|HHuH}HtoHEH]H@joATIH~USHLVHuvIBLHwpHH/uZH[L1A$0IHt}H@ HH@(H@0HXHID$HtPHL[]A\H_HZLVAL]ILHL$Q1jjynH HH^E1Lnf.UH{HHtinH}Ht[nH} HtMnH}(Ht?nH}0Ht1nHEH]H@AVHwAUATIUHSH0HD$ HD$HD$H9u H3L-UHT$LH1RHL$ QLL$0LD$8ZYtHlH|$ L5HL9]H51H6HHmHqHgH|$L9tHuWAH|$(-IHu1H0[]A\A]A^1LA$0HjmLpHhHX Lh(H@0LI0WIHlHL H5$I9o1L-"HLigL9HH3HHt_H|$L9tLH3هHH7HtgH=~H5#H?1H1HHtgH|$L9tH3kHtL&H5#I:菌1H|$L9tH1OUH7xHHuHEH]H@kfDUHSHAPHt HJH9tHsHu(HS HsHY[]SHH=q uH=UmuZ1[]AWAVAUATUSHQLoIELLAIHtOH{H;=tTH;=tKHGHHeL%'LO>eHSHKL1H5Tg HHoeHK H{H5IHHD1 HHFeAZI[L]A\1H= gA]إL-aL=eHS(HKL1H5fX HHdHK HsIH=fHHDff.AVAUATUSHHHdH{(H{ HH{ޥIHdH{ ɥIHdH=~HLHaIHfdH[H=aI|HHuH=(%HHtH;HY[]鶚fDATUHSHAH}uoHUHt$HD$HzvIHt'HMHH=/1Hq%LHZ,IH|$HuHŮHL[]A\4,HIHtHELH=[0Hp1LH+IfAVIAUATUSHHoHuQHsHu~I~Lkt^H-IHt?1H9};IFLHtlH@IDHHH=#^IuE1[L]A\A]A^IV[L]A\HrA]A^!H=]tcfAVHAUATUHSH9Ft []A\A]A^ LnHIE1M9~)JtLLH*Ht IIE1[L]A\A]A^HHWHwuH=.1C}1EATUHV?HMH}H.H=-HEHU1HqHIǬLZ]A\ff.@ATUSHH~?HFHHHHD$?HCHxIHtRHUH|$HHT$Ht$It$Hu8I\$ HUHkID$He?LIHL[]A\HATUSHHHG HHxH=\IH?HH5LH+)H>oCHK HH)$EfHI(HSL1H=2{H[]A\HSHjH}*HtHK1HHHH9|HsHH1[H=Sg]A\6{H{LDHILDff.AWIAVAUATUSH8躩m>IG E1HSIWLHjHHE1*IH%>I9MH= HH.>HLҕHH'H>IwIWH1H=),HvqHI'LM'LH8L[]A\A]A^A_MGK|#JH=KDIEHL$ Ll$(HD$HL$Hl$I HL$LHkuAI9LH=H1ILSH˙HL[]A\A]A^A_Ht$H= Hl$H IHtHI'LIMzE1H=HH=&[H]1A\A]A^A_鈿cH_H CLH9HMu24HH=a#[]A\A]A^A_jf.AVH5WAUATUSHH5H3HH[H3HH&IH31Ht$H=H\$HIH3HߚLIM3Hu^LLHsML10LHHu:LHH[]A\A]A^)IHZ)3LHHTfUHHHSHHu>H 3H2HH2HH0uJH=HH[]HYHRALHHT$R1jjH HuHP@ATIUHSHHHu0H{0HuH{8Hu1[]A\[LH]A\LՅtHՅtff.@ֱfDHH#2鹱fHH2陱fHH1yfSHH@ILHD$HtHHT$0HtHL#H|$HH1H|$0H1Ht#H=gCHH=H1fHH@H[ATIFtx I$LA\E1fATIUHQLWH5LVAHEtIHP t.LLPIHtHHs0LZ]A\L%I$LULfDUHH`HuHHc1]HE`ATUHSHHt0[H=G]A\W H"IHt'HELH=Hp1LH3IH訔L[]A\SH'HSHH{0Hu"H/HkHMD(ILf.PZHHW1HJ(H HB HHGHff.AUATIUHSQLNH5>I9tQLJM9tELu9LLu*H5sLTuH5ȉLxT*/LxVIHxIHhVHx<b/H ӎHc4HI9.HL4u .1x.H HZ[]A\A]fDAUATUSHQQH.IAHHHA'E~!L蚖HHu\HDELZD[]A\A]ff.AUIATIUHH~.HmH}x.HELHLSHAD]A\A]ff.AUIATIUHH@Ht HAԅu*H}HHtLAԅ.LLH]A\A]%.AVAUATUSHP=p.{`-DcD9cH5-LCIc{`M EiEq-HHHu;{`DcHHt^DIASL[]A\A]A^ËsH{O&IH-HLK DDD@ Hj"IHub-DcHsIcHA`A_,LIH A`A_LSIHH A`A_- L;+H A`A_, L+H A`A_x, L*Hs AA`Ao PA=pC,Ic_A;_+IOH4DvDnL4IH1EAA`EAo,LIHtA`EAov,EZEAp7,McwE;w /IGJDrZLPIH AA`Ao.DGEp.L)HEAA`Aon,EQEAp/A_A;_/IGLcJDjDr LN)HA`A_,L))HQEAA`Ao0EHEApu-EoE;o*-M_McKDpXL(HL(HAwIH,H DHAw 1A11QDY^H+AIxAwIH+fnHfAnI 8f:"H fA:"I\$fl)$>IH(+fo$H@HXP(ALLAA`Eo-L'HLHtt LH$}'A`u\Li'HtJAwIHZ(H<$DHDA؋@ 1HWAw 1P{A^ZH(A`Eo-L&HLH$H L&HL"HD$H L&A`L&HAwIHB*Ht$Mo HP LFH4$LL$ T$(LD$IH)I H4$LL$0ƹLT$0HH)AUD\$0ADLASDL$0HT$(D[A]Hu)A`EopL%HEAA`AoqA^AAp<&A_A;_^#IWLcJ4DFDvD$LoIHt(LJ%HtL8%H A`A_)L(IHL$HuLHD$H_ L$A`GL$H1AwIH'APDP E1Aw 1LARDXASDD$ Ht$8AH HI'1LH5TAwIH%HMO LDD@ DgIH+ALIH, L#A`L#HAwIH)D@DH LI D$DL$H|$ 4IHO)I LLT$(L\$(HH )t$ D$ LAD1PDL$AZA[H(LA`H$ L#HAwI<Hj*HMO DDD@ H<$YH\)L3IHL"HAMA`A_)Lz IHA`A_"LW IHAA_AyAAo0AwIRHHMO LDD@ D0IH?L7A`HL!HAwIH!HMO DDD@ HHn!LY!HLH LHD$-!A`L!HAwIOH!L\$xI_ @ |$LH߉D$ L\$(HT$(HHE!I HHL$(MLD$(HH0!I LD$(農HL$(HH WLSt$0VDL$01AQDD$ E-H H L> HLMHD$ H L HLaHD$H LA`LHAwIHD%I_ HP Ht$H߉L$(T$0@HH %Ht$8I Ht$LD$8HH$I LD$肱HL$HH$VLSDL$@AQDT$@EARDD$ Ht$@H H4$1LH5N9OAwI4H"HMO DD@ LHV"AwIHF&HMO LDD@ D IHoQ%AwIH"HMO DDD@ H=lBIH+G"AwItH%HMO DDD@ H=nIH$AwI0H7%HMO DDD@ H=lIH`$A`HA=pVLHAABEAAgE1A%AEAwIfHAQx E1Aw 11WL@PDD$ H Hx{AWAVAUATUSHAPP=p${`$k9k$HsHcH_AXHtDC`1EKfDATUSHP=p"{`"DcH5MH2eDcHuHQmHHu Dc1IqL[]A\1HH5Ht˺HHdIH"fDAUATUSHHP=p"{`q"k9k,"HsHcH LJ HAA~`AEnu]LmHHAEfE1Lu IFLcA~`J؋JDz $_AAvAvI~HoDH D@PDAv H=Y1L$EZYHHff.fUISHQHH.LH0Ht1H9~HKH4H~H|HZ[]fSfnfnHfA:"f:"flHHLϾ8)$iHtfo$HXP(H[USHAQP=pm{`|HߋkJH`8u'HHH5iVH9quDEHDZ[]H=L?WLc@(HcP LcH,HcH$V1WI2HhPc/_AXHtDC`1EKDAWIAVAUATUSH(P=pA`AAOsAL$pLIHAoApA`Ew{HHHD$Eo`1E L HuoEwIw H~IHMcL9xHLLLAAHtkA~AH([]A\A]A^A_LIHtH9\$LDEwHRNTM^AOjAL$1AOf.H8fAnfHnfnT$@f:"T$HfHnfA:"fH:"fH:"flHH|$P8)D$ )L$)$gHt#fo$$fol$fot$ `hp(H8AWIAVAUATUSH(P=pA`AgAOsAL$ pLMHHADGEpA`Ew:IHHD$Eo`1E LHEwIw H{IHMcL9`LtLHLANAHt)ADGEH([]A\A]A^A_At$ 1AwOIFANL2IHVH9\$GM EwH$DATUSHHP=p{`HDcYHHtrHHt`HfHnfH:")$HtCH{ dIHfo $HIȃHL[]A\Dc1AVAUATUSBB;B HHӃw*H[IHc4HHHLdnk[]A\A]A^HHtHLu?HoE1IcH}LEL9}H|HtHLLALoE1IcMFIMH9|CHmE1IcH1HUH9VH|HtHLAI|HtHLzAHoE1IcHcLEL9H|HtHLAHHL$LmE1McMt|MUM9}K|HtHL5tsAHm E1McE1HtLuM9`J|HtHLt:AE111E1{v@AUATUSHAPGHGH;GLHw!HwYHc4HHuDSHEZD[HZ[]A\A]HuHHuHtыE4HKHPU0RDM,DE(eY^LmE1IcMI}H9}ItH8ALeE1McMTM $M9|ILeE1McM@M$M9|HuH0ZKtHAKtHkAHmE1IcHwLEL9HtH}HAHuLeE1McMI$I9}-KtH5AHuH`Hm E1Mc1HtHMI9BJtHA@1yE1E11eff.AWAVIAUATUHSHhH8oN(DF(BH+WHHc HHv(L L[rHLE1=AHhD[]A\A]A^A_H~}HvTHhHL[]A\A]A^A_SH^H$L+1IAI9HDl 1u 1Hx@A!HL~LnM IM MeL9GH[HE DLH$u@rHL=L +MoIN8L,@L蜱HHHLHLvYjrHLRMD$I1-LH0Ll$1Hl$LII9LlMAM IuLy IuS L_ LLeL H$E1AIHE D¾ L>rHL jMIV8L>BL.IH.HL'AÅLLXrHL? H} HGHE E&<$k HL;AMoIIL$I9NLA9DIILl$Hl$LHMV8LLfADHM^8!LA=(HE rHLg  Ll$1I9Hm IV8LS=I~8H<$8 L)=Hm In8LE1䋕=A<$u#MF8L\LAVZL+Lm E1M9~#Hm JtHL .IA:HD$L|A?|Mn8LAe<HխIHHL L.Iv8L<HLL HxHD$HiLcMiM,$L,$LMH<$H\$ E1DUL]E1o]HILL$(DT$L\$@H|$)\$0L;<$THD$ Iv81HPJ\o{(舛H% H}HEBL9|$MV8LE1Ƀ|$HEAfEAA!DEDM:HHLL]MkMM;l$u MI~8HT$nWRb LRHQ HL3 > IL~H{ HvH<$Ht$MM'H|$E1H<$AM98 O,ICL\$L9" M.HsL-LHHm1L9HL[  HI~8L⾘L#HE rHLbMkL$L<$1LD$H9\$;I9ML $MlA}uI}t}MV8LA$9H蔪IHHL LM^8LA8t]HLL tKHOHvHLE1ABHvLtL RE1HE D¾LW8tHsHLTtHm HsIMoH} D$Iv8LLD$(HT$@fod$0EHULEeI7Q nHL9 M~8LMHL$Lm I_pMQHKO\1IIOpM|$ML$I9H|$(xLpOMHxAAI $A!IMV8LA%7I}蔨IHHLAÅ LLmPf\1E1M#+<$w HL MM)I9 M^8L^LA $cI~8H$cL  MD$I}I,Hܒ  I}H+ HvIyE1NL|$XI]M|$H}I4讪IHH9uHSIHHH}HP1HT$PdHHD$HIHT$PH}11LD$H`HH}LL)HLD$H>L=IF8LcL IsSL|$XLL|$MlHt$HLHHLHLd$1H\$ LILIHu8I9L$H|$OLNdHAoi(L/ ILH9tLT$LHT$(ItHT$(HLD$1H<$M(tL $I L9ILIH\$ Ld$os("L3uH4$HLYH} HHHE1HLIH$L9$$NlA}u I}HC8M9Hi3M9LФHHHHD$HT$H"LS8HA 3LLHxI9LIHHhLH5Q1[]A\A]A^A_ PE1WHs8Hߋ2H<$L)HHHHD$HT$<HOLC8HA72 H|$@H|$(MLE1HLH5g1L<$UOL<$L`1M>HHHHhHL1[H5]A\A]A^A_ OQHhLH51[]A\A]A^A_NHhLH571[]A\A]A^A_NH57L1NH|$@H|$()@AUAATUHSHQHLf L`L=HSH}8DJHHHHZ[]A\A]ATUHjSH9n}SHIH4H{+HHCH9k})I|$8^HHSHKHrHsHѸ[]A\DUHSHHH~tfHCHU8H{HHJpHCt(H<ǾHyHzpH0u4H7HqHrpKHCH[]GHAADATIUSHtuHӺH*H;HAuiH3ID$8HS H~cHT:LH;H%[]A\LG8A*/AA[HL]H5υ1A\vLfDUSHQjBtkZ[]ff.AVILAUIHATMUHSH^u2HL? u#LHRIH[L]A\A]A^MnXMu$H58HKI1HLH6fDATH/;USH9FӃIHH9Hv(H(uTI|$(uFHuI|$u.I|$(HČuHu I|$ 譌e,,H:H[]A\w H7H$ff.@Q xZff.H97uHVxN(H7L1 HB HROfHnLGHGfH:"G ff.@z,AVEAUIATIUHSHB0HӃy`Hq B,xXLlU`Hw<]HEdHL$0DLAH{@EdLHK01k,[]A\A]A^1ËF(UISHHtH~HHtOH9HHH8HH H;):H{HHCHHt1H[]1@fAWAVAUATULzXHLr`LjhBXHBhPt$8ZYLLLHA萑]DA\A]A^A_AVIAUIHATMUHSHcH m&HރfHnfH:")$MLE1LHLd$IHIY3MkH L[]A\A]A^AWE1AVIAUIATEUHSHHDL$I9};KtLyIHt5J|EuCI9"MtLIH[]A\A]A^A_HD$|$LD$uff.@AWMAVIAUIATMUHSHHHBH; :H;8H 9H9CM:HuLHVIH{0t I~8HIT$HuLLILLT$HT$HH[]A\A]A^A_Ã{0t I~8HpHLLH[L]A\A]A^A_Lff.ATHIHHHH HD$HL$1LD$HD$ıL1A$0IHH|$H@HpH@`PMsH LA\ff.HHGH;2VHWHlHGHDUHH`oH}NHEH]H@fAUATPLoLgH=#AXLLHA\H=1A]f.AUATPHGLgH=\#LhAXLH=gHLA\1A]ffDAUIATE1UHS1APH9]~ H|L襆~IHYL[]A\A]QHGE1HHLIH~LlHH=f1Zf.VHbHH=;1Yff.@H(HH51ff.fHWHwHt HOH1f.AVAUATUSHHHw0L54L9t H3HHtzHt$H=H\$HKIHHGBIHHsIHML1OLHL HHHH[]A\A]A^ÐH=]Ե@AUH5)ATAQLoHIH>H=)IAXLLHA\H=01A]1G(HG@HG@HHfDUHHGHHPHHAHHt1HPHH @\HpPHH`H@PHPhHpp@(H]fDHH^Iff.PjH=׾ZH1HATUSHHHD$IHtlHƿ1HHtJHT$H5LfH$DH|$tLHsHL$H1\HHHLIH|$HtHL[]A\H!2HHD$fDAUATUH3<H}HIHHTLI虺MID$LHPsLIoMeHUH;c/t1HrH=L1cIL9Hff.SLHlIATHxH[f.AVAUIATL$USHH(~&HL9s9+uHL)H[]A\A]A^HtDLDHH)%uHH9(u L)HHPHH)HHLH)H=~뫐AVH5AUATHLgLwLl$LLHt$HHFLH=^H18QH|$IHtfHLA\A]A^AWAVAUATIUHSHARHH0ltRHpLIHtPH{L -H1HjLGI1HLAY[]A\A]A^A_֧H_HH2u X[]A\A]A^A_L}`fLuXLmhEXHEhMtIOtItAXL[LLH]A\A]A^A_rvHLIHt*H5kMGHHH2j1H6L MtLL MBLf.H=Gԟ@HIATUSHPXHHtnH{0H( H{0TIH{0)MH{vHLH=iH1/OLHdHHYH[]A\ÐAUATUHSV'HqIHH}Lm@HMx5LLH=1NHHq(LIZL[]A\A]LH=-1NHDH@Hu.ff.USAPH~XHHnHHZHVH{HY[]AWH eAVAUATUSH(HGH;H|$HL$H|$&m1GnHHHH\$LkIEL HD$HH)IHH5uIwILLSHH1LHJMHHHH$BH<$AfL^EL*IHwH="M%HHt@HHHIM Ht$H=L1LLHHHLڣH|$УMtLãH|$9&H(H[]A\A]A^A_fSHH 1HrHuHK HSH=1Hs["Lff.f9t.USQ.AA9t:9Z[]øATAAw }HF$DA\ATAAw msHF$DA\AWAVAUIHLATIUHSH8MHHHHL}E1HH LHILLHp H~L?H8[]A\A]A^A_AWAVIAUATUSHHDg8uD%$ uA1=kIHHLkDHL9uELHH=J訚HH$HLHI薡MIv0H=ާL18JLImLMbHL[]A\A]A^A_H;8HHLHD$HT$HA!)Iv0H=x1IIDH=F1IIHTHL!Lff.HH|$Ht$H=f)YHff.H@Hzff.HG(HH(HHW@HH;QHDHff.E1gAIU'@@u D¸AÉйH5JIH4HcHsu6tAH>AI9IyN\HO\I)DL)HDAEFDGDff.HHHHHHHHAUATAUHSHQH($HH+ HfD9 tOH9wHZ[]A\A]DtHT-DH^tHtHHHH)HHHfD9"tBH)HATHIHHHvHmHcHZIt$(HL1蕹H=H HA\ff.@AWAVAUIHLATIHUSH(MHHHHL7LHHPHHHHHHt2L蓷ILLHx AL(H([]A\A]A^A_^@H@AT1SHQH(IHt/HCHKXMH=`HSPHp1ELH'ILZ[A\ff.AUATUSH  G Ho LgH@tLg0Hu,uA<$H[Hc]A\A]8tVA<$E1Ht2L9uC<,VtIރyC H;N~H;H5觲[H=HP1H5H?_[Ðff.ATIUHSHHHt HӅu-I|$Ht HӅuI|$ HHH[]A\ f.Hʚ;HHHy Hʚ;HH1HVfAȹʚ;cAUH=IATU\]HHH5ZILH֐HLH1еHI赐L]A\A]ff.H(HH51HT$ V|$ Ht$\ffH*D$Y H*L$XaH(ff.H8HH5G1HL$HT$ NHt$1H|$舨5H|$Ht$ |$ ojHH8A1H8ÐAUH1H5ؖATUH0HT$a=Hl$H H=sH5HD$HHT$ HD$ThH5H=hH5H&hH5uHhBH5kHgLHt$HsdnIH~H|$谇IH-HH5d/LR!L葎Hc|$*IHHH5LLXHc|$n*IHHH5LLD$ 4IHHH5L規uLL荫LHҍH0H]A\A]Ht$Hh_Ht$H@EHt$Hp+&fATUHSHH ILYHuLHH []A\H Ht$HvRHHSbffH*D$Y3 H*L$XCfH1H|$PH|$HAf.H1H|$`f H|$HfAUATUH0HF~ HH=}mIHLl$HEHU1HhLML$HPjLD$%ZYoH|$HSLnHHLLH1LI軋H賋H0L]A\A]6ATHUSH0Ld$HT$Ht$LmviHc|$'HHtWH|$HLnIMLH1aHH&LIH0L[]A\E1f.UHHHtH]EDSHHFfHn΀~ HH=})$fo$HtHSHH@ HP(PH[ff.AWHE1AVAUATUHpHl$Ld$0HT$Ll$PPLILHD$PLL$ZYLlIHLlIH|$HlL%HLDAIH|$ ubH-HEILLL1֤IL蛉L蓉MtL膉HtHyHpL]A\A]A^A_RHHufH?u 111N lff.UHHHtH]uDATIUHSHHf LHsHc[]A\$@f ff.@AWMAVIAUAATE1US1H(H4$Hl$HL$M9}^H$AtfAugB<`HdHL$1H49~ fnLfAnf8?fA~f~ H1҅HIHHH(H[]A\A]A^A_B< B<@APIAC@@u LDY9ptHcL2HHcI4LZAVHBIAUIATUHSHD$ HI>IHHLH^HxIO} Dt$ yjHUH9~RHپHH)HH!HHH4H)HD<H[]A\A]A^I~Ht$ au@Hv3@AWAVAUIATU1SHHHI1HHIHH EHIILH)H9HI)I9AE IAξ@D9LL$ABH6KIHts@ Ht$AAA @teM\$0H~AI1DL蠞M~IMAIDLH肞MEE11LHL6HL[]A\A]A^A_M\$H뙃<<E9HHG :HuXG ‰ t,~LGH@iA8>HÄ@H0?ff.fUHH=zH HL$HT$HD$HD$LD$HD$ktS} HL$HT$HAHt$Y8HHt%Hx H ]_HH53rH8+H 1]UIH1SHAE1I4H9}OI<E1B<tA8wA8u#HH9uI1A8sLV1LL)MӺI1HUL[]AVILZ$ATUSLBLJHjL)H:Lփz LM`1L)H9L9LHMD4D84t$B ?E4 AtMHI9LL1LHL9}$D4D84tL)1HD8uHL9|L)[]A\A^L1xLHH)jB LIXF4A?G$3AoLH9ZB8 uMaM9}B B8't M)JD I1D4D84.HL9|( &H5J/f.AWIAVIAUAATE1ULS1H(HL$L9AAE_D0u^DF0Ht$DHt$1J 91҅HHHIfnLfnEf8?f~Ef~ HLL$HLLDz2H(L[]A\A]A^A_EbEYDD$s@SH 0G L_AAA H_H@usIu AtrAtg;UHHc[8E1Mt#M9Au%B<'tIHHH[ABfDH <G LWAAA L_H@unE1It0M9~kAuC<衋tmIHHLH~H_IC} L$yPHUH9H H[]A\A]A^WnH H)H1H[]A\A]A^I~Ht$u/9f.AVHBIAUIATUHSH D$ H2I>蝚IHHILH~HIC} L$yPHUH9H H[]A\A]A^mH H)H1H[]A\A]A^I~Ht$uf.ATUSH G H_AAA HoH@tHo0HHE1E1E1/lib/pythonX.XPython %s cannot decode PYTHONWARNINGSPYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONINSPECTPYTHONDONTWRITEBYTECODEPYTHONNOUSERSITEPYTHONUNBUFFEREDPYTHONDUMPREFSPYTHONMALLOCSTATScannot decode PYTHONPATHPYTHONPLATLIBDIRPYTHONHASHSEEDPYTHONFAULTHANDLERPYTHONPROFILEIMPORTTIMEPYTHONTRACEMALLOCPYTHONINTMAXSTRDIGITSPYTHONPYCACHEPREFIXcannot decode PYTHONHOMElib64PYTHONIOENCODINGbad leading pad bytebad trailing pad bytecannot decode PREFIX macrocannot decode VPATH macrocannot decode VERSION macro/opt/alt/python310python3.10negative argument not allowed/dev/urandomsem_clockwaitsem_trywaitsem_waitsem_postPyCOND_FINI(gil->cond) failedPyCOND_INIT(gil->cond) failedPyCOND_WAIT(gil->cond) failedcan't initialize sys modulecan't set preliminary stderrfailed to initialize a typecan't init contextcan't init floatcan't init int typecan't initialize structseqCan't initialize unicode typecan't init longscan't initialize warnings__main____stderr____displayhook____excepthook____breakpointhook____unraisablehook__hexversionCPython(szz)_git_frameworkapi_versioncopyrightlinuxplatformmaxsizemaxunicodebuiltin_module_namesstdlib_module_nameslittlebyteorderabiflagsfinalcpythoncpython-310cache_tagx86_64-linux-gnu_multiarchimplementationfloat_repr_stylemeta_pathpath_importer_cacheEllipsisFalseTrueboolmemoryviewclassmethodcomplexenumeratefilterfrozensetpropertyreversedstaticmethod_frozen_importlibimport _imp # builtin _imp{sO}_installtoo many digits in integerutf-8Immortal interned string diedtype MRO must not be emptyduplicate base class %Uduplicate base class%s() method: bad call flags) -- uncollectablecollected{sisnsn}gc: %s <%s %p> in tp_clear ofin garbage collectionunnamed fielderrmap insertion problem.nameless moduleassign to%.80s (%.80s) %.80s%s%s%s, %.20s, %.9s00:00:00Dec 4 2024unmatched paren in formatUnmatched paren in formatBad dict formatan integer is requiredlist modified during sortdict mutated during updatepthreadsemaphoreembedded null bytesy#nnsunsupported error handlerBaseExceptionTypeErrorStopAsyncIterationStopIterationGeneratorExitSystemExitKeyboardInterruptModuleNotFoundErrorOSErrorEnvironmentErrorEOFErrorRuntimeErrorRecursionErrorNotImplementedErrorUnboundLocalErrorSyntaxErrorIndentationErrorTabErrorIndexErrorKeyErrorValueErrorUnicodeErrorUnicodeEncodeErrorUnicodeDecodeErrorUnicodeTranslateErrorAssertionErrorArithmeticErrorFloatingPointErrorOverflowErrorZeroDivisionErrorSystemErrorReferenceErrorMemoryErrorBufferErrorUserWarningEncodingWarningPendingDeprecationWarningSyntaxWarningRuntimeWarningFutureWarningImportWarningUnicodeWarningBytesWarningResourceWarningConnectionErrorBlockingIOErrorBrokenPipeErrorChildProcessErrorConnectionAbortedErrorConnectionRefusedErrorConnectionResetErrorFileExistsErrorFileNotFoundErrorIsADirectoryErrorNotADirectoryErrorInterruptedErrorPermissionErrorProcessLookupErrorTimeoutError__path__y#marshal.loadsmarshal.loadrecursion limit exceededmarshal data too shortsize must be positivesurrogatepassEOF read where not expectedbyte string is too largeinvalid kindco_code larger than INT_MAXcode: varnames is too smallnon-string found in code slotno import module dictionarywaswere%U() keywords must be strings, from %zd to %zd__all__ItemKeytstate mix-uporphan tstate** or pow()//%<<>>&|lost sys.displayhookbad RAISE_VARARGS opargblock stack underflow__build_class__ not foundno locals when deleting %Rname '%.200s' is not definedno locals when loading %R__import__ not found%U.%U__match_args__block stack overflowXXX lineno: %d, opcode: %d unknown opcodetuple index out of range__orig_bases__type() takes 1 or 3 argumentscannot create '%s' instancesUO!O!:type.__new____slots__ must be identifiers__weakref__exactlyat leastat mostexcess ')' in getargs formatmissing ')' in getargs format%.200s%s takes no argumentsbad format string: %.200sstr or Nonestr, bytes or bytearraya byte string of length 1a unicode character(unicode conversion error)embedded null character(buffer is NULL)(encoding failed)(buffer_len is NULL)(unspecified)read-write bytes-like objectcontiguous buffer(impossible)bases must be types|O!O:supersuper(): no argumentssuper(): arg[0] deletedsuper(): bad __class__ cellsuper(): empty __class__ cellsuper(): no current frame%U takes no keyword argumentsOsobject.__getattr__bad memberdescr typeat least at most hasattrgetattrsetattrreadonly attributeTruncation of value to charTruncation of value to shortTruncation of value to intbad memberdescr type for %sThis object has no __dict__%.200s() takes no argumentsunable to get sys.modulescheck_hash_based_pycsmodule '%s' has no __dict__module has no attribute '%U'isinstance in __instancecheck__ in comparisonwidth too bigprecision too big%lu%llu%zu%u%li%lli%zi|$OO:AttributeErrorkeyword this functionEmpty keyword parameter nameEmpty parameter name after $%s: '%s' in __subclasscheck__can't delete attribute %Rcan't set attribute %Rcan't delete attributecan't set attributeunreadable attribute %Runreadable attributeempty separatormust be str, not %.100sis_frozenis_builtinLockTypeTIMEOUT_MAX__weaklistoffset____dictoffset____vectorcalloffset__Py_tp_bases is not a tupleinvalid slot offsetfilters_onceregistry_defaultactionruntime core not initializedfail to reconfigure Pythoncan't initialize io.opencan't create __main__ moduleinitializing zipimport failedfailed to enable faulthandlercan't initialize signalscan't initialize tracemalloc_install_external_importersunable to get sys.path_hooks# installing zipimport hook zipimport# installed zipimport hook Python path configuration: PYTHONHOME = PYTHONPATH = program name = isolated = %i environment = %i user site = %i import site = %i _base_executable sys.%s = %A(not set)base_prefixbase_exec_prefixplatlibdir sys.path = [ %A, ] filesystem_encodingfilesystem_errors__stdin____stdout____annotations____builtins____loader__BuiltinImporterwarnoptions# can't import zipimport encoding erroruuicannot decode pybuilddir.txtpycache_prefixorig_argv_xoptionsdont_write_bytecodeEmpty module namemodule name must be a stringlevel must be >= 0'__name__' not in globalsglobals must be a dictpackage must be a string__name__ must be a stringOOOOOcan't allocate locknot holding the import lockno current thread identtimeout|iO:acquiretimeout value is too large+=release unlocked lockis_frozen_packageargument 'name'get_frozen_objectstring, bytes or codeDEFAULT_BUFFER_SIZEUnsupportedOperations(OO){}filenoflushisattynewlinespeekread1readallreadintoresetseekabletell-=sem_destroyF_OKR_OKW_OKTMP_MAXWCONTINUEDWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NDELAYO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_LARGEFILEO_PATHO_TMPFILEPRIO_PROCESSPRIO_PGRPPRIO_USERO_CLOEXECO_ACCMODEO_FSYNCSEEK_HOLESEEK_DATAO_ASYNCO_DIRECTO_DIRECTORYO_NOFOLLOWO_NOATIMEEX_OKEX_USAGEEX_DATAERREX_NOINPUTEX_NOUSEREX_NOHOSTEX_UNAVAILABLEEX_SOFTWAREEX_OSERREX_OSFILEEX_CANTCREATEX_IOERREX_TEMPFAILEX_PROTOCOLEX_NOPERMEX_CONFIGST_RDONLYST_NOSUIDST_NODEVST_NOEXECST_SYNCHRONOUSST_MANDLOCKST_WRITEST_APPENDST_NOATIMEST_NODIRATIMEST_RELATIMEPOSIX_FADV_NORMALPOSIX_FADV_SEQUENTIALPOSIX_FADV_RANDOMPOSIX_FADV_NOREUSEPOSIX_FADV_WILLNEEDPOSIX_FADV_DONTNEEDP_PIDP_PGIDP_ALLP_PIDFDWEXITEDWNOWAITWSTOPPEDCLD_EXITEDCLD_KILLEDCLD_DUMPEDCLD_TRAPPEDCLD_STOPPEDCLD_CONTINUEDF_LOCKF_TLOCKF_ULOCKF_TESTRWF_DSYNCRWF_HIPRIRWF_SYNCRWF_NOWAITRWF_APPENDSPLICE_F_MOVESPLICE_F_NONBLOCKSPLICE_F_MOREPOSIX_SPAWN_OPENPOSIX_SPAWN_CLOSEPOSIX_SPAWN_DUP2SCHED_OTHERSCHED_FIFOSCHED_RRSCHED_BATCHSCHED_IDLESCHED_RESET_ON_FORKXATTR_CREATEXATTR_REPLACEXATTR_SIZE_MAXRTLD_LAZYRTLD_NOWRTLD_GLOBALRTLD_LOCALRTLD_NODELETERTLD_NOLOADRTLD_DEEPBINDGRND_RANDOMGRND_NONBLOCKMFD_CLOEXECMFD_ALLOW_SEALINGMFD_HUGETLBMFD_HUGE_SHIFTMFD_HUGE_MASKMFD_HUGE_64KBMFD_HUGE_512KBMFD_HUGE_1MBMFD_HUGE_2MBMFD_HUGE_8MBMFD_HUGE_16MBMFD_HUGE_32MBMFD_HUGE_256MBMFD_HUGE_512MBMFD_HUGE_1GBMFD_HUGE_2GBMFD_HUGE_16GBEFD_CLOEXECEFD_NONBLOCKEFD_SEMAPHOREconfstr_namessysconf_namesposix.waitid_resultos.stat_resultos.statvfs_resultposix.sched_paramposix.times_resultstruct_rusagest_mode_have_functionspathconf_namesenvironordinal not in range(128)coroutine already executinggenerator already executinglist index out of rangecan only join an iterable__code__argument 'byteorder'to_bytesint too big to convertcan't concat %.100s to %.100sObject is not writable.from_bytesargument must be iterable{OO}OOOOiU|OOOi:__import__CLOCK_REALTIMECLOCK_MONOTONICCLOCK_MONOTONIC_RAWCLOCK_PROCESS_CPUTIME_IDCLOCK_THREAD_CPUTIME_IDCLOCK_BOOTTIMECLOCK_TAI_STRUCT_TM_ITEMSinvalid GMT offsettimezonealtzonedaylight(zz)tznameslice step cannot be zerostdio_encodingcannot decode %sunknown encoding: %sencodings|Oi:enablehandler must be callableunable to get sys.stderrsys.stderr is Nonestring, bytes or os.PathLikesOnnsbyte string is too longdrop_gil: GIL is not lockedsurrogateescape(iOOiO)(iOO)(iO)backslashreplacexmlcharrefreplace|$OO:min|$OO:max%s() arg is an empty sequencestring index out of range|$OO:ImportErrorimpossibleos.listdirrstrip%s arg must be None or strendswithargument 'encoding'argument 'errors'int() missing string argumentargument 'path'open_code_iorbargument 'mode'argument 'newline'invalid file: %Rinvalid mode: '%s''U' mode is deprecatedinvalid buffering sizeunknown mode: '%s'OsssOnegative file descriptorinvalid mode: %.200sOsiexpected integer from openeropener returned %dI/O operation on closed filecan't allocate read lockI/O operation on closed file.raw stream has been detachedread of closed filereadall() should return bytesread() should return bytesModuleExpressioncompile(): unrecognised flagsevalsinglefunc_typeInteractiveexpected %s node, got %.400simpossible module nodestring, bytes or AST__doc____module___attributesargtypesasnamebasescasesclscontext_exprconversionctxdecorator_listelteltsend_col_offsetend_linenoexcfinalbodyformat_specgeneratorsguardifsis_asynckeywordskw_defaultskwargkwd_attrskwd_patternskwonlyargsoperandopsoptional_varsorelseposonlyargsrestreturnssimplestepsubjecttargetstype_commenttype_ignoresvarargInteractive(stmt* body)Expression(expr body)FunctionTypestmtAsyncFunctionDefClassDefReturn(expr? value)ReturnDelete(expr* targets)DeleteAugAssignAnnAssignAsyncForWhileIfAsyncWithRaise(expr? exc, expr? cause)RaiseTryAssert(expr test, expr? msg)AssertImport(alias* names)ImportImportFromGlobal(identifier* names)GlobalNonlocal(identifier* names)NonlocalExpr(expr value)PassBreakContinueBoolOpNamedExprBinOpUnaryOpLambdaIfExpSet(expr* elts)SetListCompSetCompDictCompGeneratorExpAwait(expr value)AwaitYield(expr? value)YieldYieldFrom(expr value)YieldFromCompareCallFormattedValueJoinedStr(expr* values)JoinedStrConstantAttributeSubscriptStarredNameListTupleSliceexpr_contextLoadStoreDelboolop = And | OrboolopMatMultModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertUAddUSubcmpopNotEqLtLtEGtGtEIsIsNotNotInexcepthandlerExceptHandlerkeywordaliaswithitemmatch_caseMatchValue(expr value)MatchValueMatchSingletonMatchSequenceMatchMappingMatchClassMatchStar(identifier? name)MatchStarMatchAsMatchOr(pattern* patterns)MatchOrtype_ignoreTypeIgnoresub-views are not implementedmemoryview: invalid slice keys(O){OOOOOOOs}yO_fix_co_filenameargument 1argument 2iso-8859-1utf-8-iso-latin-1iso-8859-1-iso-latin-1-encoding problem: %sencoding problem: %s with BOMincomplete inputunexpected EOF while parsingunexpected indentunexpected unindentinvalid syntax%.200s is not a sequenceAsync with statements areAsync for loops areexpected ':'Pattern matching islookup_errorinvalid tokenunknown parsing error:__call__# type: tokenizer beginning of buffertok_backup: wrong character%04Xinvalid character '%c' (U+%s)invalid hexadecimal literalhexadecimalinvalid octal literaloctalinvalid binary literalbinaryinvalid decimal literalimaginarytoo many nested parenthesesMax string recursion exceededunexpected '{' in field nameunmatched '{' in format specMissing ']' in format stringVariable annotation syntax isillegal target for annotationargument must be callableexpected bytes, %.200s foundstring to parse is too longreplace string is too longsignal.itimer_errorNSIGSIG_BLOCKSIG_UNBLOCKSIG_SETMASKSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGCHLDSIGPWRSIGIOSIGURGSIGWINCHSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOUSIGVTALRMSIGPROFSIGXCPUSIGXFSZSIGRTMINSIGRTMAXITIMER_REALITIMER_VIRTUALITIMER_PROFSIG_DFLSIG_IGNItimerErrordefault_int_handler<>!=The '@' operator isAwait expressions areitems() returned non-iterable__bases__ is not tupleOsOobject.__setattr___abc_registerCan only register classes_abc_subclasscheck__subclasses__unicodedatanormalizeNFKCweak object has gone awaymodule filename missing<%s object at %p>expected a message argumentwbisiOOOOOOOsOOcodecs.open()illegal newline value: %sincrementaldecoderAssignment expressions areincrementalencoderexpected an indented blockAsync functions areST_MODEST_INOST_DEVST_NLINKST_UIDST_GIDST_SIZEST_ATIMEST_MTIMEST_CTIMES_IFDIRS_IFCHRS_IFBLKS_IFREGS_IFIFOS_IFLNKS_IFSOCKS_IFDOORS_IFPORTS_IFWHTS_ISUIDS_ISGIDS_ISVTXS_ENFMTS_IREADS_IWRITES_IEXECS_IRWXUS_IRUSRS_IWUSRS_IXUSRS_IRWXGS_IRGRPS_IWGRPS_IXGRPS_IRWXOS_IROTHS_IWOTHS_IXOTHUF_NODUMPUF_IMMUTABLEUF_APPENDUF_OPAQUEUF_NOUNLINKUF_COMPRESSEDUF_HIDDENSF_ARCHIVEDSF_IMMUTABLESF_APPENDSF_NOUNLINKSF_SNAPSHOTnegative countbyte must be in range(0, 256)expected '%s'issubclassAsync comprehensions arelist.remove(x): x not in listnegative shift count|$p:zipOiOinvalid %s literalno symtable__future__nested_scopesdivisionabsolute_importwith_statementprint_functionunicode_literalsbarry_as_FLUFLgenerator_stopbracesnot a chancerepeated string is too longcan only assign an iterablelatin_1iso_8859_1iso8859_1decoding str is not supportedformat requires a mappingincomplete format key* wants int%c arg not in range(0x110000)%c requires int or charincomplete formatnamed expressionlambdagenexprlistcompsetcompdictcompyield expressionawait expression__class___annotationmode out of rangesortedlstat|=compile.c compiler unitunknown symbol table entrynot readableOO;illegal decoder stateraw readinto() failed'yield' outside function'await' outside functionjoinutf_8_decodeNncannot assign to __debug__cannot delete __debug____name____qualname____classcell__'return' outside function'break' outside loopframe does not existmalformed control flow graph.too many constantsbytecode is too longline number table is too longkeyword argument repeated: %Uf-string: expecting '}'unmarshallable objectmarshal.dumps\U%08xtoo many objectstruncated \UXXXXXXXX escapetruncated \xXX escapetruncated \uXXXX escape\ at end of stringmalformed \N character escapeillegal Unicode characterunicodedata._ucnhash_CAPIf-string: unmatched '%c'f-string: unterminated stringos.mkdirbuiltins.idwritingOOiios.renameTrailing \ in string.%d(Niiii)_call_with_frames_removedPython %s on %s cpython.run_commandcpython.run_filePYTHONSTARTUPcpython.run_startupCould not open PYTHONSTARTUP cpython.run_stdincpython.run_modulerunpy_run_module_as_mainunable to get sys.pathError in sys.excepthook: Original exception was: sys.excepthook is missing sys.excepthookin audit hookin atexit callbackflush of closed filewhence value %d unsupportedseek of closed file# clear builtins._ # clear sys.%s # restore sys.%s # cleanup[2] removing %U gc %s # cleanup[3] wiping %U # cleanup[3] wiping sys # cleanup[3] wiping builtins interncan't intern %.400s# destroy %U locals must be a mapping???__file____cached__.pycSourcelessFileLoaderBad magic number in .pyc fileBad code object in .pyc fileSourceFileLoader_bootstrap_external_RAW_MAGIC_NUMBER# clear[1] %s # clear[2] %s unclosed file %R# clear sys.audit hooks writeobject with NULL filenot writable(OnnNnn)PyInitUPyInitcreate_dynamicspec.name must be a stringpunycodeccunicode errorvalue error(%s) %U(%s) unknown errorreplace bytes is too longunknown dlopen() error./%-.255s%.20s_%.200swrite to closed fileOOOO|OOlost sys.stderr found File "%S", line %zd ^.: . Did you mean: ''?sys._getframecall stack is not deep enoughNULL interpreterremaining threadsremaining subinterpreterststate %p is still currentsurrogates not allowedordinal not in range(256)divmodsetdefault__round__%s0%se%dException ignored %ssys.unraisablehookException ignored in: how_many cannot be negativepop from an empty settracebacklimit File "%U", line %d, in %U MAGICCODESIZEMAXREPEATMAXGROUPSLC_TIMELC_COLLATELC_MONETARYLC_MESSAGESLC_NUMERIClocale.Error__len__() should return >= 0argument list must be a tupleargument 'code'argument 'groupindex'argument 'indexgroup'invalid SRE codeBuffer is NULLinput(): lost sys.stdininput(): lost sys.stdoutinput(): lost sys.stderrbuiltins.inputbuiltins.input/resultEOF when reading a line(bOOpO:lru_cachefromkeys%.200s is not a mappingmaketransiter index too large&=bytearray index out of rangeExpected int as rr must be non-negative|n:productrepeat argument too largefrexp() result out of rangecharacter maps to infnanrfindreadline of closed filejoin() result is too longstartswithInvalid format specifierint too large to formatnon-ascii grouped digitOK;illegal decoder statea number is requirederrorcodeENODEVENOCSIEHOSTUNREACHENOMSGEUCLEANEL2NSYNCEL2HLTENODATAENOTBLKENOSYSEPIPEEINVALEOVERFLOWEADVEINTREUSERSENOTEMPTYENOBUFSEPROTOEREMOTEENAVAILECHILDELOOPEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEBADREHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEBADFDEDOTDOTEISCONNENOANOESHUTDOWNECHRNGELIBBADENONETEBADEEBADFEMULTIHOPEUNATCHEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNENOTNAMEACCESELNRNGEILSEQENOTDIRENOTUNIQEPERMEDOMEXFULLECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILEIDRMECOMMESRMNTEREMOTEIOEL3RSTEBADMSGENFILEELIBMAXESPIPEENOLINKENETRESETETIMEDOUTENOENTEEXISTEDQUOTENOSTREBADSLTEBADRQCELIBACCEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQELIBSCNENOLCKEISNAMECONNABORTEDENETUNREACHESTALEENOSRENOMEMENOTSOCKESTRPIPEEMLINKERANGEELIBEXECEL3HLTECONNRESETEADDRINUSEEOPNOTSUPPEREMCHGEAGAINENAMETOOLONGENOTTYERESTARTESOCKTNOSUPPORTETIMEEBFONTEDEADLOCKETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIOENOPKGENOMEDIUMEMEDIUMTYPEECANCELEDENOKEYEKEYEXPIREDEKEYREVOKEDEKEYREJECTEDEOWNERDEADENOTRECOVERABLEERFKILLENOTSUPspanno such group%S (%U, line %ld)%S (%U)%S (line %ld)<<=%S.%slstripget_terminal_sizes 1-%R is not in list_subx[][...]new string is too longrepeated bytes are too longpop from empty listpop index out of rangePyCF_ALLOW_TOP_LEVEL_AWAITPyCF_ONLY_ASTPyCF_TYPE_COMMENTS@?@d@f@N@n@Q@q@L@l@I@i@H@h@B@b@c@Pargument 'format'castmemoryview: internal errorO:cmp_to_keyO:Kno current interpreter_config_initisolateduse_environmentdev_modeinstall_signal_handlersuse_hash_seedimport_timeshow_ref_countdump_refsmalloc_statsprogram_nameparse_argvpythonpath_envhomemodule_search_paths_setmodule_search_pathssite_importbytes_warninginspectinteractiveoptimization_levelparser_debugverbosequietuser_site_directoryconfigure_c_stdiobuffered_stdiostdio_errorsskip_source_first_linerun_filename_install_importlibcheck_hash_pycs_modepathconfig_warnings_init_main_isolated_interpreterdict expectedinvalid config value: %sinvalid config type: %smissing config key: %sreadlines%+.02dInfinityNaNmaxlen|OO:dequemaxlen must be non-negativebeforeafter_in_childafter_in_parent'%s' must be callable, not %sclock_gettime(CLOCK_REALTIME)module definition is NULLmodule %p already added__getformat__doubleunknownIEEE, little-endianIEEE, big-endianUOnnUsubstring not found_bootstrapalwaysfloat division by zeroargument 3garbageDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_SAVEALLDEBUG_LEAKos.chdiros.putenvi|Oii:registersignal number out of rangesys.addaudithookos.systemdddinvalid wait status: %i__format__unlinkos.removeprecision too largeos.scandirunclosed scandir iterator %RO|iOi:dump_traceback_laterTimeout (%lu:%02lu:%02lu)! %R is not in dequepop from an empty dequeinvalid generationstart_new_threadfirst arg must be callable2nd arg must be a tuplecan't start new threadin thread started bynon-NULL old thread statedeque index out of rangereentrant call inside %Ros.forksetlocaleunsupported locale settinglocale query failedkkii:waitpidNi(kk):_acquire_restorecouldn't acquire lockis not retrievable|$O:NameError,)codecs.encode()%s with '%s' codec failedutf_16_le_encodeutf-16-leutf-16-beutf-16truncated dataillegal encodingillegal UTF-16 surrogateutf_16_be_encodeutf_32_le_encodeutf-32-leutf-32-beutf-32utf_32_be_encodeargument 'order'tobytesorder must be 'C', 'F' or 'A'imulsetitemdelitem%S.%S()thread.local.%pargument 'co_code'argument 'co_consts'argument 'co_names'argument 'co_varnames'argument 'co_freevars'argument 'co_cellvars'argument 'co_filename'argument 'co_name'argument 'co_linetable'OOOiiiiiicode.__new__%.200s() argument %zd, item %d %.256smissing 'getdata' funccannot pickle '%.200s' objectN(Os)\Uxxxxxxxx out of rangerawunicodeescapeO(O)nO(())O|O:getsizeofos.chmodfollow_symlinks_abc_instancecheckmust be %.50s, not %.50ssep must be length 1.sep must be ASCII.sep must be str or bytes. UUnnUnew buffer size too largeillegal newline value: %Rnew position too large(ii)value must be positive(%s%s%sj%s{...}_module_reprpositionalkeyword-only%U and %U, %U, and %Ustr() on a bytes instancestr() on a bytearray instancecenterresult too longO|n:repeatsubsection not foundljustremoveprefixremovesuffixrindexrjust__reduce_ex__(O(Ns)N)(O(y#)N)(O()N)fromhexreadinto of closed filepop from empty bytearray%S.%S%=a real numberprec too big%c arg not in range(256)N(O)nN(())latin_1_encodeunhashable type: '%.200s'value not found in bytearray_reduce_ex(y#)charmap_buildcharmap_encodecharmap&#%d;%ldrpartitionsys.settracecannot delete memorypeek of closed filecodecs.decode()decodingutf_16_le_decodeascii_decodeabsolute value too large//=__defaults____kwdefaults__(Nn)%.200s attribute not setlookupcharmap_decodelatin_1_decoderaw_unicode_escape_decodeutf_16_decodeutf_16_be_decodeutf_7_decodeascii_encoderaw_unicode_escape_encodeutf_16_encodeutf_7_encodeutf_8_encodeinvalid escape sequence '\%c'utf_16_ex_decodeNniill-formed sequenceunexpected special characterutf7unterminated shift sequencenegative seek value %zdutf_32_encodeutf_32_ex_decodeutf_32_le_decodeutf_32_be_decode(Cn)_count_elements%U (%s: %S)delattrstring is too large to encoderead-only bytes-like objectCP_UTF8readbuffer_encodeNegative seek position %zdutf_32_decodesearchsearch() takes no argumentsobject.__delattr__(O(nO))%s(%zd, %R)Negative size value %zdlost builtins modulegtor_and_^=float floor division by zerofloat modulocomplex division by zerocomplex modulocomplex exponentiationfloat divmod()(dd)<%U.%U object at %p>mappingproxy(%R)__origin__[ | {{}}1e%d and or + - * @ / % << >> ^ & // ** ~lambda == != < <= > >= is is not not in .unknown binary operatorunknown unary operator, /** if else (yield)(yield (yield from await unexpected comparison kind, := unknown expression kindU|O:strftimeday of month out of rangehour out of rangeminute out of rangeseconds out of rangeday of week out of rangeday of year out of rangen must be >= 0|O:gmtime|O:localtimeos.unsetenvmktime argument out of range|O:ctime%s %s%3d %.2d:%.2d:%.2d %dcharacter out of rangeO|$O:ContextVarfailed to get LC_CTYPE localeint_curr_symbolcurrency_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signint_frac_digitsp_cs_precedesp_sep_by_spacen_cs_precedesn_sep_by_spacep_sign_posnn_sign_posn**=>>=__setformat__-0x0.0p+0-0x%sp%c%dself must not be None while traversing 'stmt' node while traversing 'For' node while traversing 'If' node while traversing 'With' node while traversing 'Try' node while traversing 'Expr' nodeinvalid integer value: %R while traversing 'expr' node while traversing 'Dict' node while traversing 'Set' node while traversing 'Call' node while traversing 'Name' node while traversing 'List' nodeNegative ImportFrom levelunexpected statementempty %s on %sCompare with no comparatorsunexpected expressionfd is greater than maximumfd is less than minimumos.rmdir(O(OiiNii))nnOnnnnncannot delete __dict__O(O)(OOOO)invalid partial state%U, %R%U, %S=%R%s(%R%U)reduceO(OiiOii)subscriptstarredfunction callgenerator expressionlist comprehensionset comprehensiondict comprehensiondict literalset displayf-string expressionellipsisconditional expressiongetrusage(RUSAGE_SELF)_SC_CLK_TCK is too largetimes()clock()(O)OO(NO)OO(NiO)O(OO)ON(N)l(O(OOO))O()(OO)O()(O)O()state is not a tupleO|OArguments must be iterators.N(N)O(On)O(()n)O(On)Ninvalid argumentsO(OO)%s(%zd)%s(%R)%s(%R, %R)O(n)O(N)(OO)O(O)(OO)O!iO(OO)lO(OO)(OOO)O(Nn)nO(OnNn)nO(On)(NN)O!O!OONlen() of unsized object%s(%R, %zd)O(O)O(())(Oi)O(ONO)teedataobjectInvalid argumentsIndex out of rangeONOlength_hintis_%s(...)%s%Rmethod name must be a string%U=%R%s(%R, %U)containscount exceeds C integer sizeindex exceeds C integer sizecountOfgetitemindexOfiaddiandifloordivilshiftimodimatmul@=ioripowirshiftisubitruedivixoriconcatis_not@dictionary is empty%s()cannot use '_' as a targetinvalid pattern targetO:PickleBufferN(OO)N(ON)%s({%U}){%U}(d)(O(OO))negative size value %zd__bases__%s(%U, %U)%s(%R, maxlen=%zd)namespace%s(%S)range(%R, %R)range(%R, %R, %R)traceback loop detected0x%xre.compile(%.200R, %S)re.compile(%.200R)_expandmatch() takes no arguments[Errno %S] %S: %R -> %R[Errno %S] %S: %R[Errno %S] %Sasctimeexpect int, got %s_strptimei:clock_getresi:clock_gettimeiO:clock_settimes:get_clock_infomonotonicperf_counterprocess_timethread_timeunknown clockadjustableresolutionk:pthread_getcpuclockidexpected str, got %spadded string is too longwstrlegacy UCS2legacy asciilegacy latin1legacy UCS4xb+xbab+rb+pymallocpymalloc_debug%d %ss * %zd bytes each%48s free %d-sized PyTupleObjectfree PyDictObjectfree PyListObjectfree PyFrameObjectfree PyFloatObject%5u %6u %11zu %15zu %13zu # arenas allocated total# arenas reclaimed# arenas highwater mark# arenas allocated current%zu arenas * %d bytes/arena# bytes in allocated blocks# bytes in available blocks%u unused pools * %d bytes# bytes lost to pool headers# bytes lost to quantizationTotal arena map counts # arena map mid nodes# arena map bot nodes# bytes lost to arena map mid# bytes lost to arena map botcannot decode string\x\u\U ... File Current thread 0xThread 0x (most recent call first): Garbage-collecting input line too longcan't re-enter readlinesu#nnsnot a weakrefno interpreter providedNoneType takes no arguments__cause__ may not be deletedCell is emptyFatal Python error: Python runtime state: finalizing (tstate=0xcore initializedpreinitializedpreinitializingin new thread File "", line API '%c' at p-%d: 0x%02x *** OUCH at tail+%d: 0x%02x Data at p: %02x ...FORBIDDENBYTE, as expected. out of memorywrong thread statedeallocating deallocating NotImplementeddeallocating None object address : %p object refcount : %ld object type : %p object type name: %s object repr : %s:%d: %s: Assertion "%s" failedAssertion failed_PyObject_AssertFailedstate is not a dictionary in __issubclass__unlocked<%s %s object at %p>, NULL>slice(%R, %R, %R)%s(%ld)instancemethodtry sending as bytesnon-tuple default argsnon-dict annotationsdetachFile not open for %sinvalid module indexModule index out of bounds.sys.setprofilemissing interpmissing new_object func%R has already been used onceisnunable to start the threadnO:inserttb_linenotb_lastitb_nexttb_frame[ssss]O(OOO)(iii) sss_remove_dead_weakrefcharacters_writtenO|O&O&:index{snsnsn}call_tracing__orig_class__cannot delete attributedeque.rotatesched_priority out of rangeUnknown signalmakedevcloserangeuid is less than minimumuid is greater than maximumgid is less than minimumgid is greater than maximumcode may be unreachable.lineno must be an integerlineno out of rangeO()NNO(()n)NNanext%s: %sargument 'tb_frame'TracebackTypedepth must be >= 0argument 'source'source_hashargs may not be deleted<%s><%s name=%R><_io.FileIO [closed]>length should not be negative(NNN)%R is not in rangeN(N)Ocannot allocate locksetitimeriiO:sched_setscheduleriO:sched_setparami:sched_getparamiii:waitidtoo many groupsgroups must be integersset_inheritableset_blockingpthread_sigmasksigtimedwaittimeout must be non-negativesiginterruptpidfd_send_signalsiginfo must be Nonei:sched_getscheduleri:sched_rr_get_intervaliO:sched_setaffinitynegative CPU numberCPU number too largei:sched_getaffinitysetreuidsetregidi:getsidii:setpgidii:tcsetpgrplseekpreadpreadvpwritepwritevposix_fallocateposix_fadvisesetresuidsetresgidunsupported langinfo constantcan't create sys.pathcan't assign sys.pathno mem for sys.argvcan't assign sys.argvcan't compute path0 from argvgetpwuid(): uid not foundgetpwuid(): uid not found: %S Extension modules: (total: can't use MatchStar hereunexpected pattern<_io.TextIOWrapper name=%R%U encoding=%R> mode=%Rstrxfrmstrcollinterpreter not initialized while traversing 'arg' nodeNNNKStructunpack_fromcalcsizeTypeVartypingmanyfewToo %s arguments for %R%s=%s(OnN)|Oi:dump_traceback... truncated\'%c\x%02x\u%04xOU|itruncate of closed filereadinto1resourceNiNDEF_GLOBALDEF_NONLOCALDEF_LOCALDEF_PARAMDEF_FREEDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDDEF_ANNOTTYPE_FUNCTIONTYPE_CLASSTYPE_MODULEGLOBAL_EXPLICITGLOBAL_IMPLICITCELLSCOPE_OFFSCOPE_MASKPy_FileSystemDefaultEncodingPy_UTF8ModePy_DebugFlagPy_VerboseFlagPy_QuietFlagPy_InteractiveFlagPy_InspectFlagPy_OptimizeFlagPy_NoSiteFlagPy_BytesWarningFlagPy_FrozenFlagPy_IgnoreEnvironmentFlagPy_DontWriteBytecodeFlagPy_NoUserSiteDirectoryPy_UnbufferedStdioFlagPy_HashRandomizationFlagPy_IsolatedFlagglobal_configconfigure_localecoerce_c_localecoerce_c_locale_warnutf8_modeallocatorpre_configprogram_full_pathmodule_search_pathpath_configregister_error_stderrException in thread kind == PyUnicode_1BYTE_KINDascii->state.ready == 1ascii->state.ascii == 0compact->utf8 != dataascii->length == 0ascii->hash == -1ascii->state.ready == 0ascii->state.interned == 0ascii->wstr != ((void *)0)data == ((void *)0)compact->utf8 == ((void *)0)data != ((void *)0)compact->utf8 == dataascii->wstr == dataascii->wstr != datacompact->utf8_length == 0compact->wstr_length == 0maxchar >= 128maxchar <= 255maxchar < 128maxchar >= 0x100maxchar <= 0xFFFFmaxchar >= 0x10000maxchar <= 0x10fffftype->tp_dict != ((void *)0)type->tp_new == ((void *)0)keys->dk_refcnt == 1(-2) <= ix && ix <= usableentry->me_hash == hashentry->me_hash != -1!_PyObject_IsFreed(op)in PyEval_SetProfilein PyEval_SetTrace(OiiO)pdb.set_tracePYTHONBREAKPOINTsys._current_exceptionssys._current_framesnot main interpretermissing main interpreterfailed to create a new lockfailed to set autoTSSkeyos.utimeposix_spawnp%s: argv must not be emptyos.posix_spawngc.get_referentsgc.get_referrerslost sys.breakpointhookbuiltins.breakpointsetopencodehookkisignal.pthread_killos.forkpty(Ni)OIIios.chownos.getxattrargument 'value'OOy#ios.setxattros.removexattros.listxattriIIilchownos.linkos.symlinkexecvos.execexecvein:killos.killii:killpgos.killpgiiLos.lockfos.truncateftruncate(i)gc.get_objectsargument 7argument 8argument 9argument 10argument 11argument 12argument 14argument 15argument 16argument 'globals'arg 5 (closure) must be tuplefunction.__new__((OK))init_frozenisisssOisisOOO((yi))Oi;illegal decoder stateO()Nnegative seek position %Riy(OOnN)cannot assign to %scannot delete %s'%c' was never closed__interactivehook__cpython.run_interactivehookthread is not currentthread still has a framenot the last threadO&|$p:InterpreterID.__init__>>> ... out of memory Python %s %s string or bytes_frozen_importlib_external__hello____phello____phello__.spamgetstate() -> statesetstate(state)classmethclassmeth(*args, **kw)staticmethstaticmeth(*args, **kw)benchxxsubtypexxsubtype.spamlistxxsubtype.spamdict_symtableis_tracingclear_traces_get_traces_get_object_tracebackget_traceback_limitget_tracemalloc_memoryget_traced_memoryreset_peak_tracemallocdisableis_enabledcancel_dump_traceback_later_read_null_fatal_error_c_thread_sigabrt_sigfpe_stack_overflowall_threadsBus errorIllegal instructionFloating point exceptionAbortedSegmentation faultline_bufferinggetvalue__getstate____setstate__initial_valuenewline_io.StringIO_io._TextIOBase_CHUNK_SIZEwrite_throughreconfiguretranslate_dealloc_warnrawiso8859-1_io.IncrementalNewlineDecoder_io._BufferedIOBase__sizeof__buffer_size_io.BufferedRWPair_io.BufferedWriter_io.BufferedRandom_io.BufferedReaderTrue if the file is closed.writelinesgetbuffer_io.BytesIOinitial_bytes_io._BytesIOBuffer_io.FileIOTrue if the file is closedclosefdString giving the file mode_checkClosed_checkSeekable_checkReadable_checkWritable__enter____exit___io._IOBase_io._RawIOBaseextend__IOBase_closedlocaleconvnl_langinfo_get_locale_encodingABDAY_1ABDAY_2ABDAY_3ABDAY_4ABDAY_5ABDAY_6ABDAY_7ABMON_1ABMON_2ABMON_3ABMON_4ABMON_5ABMON_6ABMON_7ABMON_8ABMON_9ABMON_10ABMON_11ABMON_12RADIXCHARTHOUSEPCRNCYSTRAM_STRPM_STRCODESETT_FMT_AMPMERAERA_D_FMTERA_D_T_FMTERA_T_FMTALT_DIGITSYESEXPRNOEXPR_DATE_FMTacquire_lockrelease_locklocked_lock_at_fork_reinit_is_owned_release_saveThread-local dummyThread-local dataexc_typeException typeexc_valueException valueexc_tracebackException tracebackThreadstart_newallocate_lockexit_threadinterrupt_mainget_identget_native_id_set_sentinel_excepthook_localdummy_destroyed_thread._ExceptHookArgs_thread._local_thread._localdummy_thread.RLock_thread.locktm_yearyear, for example, 1993tm_monmonth of year, range [1, 12]tm_mdayday of month, range [1, 31]tm_hourhours, range [0, 23]tm_minminutes, range [0, 59]tm_secseconds, range [0, 61])tm_wdaytm_ydayday of year, range [1, 366]tm_isdsttm_zoneabbreviation of timezone nametm_gmtoffoffset from UTC in secondsclock_gettime_nsclock_settime_nssleepmktimetzsetmonotonic_nsprocess_time_nsthread_time_nsperf_counter_ns_strptime_timetime.struct_timeS_ISDIRS_ISCHRS_ISBLKS_ISREGS_ISFIFOS_ISLNKS_ISSOCKS_ISDOORS_ISPORTS_ISWHTS_IMODES_IFMTfilemode_statsi_signosignal numbersi_codesignal codesi_errnosi_pidsending process IDsi_uidsi_statusexit value or signalsi_bandband event for SIGPOLLalarmgetitimerraise_signalstrsignalgetsignalpausesigpendingsigwaitsigwaitinfovalid_signalssignal.struct_siginfowarn_on_full_buffer_run_exitfuncs_ncallbacksatexit__reduce____copy__from_iterable__class_getitem__See PEP 585__length_hint__selectorsinitialitertoolscombinations_with_replacementfillvaluetimesitertools._tee_dataobjectitertools._teeitertools._grouperitertools.groupbyitertools.repeatitertools.productitertools.permutationsitertools.pairwiseitertools.zip_longestitertools.countitertools.filterfalseitertools.compressitertools.chainitertools.starmapitertools.isliceitertools.takewhileitertools.dropwhileitertools.cycleitertools.combinationsitertools.accumulateget_cache_token_abc_init_reset_registry_reset_caches_get_dump__subclasshook____abc_tpflags____abstractmethods___abc_impl_abc._abc_dataappendappendleftcopyextendleftpopleft__reversed__reverse__missing__default_factory_collections__setitem___collections._tuplegetter_collections._deque_iteratorcollections.defaultdictcollections.dequetruthneginvinvertnot__operatoroperator.methodcalleroperator.itemgetteroperator.attrgetterobjcache_infocache_clear__deepcopy__functools._lru_list_elemfunctools.KeyWrapperfunctools._lru_cache_wrapperfunctools.partialuser_functiontypedcache_info_type_functoolsmycmpgetweakrefcountgetweakrefs_codecsgroupindexThe regex matching flags.fullmatchsubnfindallfinditerscannerlastindexlastgroupregsendposgroupdictgetcodesizeascii_iscasedunicode_iscasedascii_tolowerunicode_tolowertemplatemaxsplitreplindexgroup_srere.TEMPLATEre.IGNORECASEre.LOCALEre.MULTILINEre.DOTALLre.UNICODEre.VERBOSEre.DEBUGre.ASCII_sre.SRE_Scannerre.Matchre.Patternpw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programgetpwuidgetpwallpwd.struct_passwdprotection bitsst_inoinodest_devdevicest_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last changest_atimest_mtimetime of last modificationst_ctimest_atime_nsst_mtime_nsst_ctime_nsst_blksizeblocksize for filesystem I/Ost_blocksnumber of blocks allocatedst_rdevdevice type (if inode device)f_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxf_fsidsysnameoperating system namenodenameoperating system releaseoperating system versionmachinehardware identifiersched_prioritythe scheduling priorityuser timesystem timechildren_useruser time of childrenchildren_systemsystem time of childrenelapsedcolumnsis_diris_fileis_symlink__fspath__ttynamefchmodfchownctermidgetcwdgetcwdbnicegetprioritysetprioritycopy_file_rangespliceumaskuname_exitregister_at_forksched_get_priority_maxsched_get_priority_minsched_yieldopenptygetegidgeteuidgetgidgetgroupsgetpidgetppidgetuidgetloginsetuidseteuidsetgidsetegidsetgroupswait3setsidtcgetpgrpdevice_encodingdupdup2sendfilefstatpipepipe2majorminorfchdirfsyncfdatasyncWCOREDUMPWIFCONTINUEDWIFSTOPPEDWIFSIGNALEDWIFEXITEDWEXITSTATUSWTERMSIGWSTOPSIGfstatvfsconfstrsysconfabortgetloadavggetresuidgetresgidcpu_countget_inheritableget_blockingfspathgetrandommemfd_createeventfdeventfd_readeventfd_writewaitstatus_to_exitcodeinitvalout_fdin_fdfd2policytarget_is_directorysrc_dir_fddst_dir_fdoffset_srcoffset_dstfile_actionssetpgroupresetidssetsigmasksetsigdefwhichwhoeffective_idsposixHAVE_EVENTFDHAVE_FACCESSATHAVE_FCHDIRHAVE_FCHMODHAVE_FCHMODATHAVE_FCHOWNHAVE_FCHOWNATHAVE_FEXECVEHAVE_FDOPENDIRHAVE_FPATHCONFHAVE_FSTATATHAVE_FSTATVFSHAVE_FTRUNCATEHAVE_FUTIMENSHAVE_FUTIMESHAVE_FUTIMESATHAVE_LINKATHAVE_LCHOWNHAVE_LSTATHAVE_LUTIMESHAVE_MEMFD_CREATEHAVE_MKDIRATHAVE_MKFIFOATHAVE_MKNODATHAVE_OPENATHAVE_READLINKATHAVE_RENAMEATHAVE_SYMLINKATHAVE_UNLINKATHAVE_UTIMENSATposix.uname_resultposix.DirEntryposix.ScandirIteratoros.terminal_sizei:getpgidii:wait4i|O&:pidfd_openSC_2_CHAR_TERMSC_2_C_BINDSC_2_C_DEVSC_2_C_VERSIONSC_2_FORT_DEVSC_2_FORT_RUNSC_2_LOCALEDEFSC_2_SW_DEVSC_2_UPESC_2_VERSIONSC_AIO_LISTIO_MAXSC_AIO_MAXSC_AIO_PRIO_DELTA_MAXSC_ARG_MAXSC_ASYNCHRONOUS_IOSC_ATEXIT_MAXSC_AVPHYS_PAGESSC_BC_BASE_MAXSC_BC_DIM_MAXSC_BC_SCALE_MAXSC_BC_STRING_MAXSC_CHARCLASS_NAME_MAXSC_CHAR_BITSC_CHAR_MAXSC_CHAR_MINSC_CHILD_MAXSC_CLK_TCKSC_COLL_WEIGHTS_MAXSC_DELAYTIMER_MAXSC_EQUIV_CLASS_MAXSC_EXPR_NEST_MAXSC_FSYNCSC_GETGR_R_SIZE_MAXSC_GETPW_R_SIZE_MAXSC_INT_MAXSC_INT_MINSC_IOV_MAXSC_JOB_CONTROLSC_LINE_MAXSC_LOGIN_NAME_MAXSC_LONG_BITSC_MAPPED_FILESSC_MB_LEN_MAXSC_MEMLOCKSC_MEMLOCK_RANGESC_MEMORY_PROTECTIONSC_MESSAGE_PASSINGSC_MQ_OPEN_MAXSC_MQ_PRIO_MAXSC_NGROUPS_MAXSC_NL_ARGMAXSC_NL_LANGMAXSC_NL_MSGMAXSC_NL_NMAXSC_NL_SETMAXSC_NL_TEXTMAXSC_NPROCESSORS_CONFSC_NPROCESSORS_ONLNSC_NZEROSC_OPEN_MAXSC_PAGESIZESC_PAGE_SIZESC_PASS_MAXSC_PHYS_PAGESSC_PIISC_PII_INTERNETSC_PII_INTERNET_DGRAMSC_PII_INTERNET_STREAMSC_PII_OSISC_PII_OSI_CLTSSC_PII_OSI_COTSSC_PII_OSI_MSC_PII_SOCKETSC_PII_XTISC_POLLSC_PRIORITIZED_IOSC_PRIORITY_SCHEDULINGSC_REALTIME_SIGNALSSC_RE_DUP_MAXSC_RTSIG_MAXSC_SAVED_IDSSC_SCHAR_MAXSC_SCHAR_MINSC_SELECTSC_SEMAPHORESSC_SEM_NSEMS_MAXSC_SEM_VALUE_MAXSC_SHARED_MEMORY_OBJECTSSC_SHRT_MAXSC_SHRT_MINSC_SIGQUEUE_MAXSC_SSIZE_MAXSC_STREAM_MAXSC_SYNCHRONIZED_IOSC_THREADSSC_THREAD_ATTR_STACKADDRSC_THREAD_ATTR_STACKSIZESC_THREAD_KEYS_MAXSC_THREAD_PRIORITY_SCHEDULINGSC_THREAD_PRIO_INHERITSC_THREAD_PRIO_PROTECTSC_THREAD_PROCESS_SHAREDSC_THREAD_SAFE_FUNCTIONSSC_THREAD_STACK_MINSC_THREAD_THREADS_MAXSC_TIMERSSC_TIMER_MAXSC_TTY_NAME_MAXSC_TZNAME_MAXSC_T_IOV_MAXSC_UCHAR_MAXSC_UINT_MAXSC_UIO_MAXIOVSC_ULONG_MAXSC_USHRT_MAXSC_VERSIONSC_WORD_BITSC_XBS5_ILP32_OFF32SC_XBS5_ILP32_OFFBIGSC_XBS5_LP64_OFF64SC_XBS5_LPBIG_OFFBIGSC_XOPEN_CRYPTSC_XOPEN_ENH_I18NSC_XOPEN_LEGACYSC_XOPEN_REALTIMESC_XOPEN_REALTIME_THREADSSC_XOPEN_SHMSC_XOPEN_UNIXSC_XOPEN_VERSIONSC_XOPEN_XCU_VERSIONSC_XOPEN_XPG2SC_XOPEN_XPG3SC_XOPEN_XPG4CS_GNU_LIBC_VERSIONCS_GNU_LIBPTHREAD_VERSIONCS_LFS64_CFLAGSCS_LFS64_LDFLAGSCS_LFS64_LIBSCS_LFS64_LINTFLAGSCS_LFS_CFLAGSCS_LFS_LDFLAGSCS_LFS_LIBSCS_LFS_LINTFLAGSCS_PATHCS_XBS5_ILP32_OFF32_CFLAGSCS_XBS5_ILP32_OFF32_LDFLAGSCS_XBS5_ILP32_OFF32_LIBSCS_XBS5_ILP32_OFF32_LINTFLAGSCS_XBS5_ILP32_OFFBIG_CFLAGSCS_XBS5_ILP32_OFFBIG_LDFLAGSCS_XBS5_ILP32_OFFBIG_LIBSCS_XBS5_LP64_OFF64_CFLAGSCS_XBS5_LP64_OFF64_LDFLAGSCS_XBS5_LP64_OFF64_LIBSCS_XBS5_LP64_OFF64_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_CFLAGSCS_XBS5_LPBIG_OFFBIG_LDFLAGSCS_XBS5_LPBIG_OFFBIG_LIBSPC_ASYNC_IOPC_CHOWN_RESTRICTEDPC_FILESIZEBITSPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_PRIO_IOPC_SOCK_MAXBUFPC_SYNC_IOPC_VDISABLEPC_ALLOC_SIZE_MINPC_REC_INCR_XFER_SIZEPC_REC_MAX_XFER_SIZEPC_REC_MIN_XFER_SIZEPC_REC_XFER_ALIGNPC_SYMLINK_MAXisenabledset_debugget_debugget_countget_thresholdcollectget_statsis_trackedis_finalizedunfreezeget_freeze_countmarshal_ast_string.abi3.soINFNAN__dir__sys.thread_infofirstiterfinalizerwidthmodulusimaghash_bitsseed_bitsseed size of hash algorithmcutoff-d-ioptimize-O or -OO-Bno_user_site-sno_site-Signore_environment-E-v-b-qhash_randomization-R-I-X dev-X utf8-X warn_default_encoding-X int_max_str_digitsMajor release numberMinor release numbermicroPatch release numberreleaselevelserialSerial release numberaudit_clear_type_cacheexc_infogetdefaultencodinggetdlopenflagsgetallocatedblocksgetfilesystemencodinggetfilesystemencodeerrorsgetrefcountgetrecursionlimitis_finalizingsetswitchintervalgetswitchintervalsetdlopenflagsgetprofilesetrecursionlimitgettrace_debugmallocstatsset_asyncgen_hooksget_asyncgen_hooks_deactivate_opcacheget_int_max_str_digitsset_int_max_str_digitsmaxdigitsdepth__cantrace__sys.flagssys.version_infosys.hash_info_aix_support_asyncio_bisect_blake2_bootsubprocess_bz2_codecs_cn_codecs_hk_codecs_iso2022_codecs_jp_codecs_kr_codecs_tw_collections_abc_compat_pickle_compression_contextvars_crypt_csv_ctypes_curses_curses_panel_datetime_dbm_decimal_elementtree_gdbm_hashlib_heapq_json_lsprof_lzma_markupbase_md5_msi_multibytecodec_multiprocessing_opcode_osx_support_overlapped_posixshmem_posixsubprocess_py_abc_pydecimal_pyio_queue_random_scproxy_sha1_sha256_sha3_sha512_sitebuiltins_socket_sqlite3_ssl_statistics_struct_threading_local_tkinter_uuid_weakrefset_winapi_zoneinfoaifcantigravityargparseasynchatasyncoreaudioopbase64bdbbinasciibinhexcProfilecalendarcgicgitbchunkcmathcmdcodeopcolorsyscompileallconcurrentconfigparsercontextlibcopyregdataclassesdifflibdisdistutilsdoctestemailensurepipenumfcntlfilecmpfileinputfnmatchfractionsftplibgenericpathgetoptgetpassglobgraphlibgziphmachtmlhttpidlelibimaplibimghdripaddresslib2to3linecacheloggingmailboxmailcapmimetypesmmapmodulefindermsilibmsvcrtnetrcnisnntplibntpathnturl2pathnumbersoptparseossaudiodevpathlibpdbpickletoolspipespkgutilplistlibpoplibposixpathpprintpstatspy_compilepyclbrpydocpydoc_datapyexpatquoprireprlibrlcompleterschedsecretsselectshelveshlexshutilsmtpdsmtplibsndhdrsocketserverspwdsre_compilesre_constantssre_parsestringprepsunausysconfigsyslogtabnannytarfiletelnetlibtempfiletermiostextwrapthisthreadingtimeittokenizeturtleturtledemounittesturllibuuvenvwavewebbrowserwinregwinsoundwsgirefxdrlibxmlxmlrpczipappzipfilezlibc_callc_exceptionc_returnsymbolsnestedsymtable entrylast_tracebacklast_valuelast_typeend_offsetps2ps1C.UTF-8C.utf8_shutdownsiphash24extension_suffixeslock_heldcreate_builtinexec_dynamicexec_builtinzipimporterreload_handle_fromlist_get_sourcefile_fix_up_module_lock_unlock_module_find_and_load__spec____package__deletehamthamt_collision_nodehamt_array_nodehamt_bitmap_nodeerr_msgError messageObject causing the exceptionUnraisableHookArgsrunvarold_valueToken.MISSING_contextvars.Token_contextvars.ContextVar_contextvars.Context.0123456789abcdef_is_text_encodingstrict_errorsignore_errorsxmlcharrefreplace_errorsbackslashreplace_errorsnamereplacenamereplace_errors__aexit____aenter____build_class__binchraiteroctroundsumndigitsdont_inherit_feature_version__prepare__metaclass__mro_entries__|OOOp:printast.AST_filters_mutatedcategorystacklevel_warn_unawaited_coroutinemodule_globalsget_sourceWarningMessage_showwarnmsg__warningregistry____callback____bytes__weakref.CallableProxyTypeweakref.ProxyTypeweakref.ReferenceType__parameters____args__types.UnionTypersplitcapitalizecasefoldexpandtabssplitlinesswapcaseisasciiislowerisupperistitleisspaceisdecimalisdigitisnumericisalphaisalnumisidentifierisprintablezfillformat_map__getnewargs__formatter_field_name_splitformatter_parserkeependstabsizestring helper modulefieldnameiteratorformatteriteratorstr_iteratorEncodingMap__text_signature____basicsize____itemsize____flags____weakrefoffset____base____mro__mrothe object's class__init_subclass____thisclass__the class invoking super()__self____self_class____newobj_ex____newobj____getnewargs_ex____set_name____pow____getitem____delitem____neg____pos____abs____index____invert____int____float____iadd____isub____imul____imatmul____imod____ipow____ilshift____irshift____iand____ixor____ior____ifloordiv____itruediv____str____getattribute____next____set____delete____add____radd____sub____rsub____mul____rmul____matmul____rmatmul____mod____rmod____divmod____rdivmod____rpow____lshift____rlshift____rshift____rrshift____and____rand____xor____rxor____or____ror____floordiv____rfloordiv____truediv____rtruediv____repr____contains____len____bool____lt____le____eq____ne____gt____ge____iter____del____await____aiter____anext____get___slotnames__slotnames____slots____hash____neg__($self, /) -- -self__pos__($self, /) -- +selftuple_iteratorn_sequence_fieldsn_unnamed_fieldsn_fieldsindicesdiscardintersectionintersection_updateisdisjointissubsetissupersetsymmetric_differencesymmetric_difference_updateunion typeset_iteratorlongrange_iteratorpickle.PickleBufferPy_ReprNotImplementedTypeNoneType__isabstractmethod__==types.SimpleNamespace_initializingmoduledefbuiltin_methodbuiltin_function_or_methodnbytesitemsizendimshapestridessuboffsetsc_contiguousf_contiguoustolisttoreadonlybytes_per_sepmemory_iteratormanagedbufferpopitemmove_to_endlastcollections.OrderedDictodict_keysodict_itemsodict_valuesodict_iteratordict_valueiteratordict_keyiteratordict_itemiteratordict_reversevalueiteratordict_reverseitemiteratordict_reversekeyiteratorrealnumeratordenominatorconjugatebit_lengthbit_countas_integer_ratio__trunc____floor____ceil__bits_per_digitsize of a digit in bitssizeof_digitdefault_max_str_digitsstr_digits_check_thresholdsignedsys.int_infox.__getitem__(y) <==> x[y]list_iteratorlist_reverseiteratoranext_awaitablecallable_iteratorforceInterpreterID__closure____globals____func____wrapped__argdefsclosuref_localsf_linenof_tracef_lastif_backf_codef_builtinsf_globalsf_trace_linesf_trace_opcodesmax_expmax_10_expmin_expmin_10_expmant_digepsilonradixroundsis_integersys.float_infoEncoding of the filestderrprintername of the generatorgi_yieldfromgi_runninggi_framegi_codename of the coroutinecr_awaitcr_runningcr_framecr_codecr_originname of the async generatorag_awaitag_frameag_runningag_codeacloseasync_generator_wrapped_valueasync_generator_asendcoroutine_wrapperasync_generator_athrowasync_generatortypes.GenericAlias__traceback____context__exception context__cause__exception cause__suppress_context__with_tracebackgenerator return valueexception messagemodule pathPOSIX exception codeexception strerrorfilename2second exception filenameattribute nameexception msgexception linenoexception offsetexception textexception end linenoexception end offsetexception print_file_and_lineexception encodingexception objectexception startexception endexception reasonTimeout expired.Process not found.Not enough permissions.Interrupted by signal.File not found.File already exists.Connection reset.Connection refused.Connection aborted.Child process error.Broken pipe.I/O operation would block.Connection error.Buffer error.Out of memory.Assertion failed.Unicode translation error.Unicode decoding error.Unicode encoding error.Unicode related error.Mapping key not found.Sequence index out of range.Base class for lookup errors.Improper indentation.Invalid syntax.Attribute not found.Name not found globally.Recursion limit exceeded.Unspecified run-time error.Read beyond end of file.Module not found.Program interrupted by user.Inappropriate argument type.__objclass__fgetfdelsetterdeleterwrapper_descriptorgetset_descriptormember_descriptorclassmethod_descriptormappingproxymethod-wrapper__complex__co_lnotabco_argcountco_posonlyargcountco_kwonlyargcountco_nlocalsco_stacksizeco_flagsco_codeco_constsco_namesco_varnamesco_freevarsco_cellvarsco_nameco_firstlinenoco_linetableco_linesline_iteratorcell_contentsPyCapsulebytes_iterator__alloc__bytearray_iteratorcontinuenonlocalfinallyassertglobalexceptraisebreakelifforENDMARKERNAMESTRINGNEWLINEINDENTDEDENTLPARRPARLSQBRSQBCOLONCOMMASEMIPLUSMINUSVBARAMPERLESSGREATERPERCENTLBRACERBRACEEQEQUALNOTEQUALLESSEQUALGREATEREQUALTILDECIRCUMFLEXLEFTSHIFTRIGHTSHIFTDOUBLESTARPLUSEQUALMINEQUALPERCENTEQUALAMPEREQUALVBAREQUALCIRCUMFLEXEQUALLEFTSHIFTEQUALRIGHTSHIFTEQUALDOUBLESTAREQUALDOUBLESLASHDOUBLESLASHEQUALATEQUALRARROWELLIPSISCOLONEQUALTYPE_IGNORETYPE_COMMENTSOFT_KEYWORDEncoding changed twice while reading the configurationPYTHONMALLOC: unknown allocatorinvalid PYTHONUTF8 environment variable valuepreinitialization config is NULLUnknown PYTHONMALLOC allocatorcannot decode command line argumentsArgument expected for the %ls options Argument expected for the -%c option PyWideStringList_Insert index must be >= 0Error setting LC_CTYPE, skipping C locale coercion failed to get random numbers to initialize Pythonmain interpreter already initialized-X int_max_str_digits: invalid limit; must be >= 640 or 0 for unlimited.PYTHONINTMAXSTRDIGITS: invalid limit; must be >= 640 or 0 for unlimited.PYTHONTRACEMALLOC: invalid number of frames-X tracemalloc=NFRAME: invalid number of framesPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]--check-hash-based-pycs must be one of 'default', 'always', or 'never' Try `python -h' for more information. cannot decode PYTHONPLATLIBDIRcannot decode PYTHONPYCACHEPREFIXcannot decode PLATLIBDIR macrocannot decode _Py_StandardStreamEncodingcannot decode _Py_StandardStreamErrorscannot decode PYTHONIOENCODING environment variablebad ID: Allocated using API '%c', verified using API '%c'cannot decode PATH environment variablecannot decode PYTHONPATH macrocannot decode EXEC_PREFIX macro/builddir/build/BUILD/Python-3.10.16Consider setting $PYTHONHOME to [:] /dev/urandom (or equivalent) not foundFailed to read %zi bytes from /dev/urandomCan't initialize threads for interpretercpython.PyInterpreterState_Newfailed to get an interpreter IDTimeout larger than PY_TIMEOUT_MAXCouldn't create autoTSSkey mappingPyMUTEX_FINI(gil->mutex) failedPyCOND_FINI(gil->switch_cond) failedPyMUTEX_FINI(gil->switch_mutex) failedPyMUTEX_INIT(gil->mutex) failedPyMUTEX_INIT(gil->switch_mutex) failedPyCOND_INIT(gil->switch_cond) failedPyMUTEX_LOCK(gil->mutex) failedPyMUTEX_UNLOCK(gil->mutex) failedPyMUTEX_LOCK(gil->switch_mutex) failedPyCOND_SIGNAL(gil->switch_cond) failedPyMUTEX_UNLOCK(gil->switch_mutex) failedcan't initialize builtins modulefailed to create a module objectfailed to initialize UnraisableHookArgs typeCan't initialize formatter iter typeCan't initialize field name iterator typeCan't initialize encoding map typeCan't initialize _PyUnion_Type typeCan't initialize _PyWeakref_RefType typeCan't initialize _PyWeakref_ProxyType typeCan't initialize _PyWeakref_CallableProxyType typeCan't initialize _PyNotImplemented_Type typeCan't initialize _PyNone_Type typeCan't initialize _PyNamespace_Type typeCan't initialize _PyMethodWrapper_Type typeCan't initialize _PyManagedBuffer_Type typeCan't initialize _PyInterpreterID_Type typeCan't initialize _PyCoroWrapper_Type typeCan't initialize _PyAsyncGenWrappedValue_Type typeCan't initialize _PyAsyncGenAThrow_Type typeCan't initialize _PyAsyncGenASend_Type typeCan't initialize _PyAnextAwaitable_Type typeCan't initialize Py_GenericAliasType typeCan't initialize PyWrapperDescr_Type typeCan't initialize PyUnicode_Type typeCan't initialize PyUnicodeIter_Type typeCan't initialize PyTuple_Type typeCan't initialize PyTupleIter_Type typeCan't initialize PyTraceBack_Type typeCan't initialize PySuper_Type typeCan't initialize PyStdPrinter_Type typeCan't initialize PyStaticMethod_Type typeCan't initialize PySlice_Type typeCan't initialize PySet_Type typeCan't initialize PySetIter_Type typeCan't initialize PySeqIter_Type typeCan't initialize PySTEntry_Type typeCan't initialize PyReversed_Type typeCan't initialize PyRange_Type typeCan't initialize PyRangeIter_Type typeCan't initialize PyProperty_Type typeCan't initialize PyPickleBuffer_Type typeCan't initialize PyODict_Type typeCan't initialize PyODictValues_Type typeCan't initialize PyODictKeys_Type typeCan't initialize PyODictIter_Type typeCan't initialize PyODictItems_Type typeCan't initialize PyModule_Type typeCan't initialize PyModuleDef_Type typeCan't initialize PyMethod_Type typeCan't initialize PyMethodDescr_Type typeCan't initialize PyMemoryView_Type typeCan't initialize PyMemberDescr_Type typeCan't initialize PyLong_Type typeCan't initialize PyLongRangeIter_Type typeCan't initialize PyList_Type typeCan't initialize PyListRevIter_Type typeCan't initialize PyListIter_Type typeCan't initialize PyInstanceMethod_Type typeCan't initialize PyGetSetDescr_Type typeCan't initialize PyGen_Type typeCan't initialize PyFunction_Type typeCan't initialize PyFrozenSet_Type typeCan't initialize PyFrame_Type typeCan't initialize PyFloat_Type typeCan't initialize PyEnum_Type typeCan't initialize PyEllipsis_Type typeCan't initialize PyDict_Type typeCan't initialize PyDictValues_Type typeCan't initialize PyDictRevIterValue_Type typeCan't initialize PyDictRevIterKey_Type typeCan't initialize PyDictRevIterItem_Type typeCan't initialize PyDictProxy_Type typeCan't initialize PyDictKeys_Type typeCan't initialize PyDictIterValue_Type typeCan't initialize PyDictIterKey_Type typeCan't initialize PyDictIterItem_Type typeCan't initialize PyDictItems_Type typeCan't initialize PyCoro_Type typeCan't initialize PyComplex_Type typeCan't initialize PyCode_Type typeCan't initialize PyClassMethod_Type typeCan't initialize PyClassMethodDescr_Type typeCan't initialize PyCell_Type typeCan't initialize PyCapsule_Type typeCan't initialize PyCallIter_Type typeCan't initialize PyCMethod_Type typeCan't initialize PyCFunction_Type typeCan't initialize PyBytes_Type typeCan't initialize PyBytesIter_Type typeCan't initialize PyByteArray_Type typeCan't initialize PyByteArrayIter_Type typeCan't initialize PyBool_Type typeCan't initialize PyAsyncGen_Type typeCan't initialize PyType_Type typeCan't initialize PyBaseObject_Type typefailed to initialize importlibimport _frozen_importlib # frozen Python memory allocator called without holding the GILinvalid maximum character passed to PyUnicode_NewNegative size passed to PyUnicode_New/builddir/build/BUILD/Python-3.10.16/Modules/gcmodule.c/builddir/build/BUILD/Python-3.10.16/Objects/listobject.c/builddir/build/BUILD/Python-3.10.16/Objects/dictobject.cdeletion of interned string failed/builddir/build/BUILD/Python-3.10.16/Objects/unicodeobject.cType does not define the tp_name field.type '%.100s' is not dynamically allocated but its base type '%.100s' is dynamically allocatedmethod cannot be both class and statictype '%.100s' participates in gc and is a base type but has inappropriate tp_free slotmro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')Cannot extend an incomplete type '%.100s'/builddir/build/BUILD/Python-3.10.16/Objects/tupleobject.cattempting to create PyCMethod with a METH_METHOD flag but no classattempting to create PyCFunction with class but no METH_METHOD flagcannot create weak reference to '%s' objectobject already tracked by the garbage collectorgc: collecting generation %d... gc: objects in each generation:%s gc: objects in permanent generation: %zd gc: done, %zd unreachable, %zd uncollectable, %.4fs elapsed /builddir/build/BUILD/Python-3.10.16/Objects/structseq.cexceptions bootstrapping error.module %s: PyModule_Create is incompatible with m_slotsPython C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.module functions cannot set METH_CLASS or METH_STATICattribute name must be string, not '%.200s''%.100s' object has no attributes (%s .%U)'%.100s' object has only read-only attributes (%s .%U)'%.100s' object has no attribute '%U''%.50s' object attribute '%U' is read-onlyNot enough memory to allocate new values array/builddir/build/BUILD/Python-3.10.16/Objects/moduleobject.csequence index must be integer, not '%.200s''%.200s' object is not subscriptable[GCC 11.5.0 20240719 (Red Hat 11.5.0-2)]PY_SSIZE_T_CLEAN macro must be defined for '#' formatsNULL object passed to Py_BuildValuebad format char passed to Py_BuildValueNegative size passed to PyUnicode_FromStringAndSizePyUnicode_FromStringAndSize(NULL, size) is deprecated; use PyUnicode_New() insteadMissed attribute '%U' of type %s/builddir/build/BUILD/Python-3.10.16/Objects/longobject.cPython int too large to convert to C ssize_t'%.200s' object is not iterableiter() returned non-iterator of type '%.100s'%R returned NULL without setting an exception%s returned NULL without setting an exception%R returned a result with an exception set%s returned a result with an exception setcharacter U+%x is not in range [U+0000; U+%x]/builddir/build/BUILD/Python-3.10.16/Python/import.c'%.200s' object does not support item assignmentPyState_AddModule called on module with slotslist assignment index out of rangeModule dictionary insertion problem.Excluded frozen object named %Rfrozen object %R is not a code objectXXX readobject called with exception set NULL object in marshal data for objectEOF read where object expectedbad marshal data (long size out of range)bad marshal data (unnormalized long data)bad marshal data (digit out of range in long)bad marshal data (bytes object size out of range)bad marshal data (string size out of range)bad marshal data (tuple size out of range)NULL object in marshal data for tuplebad marshal data (list size out of range)NULL object in marshal data for listbad marshal data (set size out of range)NULL object in marshal data for setbad marshal data (invalid reference)bad marshal data (unknown type code)bad marshal data (index list too large)Negative size passed to PyBytes_FromStringAndSizeread() returned too much data: %zd bytes requested, %zd returned/builddir/build/BUILD/Python-3.10.16/Objects/codeobject.cCan't compare %.100s and %.100sLoaded module %R not found in sys.modules%U() got some positional-only arguments passed as keyword arguments: '%U'%U() got an unexpected keyword argument '%S'%U() got multiple values for argument '%S' positional argument%s (and %zd keyword-only argument%s)%U() takes %U positional argument%s but %zd%U %s givencannot import name %R from partially initialized module %R (most likely due to a circular import) (%S)cannot import name %R from %R (%S)the function must be called with the GIL held, but the GIL is released (the current Python thread state is NULL)local variable '%.200s' referenced before assignmentNo active exception to reraisecalling %R should have returned an instance of BaseException, not %Rexceptions must derive from BaseExceptionexception causes must derive from BaseException'async for' requires an object with __aiter__ method, got %.100s'async for' received an object from __aiter__ that does not implement __anext__: %.100s'async for' requires an iterator with __anext__ method, got %.100s'async for' received an invalid object from __anext__: %.100s'async with' received an object from __aenter__ that does not implement __await__: %.100s'async with' received an object from __aexit__ that does not implement __await__: %.100scoroutine is being awaited alreadypopped block is not an except handlerno locals found when storing %RValue after * must be an iterable, not %.200sno locals found when setting up annotationsbad BUILD_CONST_KEY_MAP keys argument'%.200s' object is not a mappingcatching classes that do not inherit from BaseException is not allowedno locals found during 'import *'from-import-* object has no __dict__ and no __all__module __name__ must be a string, not %.100s%s in %U.%s must be str, not %.100scalled match pattern must be a type%s.__match_args__ must be a tuple (got %s)%s() accepts %d positional sub-pattern%s (%d given)__match_args__ elements must be strings (got %s)mapping pattern checks duplicate key (%R)cannot 'yield from' a coroutine object in a non-coroutine generator%U argument after * must be an iterable, not %.200serror return without exception setcannot import name %R from %R (unknown location) while calling a Python object__build_class__: not enough arguments__build_class__: func must be a function__build_class__: name is not a string__mro_entries__ must return a tuple%.200s.__prepare__() must return a mapping, not %.200s__class__ not set defining %.200R as %.200R. Was __classcell__ propagated to type.__new__?__class__ set to %.200R defining %.200R as %.200Rmetaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its basestype object '%.50s' has no attribute '%U'descriptor '%V' for type '%.100s' needs either an object or a typedescriptor '%V' for type '%.100s' needs a type, not a '%.100s' as arg 2descriptor '%V' requires a subtype of '%.100s' but received '%.100s''%.200s' object is not callable%.200s.__init__() takes exactly one argument (the instance to initialize)type() doesn't support MRO entry resolution; use types.new_class()nonempty __slots__ not supported for subtype of '%s'__slots__ items must be strings, not '%.200s'__dict__ slot disallowed: we already got one__weakref__ slot disallowed: either we already got one, or __itemsize__ != 0%R in __slots__ conflicts with class variabletype name must not contain null characterstype __qualname__ must be a str, not %s__classcell__ must be a nonlocal cell, not %.200RError calling __set_name__ on '%.100s' instance %R in '%.100s'new style getargs format but argument is not a tupletoo many tuple nesting levels in argument format string%.200s%s takes at least one argumentold style getargs format uses new features%.150s%s takes %s %d argument%s (%zd given)unsigned byte integer is less than minimumunsigned byte integer is greater than maximumsigned short integer is less than minimumsigned short integer is greater than maximumPython int too large to convert to C longsigned integer is greater than maximumsigned integer is less than minimumgetargs: The '%c' format is deprecated. Use 'U' instead.(unknown parser marker combination)encoded string too long (%zd, maximum length %zd)encoded string without null bytes(invalid use of 'w' format character)type '%.100s' is not an acceptable base typemultiple bases have instance lay-out conflictsuper(): __class__ is not a type (%s)super(): __class__ cell not foundsuper(type, obj): obj must be an instance or subtype of type'%.50s' object has no attribute '%U'%U takes no arguments (%zd given)type.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 argumentsobject.__init__() takes exactly one argument (the instance to initialize)descriptor '%V' for '%.100s' objects doesn't apply to a '%.100s' object'%.200s' object has no attribute '%s'descriptor '%V' needs a type, not '%s', as arg 2%U takes exactly one argument (%zd given)%.200s() takes no keyword arguments__set_name__() takes 2 positional arguments but %d were givenPyArg_UnpackTuple() argument list is not a tuple%.200s expected %s%zd argument%s, got %zdunpacked tuple should have %s%zd element%s, but has %zdattribute '%V' of '%.100s' objects is not readablehasattr(): attribute name must be stringgetattr(): attribute name must be stringcan't delete numeric/char attributeattribute value type must be boolTruncation of value to unsigned charTruncation of value to unsigned shortWriting negative value into unsigned fieldTruncation of value to unsigned intattribute '%V' of '%.100s' objects is not writable__name__ must be set to a string object__qualname__ must be set to a string objectunbound method %U needs an argumentstrings are too large to concatobject.__new__() takes exactly one argument (the type to instantiate)Can't instantiate abstract class %s with abstract method%s %U/builddir/build/BUILD/Python-3.10.16/Objects/weakrefobject.cimport %U # previously loaded (%R) module %s: m_size may not be negative for multi-phase initializationmodule %s has multiple create slotsmodule %s uses unknown slot ID %icreation of module %s failed without setting an exceptioncreation of module %s raised unreported exceptionmodule %s is not a module object, but requests module statemodule %s specifies execution slots, but did not create a ModuleType instanceexecution of module %s failed without setting an exceptionexecution of module %s raised unreported exceptionmodule %s initialized with unknown slot %iPyModule_AddObjectRef() first argument must be a modulePyModule_AddObjectRef() must be called with an exception raised if value is NULLpartially initialized module '%U' has no attribute '%U' (most likely due to a circular import)module '%U' has no attribute '%U'attribute of type '%.200s' is not callable%s() requires a dict argument, not '%s'dictionary changed size during iterationdictionary keys changed during iteration/builddir/build/BUILD/Python-3.10.16/Objects/object.c'%s' not supported between instances of '%.100s' and '%.100s'character argument not in range(0x110000)PyUnicode_FromFormatV() expects an ASCII-encoded format string, got a non-ASCII byte: 0x%02x_PyErr_SetObject: exception %R is not a BaseException subclassmaximum recursion depth exceeded while normalizing an exceptionCannot recover from MemoryErrors while normalizing exceptions.Cannot recover from the recursive normalization of an exception.calling %R should have returned an instance of BaseException, not %s/builddir/build/BUILD/Python-3.10.16/Python/getargs.c%.200s%s takes at most %d %sargument%s (%zd given)Invalid format string (| specified twice)Invalid format string ($ before |)Invalid format string ($ specified twice)%.200s%s takes no positional arguments%.200s%s takes %s %d positional argument%s (%zd given)More keyword list entries (%d) than format specifiers (%d)%.200s%s missing required argument '%s' (pos %d)more argument specifiers than keyword list entries (remaining format:'%s')argument for %.200s%s given by name ('%s') and position (%d)'%U' is an invalid keyword argument for %.200s%sinvalid keyword argument for %.200s%s/builddir/build/BUILD/Python-3.10.16/Python/traceback.c__traceback__ may not be deleted__traceback__ must be a traceback or None__init__() should return None, not '%.200s'tuple indices must be integers or slices, not %.200scannot fit '%.200s' into an index-sized integer'%.200s' object cannot be interpreted as an integer__index__ returned non-int (type %.200s)__index__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.uninitialized classmethod object/builddir/build/BUILD/Python-3.10.16/Objects/classobject.cuninitialized staticmethod object'%.200s' object does not support vectorcallType spec does not define the name field.builtin type %.200s has no __module__ attributewarnings_get_state: could not identify current interpretercan't initialize sys standard streams is a directory, cannot continueFailed to initialize __main__.__loader__Failed to retrieve BuiltinImporterFailed to test __main__.__loader__Failed to initialize __main__.__builtins__Failed to retrieve builtins moduleFailed to test __main__.__builtins__Failed to initialize __main__.__annotations__failed to get the Python codec name of the stdio encodingcannot initialize filesystem codecfailed to get the Python codec of the filesystem encodingexternal importer setup failedfailed to update the Python configFailed to import the site moduleunknown filesystem error handler'import warnings' failed; traceback: Python runtime initialized with LC_CTYPE=C (a locale with default ASCII encoding), which may cause Unicode compatibility problems. Using C.UTF-8, C.utf8, or UTF-8 (if available) as alternative Unicode-compatible locales is recommended. # can't import zipimport.zipimporter maximum number of symbolic links reachedpath configuration: path too longCould not find platform independent libraries Could not find platform dependent libraries Python int too large to convert to C int__package__ != __spec__.parent__spec__.parent must be a stringcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__attempted relative import beyond top-level packageattempted relative import with no known parent packageimport time: self [us] | cumulative | imported package import time: %9ld | %10ld | %*s%s %R not in sys.modules as expectedcan't specify a timeout for a non-blocking calltimeout value must be positive'%.200s' object does not support item deletionNo such frozen object named %R/builddir/build/BUILD/Python-3.10.16/Objects/setobject.c__length_hint__ must be an integer, not %.100s__length_hint__() should return >= 0Set changed size during iterationtype_traverse() called on non-heap type '%.100s'/builddir/build/BUILD/Python-3.10.16/Objects/typeobject.cglobals and locals cannot be NULLexec() globals must be a dict, not %.100slocals must be a mapping or None, not %.100scode object passed to exec() may not contain free variablesPython import machinery not initializedNegative size passed to _PyUnicode_Newargument should be integer or None, not %.200scan't send non-None value to a just-started coroutinecan't send non-None value to a just-started generatorcan't send non-None value to a just-started async generatorasync generator already executingcoroutine raised StopIterationgenerator raised StopIterationasync generator raised StopIterationcannot reuse already awaited coroutineasync generator raised StopAsyncIterationPyObject_CallFinalizerFromDealloc called on object with a non-zero refcountcoroutine '%S' was never awaitedlist indices must be integers or slices, not %.200sseparator: expected str instance, %.80s foundsequence item %zd: expected str instance, %.80s foundjoin() result is too long for a Python stringchr() arg not in range(0x110000)can only concatenate tuple (not "%.200s") to tupleslice indices must be integers or None or have an __index__ methodtuple for startswith must only contain str, not %.100sstartswith first arg must be str or a tuple of str, not %.100sbyteorder must be either 'little' or 'big'length argument must be non-negativecan't convert negative int to unsigneda bytes-like object is required, not '%.100s'PyBuffer_FillInfo: view==NULL argument is obsolete__bytes__ returned non-bytes (type %.200s)byte array too long to convert to int/builddir/build/BUILD/Python-3.10.16/Objects/cellobject.cstring indices must be integers_Py_normalize_encoding() failedno codec search functions registered: can't find encodingcodec search functions must return 4-tuplesfile is not a valid file descripterfile.fileno() is not a valid file descriptorstring, bytes, os.PathLike, integer or Nonestring, bytes, os.PathLike or integerstring, bytes, os.PathLike or Noneexpected %.200s.__fspath__() to return str or bytes, not %.200s%s%s%s should be %s, not %.200s%s%sembedded null character in %sunable to get the current thread stateexpected str, bytes or os.PathLike object, not %.200s%s: can't specify dir_fd without matching path%s: can't specify both dir_fd and fd%s: cannot use fd and follow_symlinks togetherPyCOND_SIGNAL(gil->cond) failedPyCOND_WAIT(gil->switch_cond) failed%s expected at least 1 argument, got 0Cannot specify a default for %s() with multiple positional argumentsSignal %i ignored due to race conditionunsupported operand type(s) for %.100s: '%.100s' and '%.100s'. Did you mean "print(, file=)"?Unmatched right paren in format stringUnmatched left paren in format stringtuple for endswith must only contain str, not %.100sendswith first arg must be str or a tuple of str, not %.100s while getting the str of an object__str__ returned non-string (type %.200s)int() base must be >= 2 and <= 36, or 0int() can't convert non-string with explicit base__int__ returned non-int (type %.200s)__int__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.__trunc__ returned non-Integral (type %.200s)int() argument must be a string, a bytes-like object or a real number, not '%.200s'cannot convert float infinity to integercannot convert float NaN to integerisinstance() arg 2 must be a type, a tuple of types, or a union'path' must be 'str', not '%.200s'mode U cannot be combined with 'x', 'w', 'a', or '+'can't have text and binary mode at oncemust have exactly one of create/read/write/append modebinary mode doesn't take an encoding argumentbinary mode doesn't take an errors argumentbinary mode doesn't take a newline argumentline buffering (buffering=1) isn't supported in binary mode, the default buffer size will be usedcan't have unbuffered text I/OMust have exactly one of create/read/write/append mode and at most one plusCannot use closefd=False with file nameFile or stream is not readable.buffer size must be strictly positiveRaw stream returned invalid position %zdcannot fit '%.200s' into an offset-sized integerI/O operation on uninitialized objectread length must be non-negative or -1unbounded read returned more bytes than a Python bytes object can hold/builddir/build/BUILD/Python-3.10.16/Objects/bytesobject.c_PyErr_ChainExceptions: exception %R is not a BaseException subclassbyte indices must be integers or slices, not %.200sComparison between bytes and stringComparison between bytes and intcompile() mode must be 'exec', 'eval', 'single' or 'func_type'compile() mode must be 'exec', 'eval' or 'single'compile(): invalid optimize valuecompile() mode 'func_type' requires flag PyCF_ONLY_ASTrequired field "body" missing from ModuleModule field "body" must be a list, not a %.200s while traversing 'Module' nodeModule field "body" changed size during iterationrequired field "type_ignores" missing from ModuleModule field "type_ignores" must be a list, not a %.200srequired field "lineno" missing from TypeIgnore while traversing 'TypeIgnore' noderequired field "tag" missing from TypeIgnoreexpected some sort of type_ignore, but got %RModule field "type_ignores" changed size during iterationrequired field "body" missing from InteractiveInteractive field "body" must be a list, not a %.200s while traversing 'Interactive' nodeInteractive field "body" changed size during iterationrequired field "body" missing from Expression while traversing 'Expression' noderequired field "argtypes" missing from FunctionTypeFunctionType field "argtypes" must be a list, not a %.200s while traversing 'FunctionType' nodeFunctionType field "argtypes" changed size during iterationrequired field "returns" missing from FunctionTypeexpected some sort of mod, but got %RAST validator recursion depth mismatch (before=%d, after=%d)%.200s%s missing required argument '%U' (pos %d)argument for %.200s%s given by name ('%U') and position (%d)operation forbidden on released memoryview objectmemoryview: a bytes-like object is required, not '%.200s'path should be string, bytes, or os.PathLike, not %.200smemoryview: number of dimensions must not exceed 64mod = Module(stmt* body, type_ignore* type_ignores) | Interactive(stmt* body) | Expression(expr body) | FunctionType(expr* argtypes, expr returns)Module(stmt* body, type_ignore* type_ignores)FunctionType(expr* argtypes, expr returns)stmt = FunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment) | AsyncFunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment) | ClassDef(identifier name, expr* bases, keyword* keywords, stmt* body, expr* decorator_list) | Return(expr? value) | Delete(expr* targets) | Assign(expr* targets, expr value, string? type_comment) | AugAssign(expr target, operator op, expr value) | AnnAssign(expr target, expr annotation, expr? value, int simple) | For(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment) | AsyncFor(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment) | While(expr test, stmt* body, stmt* orelse) | If(expr test, stmt* body, stmt* orelse) | With(withitem* items, stmt* body, string? type_comment) | AsyncWith(withitem* items, stmt* body, string? type_comment) | Match(expr subject, match_case* cases) | Raise(expr? exc, expr? cause) | Try(stmt* body, excepthandler* handlers, stmt* orelse, stmt* finalbody) | Assert(expr test, expr? msg) | Import(alias* names) | ImportFrom(identifier? module, alias* names, int? level) | Global(identifier* names) | Nonlocal(identifier* names) | Expr(expr value) | Pass | Break | ContinueFunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment)AsyncFunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment)ClassDef(identifier name, expr* bases, keyword* keywords, stmt* body, expr* decorator_list)Assign(expr* targets, expr value, string? type_comment)AugAssign(expr target, operator op, expr value)AnnAssign(expr target, expr annotation, expr? value, int simple)For(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment)AsyncFor(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment)While(expr test, stmt* body, stmt* orelse)If(expr test, stmt* body, stmt* orelse)With(withitem* items, stmt* body, string? type_comment)AsyncWith(withitem* items, stmt* body, string? type_comment)Match(expr subject, match_case* cases)Try(stmt* body, excepthandler* handlers, stmt* orelse, stmt* finalbody)ImportFrom(identifier? module, alias* names, int? level)expr = BoolOp(boolop op, expr* values) | NamedExpr(expr target, expr value) | BinOp(expr left, operator op, expr right) | UnaryOp(unaryop op, expr operand) | Lambda(arguments args, expr body) | IfExp(expr test, expr body, expr orelse) | Dict(expr* keys, expr* values) | Set(expr* elts) | ListComp(expr elt, comprehension* generators) | SetComp(expr elt, comprehension* generators) | DictComp(expr key, expr value, comprehension* generators) | GeneratorExp(expr elt, comprehension* generators) | Await(expr value) | Yield(expr? value) | YieldFrom(expr value) | Compare(expr left, cmpop* ops, expr* comparators) | Call(expr func, expr* args, keyword* keywords) | FormattedValue(expr value, int conversion, expr? format_spec) | JoinedStr(expr* values) | Constant(constant value, string? kind) | Attribute(expr value, identifier attr, expr_context ctx) | Subscript(expr value, expr slice, expr_context ctx) | Starred(expr value, expr_context ctx) | Name(identifier id, expr_context ctx) | List(expr* elts, expr_context ctx) | Tuple(expr* elts, expr_context ctx) | Slice(expr? lower, expr? upper, expr? step)BoolOp(boolop op, expr* values)NamedExpr(expr target, expr value)BinOp(expr left, operator op, expr right)UnaryOp(unaryop op, expr operand)Lambda(arguments args, expr body)IfExp(expr test, expr body, expr orelse)Dict(expr* keys, expr* values)ListComp(expr elt, comprehension* generators)SetComp(expr elt, comprehension* generators)DictComp(expr key, expr value, comprehension* generators)GeneratorExp(expr elt, comprehension* generators)Compare(expr left, cmpop* ops, expr* comparators)Call(expr func, expr* args, keyword* keywords)FormattedValue(expr value, int conversion, expr? format_spec)Constant(constant value, string? kind)Attribute(expr value, identifier attr, expr_context ctx)Subscript(expr value, expr slice, expr_context ctx)Starred(expr value, expr_context ctx)Name(identifier id, expr_context ctx)List(expr* elts, expr_context ctx)Tuple(expr* elts, expr_context ctx)Slice(expr? lower, expr? upper, expr? step)expr_context = Load | Store | Deloperator = Add | Sub | Mult | MatMult | Div | Mod | Pow | LShift | RShift | BitOr | BitXor | BitAnd | FloorDivunaryop = Invert | Not | UAdd | USubcmpop = Eq | NotEq | Lt | LtE | Gt | GtE | Is | IsNot | In | NotIncomprehension(expr target, expr iter, expr* ifs, int is_async)excepthandler = ExceptHandler(expr? type, identifier? name, stmt* body)arguments(arg* posonlyargs, arg* args, arg? vararg, arg* kwonlyargs, expr* kw_defaults, arg? kwarg, expr* defaults)arg(identifier arg, expr? annotation, string? type_comment)keyword(identifier? arg, expr value)alias(identifier name, identifier? asname)withitem(expr context_expr, expr? optional_vars)match_case(pattern pattern, expr? guard, stmt* body)pattern = MatchValue(expr value) | MatchSingleton(constant value) | MatchSequence(pattern* patterns) | MatchMapping(expr* keys, pattern* patterns, identifier? rest) | MatchClass(expr cls, pattern* patterns, identifier* kwd_attrs, pattern* kwd_patterns) | MatchStar(identifier? name) | MatchAs(pattern? pattern, identifier? name) | MatchOr(pattern* patterns)MatchSingleton(constant value)MatchSequence(pattern* patterns)MatchMapping(expr* keys, pattern* patterns, identifier? rest)MatchClass(expr cls, pattern* patterns, identifier* kwd_attrs, pattern* kwd_patterns)MatchAs(pattern? pattern, identifier? name)type_ignore = TypeIgnore(int lineno, string tag)TypeIgnore(int lineno, string tag)cannot set %R attribute of immutable type '%s'Out of memory interning an attribute nameinvalid indexing of 0-dim memorymulti-dimensional slicing is not implementedmemoryview has %zd exported buffer%s_memory_release(): negative export count%s() arg 1 must be a %s objectsource code string cannot contain null bytesmemoryview: underlying buffer is not writablememoryview: underlying buffer is not C-contiguousmemoryview: underlying buffer is not Fortran contiguousmemoryview: underlying buffer is not contiguousmemoryview: underlying buffer requires suboffsetsmemoryview: cannot cast to unsigned bytes if the format flag is present/builddir/build/BUILD/Python-3.10.16/Objects/frameobject.cco_varnames must be a tuple, not %serror at start before reading any inputmultiple statements found while compiling a single statement'%.200s' object does not support indexingParenthesized context managers areexpected an indented block after 'try' statement on line %dexpected 'except' or 'finally' blockmultiple exception types must be parenthesizedexpected an indented block after 'case' statement on line %dexpected an indented block after 'match' statement on line %dunknown error handler name '%.400s'inconsistent use of tabs and spaces in indentationtoo many levels of indentationunexpected character after line continuation characterunindent does not match any outer indentation levelinvalid non-printable character U+%sinvalid digit '%c' in octal literalinvalid digit '%c' in binary literalleading zeros in decimal integer literals are not permitted; use an 0o prefix for octal integersclosing parenthesis '%c' does not match opening parenthesis '%c' on line %dclosing parenthesis '%c' does not match opening parenthesis '%c'unterminated triple-quoted string literal (detected at line %d)unterminated string literal (detected at line %d)Format string contains positional fieldsReplacement index %zd out of range for positional args tupleUnknown conversion specifier %cUnknown conversion specifier \x%xNon-UTF-8 code starting with '\x%.2x' in file %U on line %i, but no encoding declared; see https://python.org/dev/peps/pep-0263/ for detailsSingle '}' encountered in format stringSingle '{' encountered in format stringend of string while looking for conversion specifierexpected ':' after conversion specifierexpected '}' before end of stringcannot switch from manual field specification to automatic field numberingcannot switch from automatic field numbering to manual field specificationToo many decimal digits in format stringOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringSpace not allowed in string format specifierSign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierVariable annotations syntax isonly single target (not %s) can be annotatedonly single target (not tuple) can be annotatedassignment to yield expression not possible'%s' is an illegal expression for augmented assignmentcannot use starred expression herecannot use double starred expression here':' expected after dictionary keycannot use a starred expression in a dictionary valueexpression expected after dictionary key and ':'dict unpacking cannot be used in dict comprehensionFormat strings are only supported in Python 3.6 and greater/builddir/build/BUILD/Python-3.10.16/Parser/string_parser.cbytes can only contain ASCII literal characterscannot mix bytes and nonbytes literals'in ' requires string as left operand, not %.100s__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()field 'value' is required for ConstantPyErr_NewException: name must be module.classinvalid syntax. Perhaps you forgot a comma?expected 'else' after 'if' expressionMissing parentheses in call to '%U'. Did you mean %U(...)?with Barry as BDFL, use '<>' instead of '!='items() returned item which size is not 2__abc_tpflags__ cannot be both Py_TPFLAGS_SEQUENCE and Py_TPFLAGS_MAPPINGmappingproxy() argument must be a mapping, not %s%.200s.%U() returned a non-iterable (type %.200s)field 'value' is required for ExprUnderscores in numeric literals are only supported in Python 3.6 and greater%S - Consider hexadecimal for huge integer literals to avoid decimal conversion limits.PyType_GetModule: Type '%s' is not a heap typePyType_GetModule: Type '%s' has no associated modulenon-default argument follows default argumentPositional-only parameters arecannot set '%s' attribute of immutable type '%s'cannot delete '%s' attribute of immutable type '%s'Refusing to create an inheritance cycleissubclass() arg 1 must be a class__subclasshook__ must return either False, True, or NotImplemented__subclasses__() must return a listunicodedata.normalize() must return a string, not %.200sfield 'id' is required for Namefield 'ctx' is required for Name_abc_impl is set to a wrong typefield 'name' is required for aliastrailing comma not allowed without surrounding parenthesesissubclass() arg 2 must be a class, a tuple of classes, or a union while getting the repr of an object__repr__ returned non-string (type %.200s)string is too long to generate reprexpected a subclass of ImportError'encoding' argument not specifiedTextIOWrapper() argument 'errors' must be str or None, not %.50sembedded null character in errors'%.400s' is not a text encoding; use %s to handle arbitrary codecscannot use assignment expressions with %sinvalid syntax. Maybe you meant '==' or ':=' instead of '='?cannot assign to %s here. Maybe you meant '==' instead of '='?field 'ctx' is required for Listfield 'value' is required for Attributefield 'attr' is required for Attributefield 'ctx' is required for Attributeexpected an indented block after class definition on line %dpositional argument follows keyword argument unpackingpositional argument follows keyword argumentiterable argument unpacking follows keyword argument unpackingGenerator expression must be parenthesizedFile or stream is not writable.field 'func' is required for Callfield 'name' is required for ClassDefexpected an indented block after function definition on line %dfield 'arg' is required for argiter(v, w): v must be callableencoding without a string argumenterrors without a string argumentstring argument without an encodingcannot convert '%.200s' object to bytearray/builddir/build/BUILD/Python-3.10.16/Objects/bytearrayobject.cnamed arguments must follow bare *bare * has associated type commentdeallocated bytearray object has exported buffersmust be str or None, not %.100s'%.200s' object is not reversibleCannot have two type comments on defrange() arg 3 must not be zerorange expected at least 1 argument, got 0range expected at most 3 arguments, got %zdexpected an indented block after 'elif' statement on line %dexpected an indented block after 'else' statement on line %dfield 'test' is required for Ifinteger division or modulo by zerofield 'target' is required for Forfield 'iter' is required for Forfield 'name' is required for FunctionDeffield 'args' is required for FunctionDefcoroutine ignored GeneratorExitgenerator ignored GeneratorExitasync generator ignored GeneratorExitfield 'op' is required for UnaryOpfield 'operand' is required for UnaryOpfield 'left' is required for BinOpfield 'op' is required for BinOpfield 'right' is required for BinOpfield 'value' is required for keywordtype object '%s' has no attribute '__annotations__'expected an indented block after 'finally' statement on line %dprivate identifier too large to be mangleddir(): expected keys() of locals to be a list, not '%.200s'object does not provide __dir__.__dict__ is not a dictionaryfield 'value' is required for Subscriptfield 'slice' is required for Subscriptfield 'ctx' is required for Subscriptfield 'ctx' is required for Tuplefield 'target' is required for AugAssignfield 'op' is required for AugAssignfield 'value' is required for AugAssignfield 'value' is required for Starredfield 'ctx' is required for Starredmap() must have at least two arguments.AST optimizer recursion depth mismatch (before=%d, after=%d)module kind %d should not be possiblefrom __future__ imports must occur at the beginning of the filefuture feature %.100s is not definedcan't multiply sequence by non-int of type '%.200s'maximum recursion depth exceeded during compilationmust assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zdencoder %s returned bytearray instead of bytes; use codecs.encode() to encode to arbitrary types'%.400s' encoder returned '%.400s' instead of 'bytes'; use codecs.encode() to encode to arbitrary types'%.200s' object is not a containerdecoding to str: need a bytes-like object, %.80s foundthis compiler does not handle FunctionTypessymtable analysis recursion depth mismatch (before=%d, after=%d)'%.400s' decoder returned '%.400s' instead of 'str'; use codecs.decode() to decode to arbitrary typesFormat specifier must be a string, not %.200sType %.100s doesn't define __format____format__ must return a str, not %.200sExceeds the limit (%d) for integer string conversion; use sys.set_int_max_str_digits() to increase the limitannotated name '%U' can't be globalannotated name '%U' can't be nonlocalname '%U' is parameter and globalname '%U' is used prior to global declarationname '%U' is assigned to before global declarationname '%U' is parameter and nonlocalname '%U' is used prior to nonlocal declarationname '%U' is assigned to before nonlocal declarationnot enough arguments for format string%%%c format: an integer is required, not %.200s%%%c format: a real number is required, not %.200sunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formattingassignment expression cannot be used in a comprehension iterable expressionassignment expression cannot rebind comprehension iteration variable '%U'assignment expression within a comprehension cannot be used in a class bodyimport * only allowed at module levelduplicate argument '%U' in function definitioncomprehension inner loop cannot rebind assignment expression target '%U'can't convert negative value to unsigned intPython int too large to convert to C unsigned longname '%U' is nonlocal and globalnonlocal declaration not allowed at module levelno binding for nonlocal '%U' foundcould not find io module state (interpreter shutdown?)underlying buffer has been detachedreadline() should have returned a str object, not '%.200s'illegal decoder state: the first item should be a bytes object, not '%.200s'underlying %s() should have returned a bytes-like object, not '%.200s'raw readinto() returned invalid length %zd (should have been between 0 and %zd)PyMemoryView_FromBuffer(): info->buf must not be NULLunary op %d should not be possible'yield from' inside async function'await' outside async function'%.200s' object is not callable; perhaps you missed a comma?Unrecognized conversion character %d'%.200s' object is not subscriptable; perhaps you missed a comma?%.200s indices must be integers or slices, not %.200s; perhaps you missed a comma?starred assignment target must be in a list or tuplecan't use starred expression hereIncrementalNewlineDecoder.__init__() not calleddecoder should return a string result, not '%.200s''return' with value in async generatorinvalid node type (%d) for augmented assignmentinplace binary op %d should not be possibleinvalid node type (%d) for annotated assignmentassertion is always true, perhaps remove parentheses?'continue' not properly in loop'async for' outside async functionPyCapsule_New called with null pointercompiler stack_effect(opcode=%d, arg=%i) failedon removing the last compiler stack itemPyCapsule_GetPointer called with invalid PyCapsule objectPyCapsule_GetPointer called with incorrect name'%.200s' object doesn't support item deletion_PyST_GetScope(name=%R) failed: unknown scope in unit %S (%R); symbols: %R; locals: %R; globals: %Rcompiler_lookup_arg(name=%R) with reftype=%d failed in %S; freevars of code %S: %Rtoo many statically nested blocks"is" with a literal. Did you mean "=="?"is not" with a literal. Did you mean "!="?default 'except:' must be lastExisting exports of data: object cannot be re-sizedPyBuffer_ToContiguous: len != view->lencan't extend bytearray with %.100scan't set bytearray slice from %.100sf-string: single '}' is not allowedf-string: unexpected end of stringobject too deeply nested to marshalunknown Unicode character name\N escapes not supported (can't load unicodedata module)f-string: expressions nested too deeplyf-string expression part cannot include a backslashf-string: too many nested parenthesisf-string expression part cannot include '#'f-string: closing parenthesis '%c' does not match opening parenthesis '%c'f-string: self documenting expressions are only supported in Python 3.8 and greaterf-string: invalid conversion character: expected 's', 'r', or 'a'f-string: empty expression not allowedfield 'context_expr' is required for withitemfield 'target' is required for comprehensionfield 'iter' is required for comprehensionPrecision not allowed in integer format specifierSign not allowed with integer format specifier 'c'Alternate form (#) not allowed with integer format specifier 'c'bytearray_getbuffer: view==NULL argument is obsolete%s: src and dst must be the same typeinvalid \x escape at position %zddecoding error; unknown error handling code: %.400sfield 'key' is required for DictCompfield 'value' is required for DictCompbad operand type for unary -: '%.200s''%s' can not be used within an annotationcan only concatenate str (not "%.200s") to strtoo many expressions in star-unpacking assignmentmultiple starred expressions in assignmentasynchronous comprehension outside of an asynchronous functionFailed checking if argv[0] is an import path entry Type "help", "copyright", "credits" or "license" for more information.Unable to decode the command from the command line: %S: can't open file %R: [Errno %d] %s %S: %R is a directory, cannot continue Could not import runpy module Could not access runpy._run_module_as_main Could not convert module name to unicode Could not create arguments for runpy._run_module_as_main /builddir/build/BUILD/Python-3.10.16/Python/ceval.c__annotations__ must be set to a dict objectFile or stream is not seekable.gc: %zd uncollectable objects at shutdowngc: %zd uncollectable objects at shutdown; use gc.set_debug(gc.DEBUG_UNCOLLECTABLE) to list themcan only concatenate list (not "%.200s") to listglobals must be a real dict; try eval(expr, {}, mapping)eval must be given globals and locals when called without a framecode object passed to eval() may not contain free variablesException ignored in m_clear of module%s%V python: Can't reopen .pyc file python: failed to set __main__.__loader__ could not convert string to float: '%.200s'value too large to convert to float: '%.200s'field 'args' is required for Lambdafield 'body' is required for Lambdabytes must be in range(0, 256)cannot convert '%.200s' object to bytesfield 'body' is required for Expressioncpython._PySys_ClearAuditHooksbytes object is too large to make reprcpython.PyInterpreterState_Clearsep must be None or a string, not %.200send must be None or a string, not %.200sPyThreadState_Clear: warning: thread still has a frame PyThreadState_Clear: warning: thread still has a generator encoder should return a bytes object, not '%.200s'iterable unpacking cannot be used in comprehensiondid you forget parentheses around the comprehension target?null file for PyFile_WriteStringdynamic module does not define module export function (%s_%s)initialization of %s failed without raising an exceptioninitialization of %s raised unreported exceptioninit function of %s returned uninitialized objectinitialization of %s did not return PyModuleDefinitialization of %s did not return an extension modulefield 'test' is required for IfExpfield 'body' is required for IfExpfield 'orelse' is required for IfExpend_offset must be provided when end_lineno is providedraw write() returned invalid length %zd (should have been between 0 and %zd)TypeError: print_exception(): Exception expected for value, can't unpack IEEE 754 special value on non-IEEE platformtype 'partial' takes at least one argumentthe first argument must be callable'%.200s' object can't be concatenatedencoded result is too long for a Python stringbad operand type for abs(): '%.200s'wrapper %s() takes no keyword argumentsint too large to convert to float_PyType_GetModuleByDef: No superclass of '%s' has the given moduletype %.100s doesn't define __round__ methodrounded value too large to representmust be real number, not %.50s%.50s.__float__ returned non-float (type %.50s)%.50s.__float__ returned non-float (type %.50s). The ability to return an instance of a strict subclass of float is deprecated, and may be removed in a future version of Python.Exception ignored on building sys.unraisablehook argumentsException ignored in audit hookException ignored in sys.unraisablehooksys.unraisablehook argument type must be UnraisableHookArgsint has too many bits to express in a platform size_texpected %d argument%s, got %zdinterpreter has no modules dictionarycan't apply this %s to %s objectCannot write %zi characters at %zi in a string of %zi charactersCannot copy %s characters into a string of %s charactersCannot modify a string currently usedfield 'name' is required for AsyncFunctionDeffield 'args' is required for AsyncFunctionDef%s only supported in Python 3.%i and greaterTraceback (most recent call last): 'async with' outside async functionord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd founddescriptor '%V' of '%.100s' object needs an argumentdescriptor '%V' requires a '%.100s' object but received a '%.100s'can't convert negative value to size_tPython int too large to convert to C size_tinvalid literal for int() with base %d: %.200Rint() arg 2 must be >= 2 and <= 36int string too large to convertExceeds the limit (%d) for integer string conversion: value has %zd digits; use sys.set_int_max_str_digits() to increase the limitrange indices must be integers or slices, not %.200stuple assignment index out of rangeCouldn't create thread-state for new threadregular expression code size limit exceededexpected string or bytes-like objectcannot use a string pattern on a bytes-like objectcannot use a bytes pattern on a string-like object/builddir/build/BUILD/Python-3.10.16/Objects/fileobject.cobject.readline() returned non-stringbytearray object is too large to make reprmaxsize should be integer or Noneauto-releasing thread-state, but no thread-state for this threadthread state %p must be current when releasingobject of type '%.200s' has no len()maketrans arguments must have same length/builddir/build/BUILD/Python-3.10.16/Objects/iterobject.cbad operand type for unary ~: '%.200s'bytearray indices must be integers or slices, not %.200scan assign only bytes, buffers, or iterables of ints in range(0, 256)attempt to assign bytes of size %zd to extended slice of size %zdargument should be integer or bytes-like object, not '%.200s'translation table must be 256 characters longNegative size passed to PyByteArray_FromStringAndSizerepeat argument cannot be negativefloat() argument must be a string or a real number, not '%.200s'could not convert string to %s: %Rcould not convert string to float: %Rfloat too large to pack with d formatUn;translating error handler must return (str, int) tupleposition %zd from error handler out of boundscharacter mapping must be in range(0x%x)character mapping must return integer, None or strcannot unpack non-iterable %.200s objectnot enough values to unpack (expected %d, got %d)not enough values to unpack (expected at least %d, got %d)too many values to unpack (expected %d)not enough values to unpack (expected at least %d, got %zd)argument should be integer or None, not '%.200s'sequence item %zd: expected a bytes-like object, %.80s foundsequence changed size during iterationCannot specify both ',' and '_'.Format specifier missing precisionCannot specify '%c' with '%c'.Cannot specify '%c' with '\x%x'.%s first arg must be bytes or a tuple of bytes, not %sunsupported operand type(s) for %.100s: '%.100s' and '%.100s'unsupported operand type(s) for %.100s: '%.100s', '%.100s', '%.100s'pow() 3rd argument cannot be 0base is not invertible for the given modulusdescriptor for index '%zd' for tuple subclasses doesn't apply to '%s' objectattribute name must be a string.__class__.__qualname__ is not a unicode objectconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given)zip() argument %d is shorter than argument%s%dzip() argument %d is longer than argument%s%dvars() argument must have __dict__ attributememoryview: casts are restricted to C-contiguous viewsshape must be a list or a tuplememoryview: cast must be 1D -> ND or ND -> 1Dmemoryview: destination format must be a native single character format prefixed with an optional '@'memoryview: cannot cast between two non-byte formatsmemoryview: length is not a multiple of itemsizememoryview.cast(): elements of shape must be integersmemoryview.cast(): elements of shape must be integers > 0memoryview.cast(): product(shape) > SSIZE_MAXmemoryview: product(shape) * itemsize != buffer sizememoryview: cannot cast view with zeros in shape or stridesmemoryview: unsupported format %smemoryview: format %s not supportedfield 'target' is required for NamedExprfield 'value' is required for NamedExprother argument must be K instanceclock_gettime(CLOCK_MONOTONIC)timestamp too large to convert to C _PyTime_t'%.200s' object is not an iteratorcannot clear an executing frame/builddir/build/BUILD/Python-3.10.16/Python/pystrtod.cInternal lock count overflowedcannot release un-acquired lockAt least one argument is required.__getformat__() argument 1 must be 'double' or 'float'insane float_format or double_formatUn;decoding error handler must return (str, int) tuplecodec must pass exception instancecannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is requiredregister() takes at least 1 argument (0 given)category must be a Warning subclass, not '%s'configuration names must be strings or integersunrecognized configuration name'registry' must be a dict or None_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tupleaction must be a string, not '%.200s'_warnings.defaultaction must be a string, not '%.200s'_warnings.onceregistry must be a dict, not '%.200s'Unrecognized action (%R) in warnings.filters: %Rwarnings._showwarnmsg() must be set to a callableunable to get warnings.WarningMessagepow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative powerfirst maketrans argument must be a string if there is a second argumentthe first two maketrans arguments must have equal lengthif you give only one argument to maketrans it must be a dictstring keys in translate table must be of length 1keys in translate table must be strings or integersillegal environment variable namesignal %i cannot be registered, use enable() insteadLoad averages are unobtainableprocess stopped by delivery of signal %istring too large in _PyUnicode_FormatLongPyNumber_ToBase: base must be 2, 8, 10 or 16audit() missing 1 required positional argument: 'event'expected str for argument 'event'expected str for argument 'event', not %.200stimeout must be greater than 0Timeout (%lu:%02lu:%02lu.%06u)! unable to start watchdog threadInvalid value NaN (not a number)deque mutated during iterationoptional 3rd arg must be a dictionarythread is not supported for isolated subinterpreterscould not acquire lock for %s at interpreter shutdown, possibly due to daemon threadsfork not supported for isolated subinterpretersfailed releasing import lock after forkmust be %d-item sequence, not %.50smust be sequence of length %d, not %zdPyCapsule_Import could not import module "%s"PyCapsule_Import "%s" is not validfloat too large to pack with f formatencoder must return a tuple (object, integer)code point in surrogate code point range(0xd800, 0xe000)code point not in range(0x110000)bad argument type for built-in operationInitialization arguments are not supportedCouldn't get thread-state dictionarytuple.index(x): x not in tupleunsupported format string passed to %.200s.__format__can only assign string to %s.__name__, not '%s'co_argcount must be a positive integerco_posonlyargcount must be a positive integerco_kwonlyargcount must be a positive integerco_nlocals must be a positive integerco_stacksize must be a positive integerco_flags must be a positive integerco_firstlineno must be a positive integer__code__ must be set to a code object%U() requires a code object with %zd free vars, not %zd__hash__ method should return an integerslice indices must be integers or have an __index__ methodonly classes may be registeredcould not register None for cross-interpreter sharingcould not register int for cross-interpreter sharingcould not register bytes for cross-interpreter sharingcould not register str for cross-interpreter sharing__getnewargs_ex__ should return a tuple, not '%.200s'__getnewargs_ex__ should return a tuple of length 2, not %zdfirst item of the tuple returned by __getnewargs_ex__ must be a tuple, not '%.200s'second item of the tuple returned by __getnewargs_ex__ must be a dict, not '%.200s'__getnewargs__ should return a tuple, not '%.200s'%.200s.__slotnames__ should be a list or None, not %.200scopyreg._slotnames didn't return a list or None__slotsname__ changed size during iterationcontext variable name must be a strType %.100s doesn't define __sizeof____sizeof__() should return >= 0readline() should have returned a bytes object, not '%.200s'weakly-referenced object no longer exists%s: cannot use dir_fd and follow_symlinks together%s%s%s unavailable on this platformOut of memory and PyExc_MemoryError is not initialized yethuge integer: number of bits overflows a Py_ssize_tComparison between bytearray and stringnewline must be str or None, not %.200sinitial_value must be str or None, not %.200sstring is longer than the bufferdeallocated BytesIO object has exported buffersstring argument expected, got '%s'fileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)Python int too large for C unsigned shortcannot add more objects to bytearrayintermediate overflow during divisioninteger division result too large for a floatthrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes or instances deriving from BaseException, not %srange object index out of range%U() missing %i required %s argument%s: %Unon-hexadecimal number found in fromhex() arg at position %zd%.200s() %.200s must be %.50s, not %.50s.__name__ is not a unicode object.__objclass__.__qualname__ is not a unicode object%%b requires a bytes-like object, or an object that implements __bytes__, not '%.100s'%%%c format: %s is required, not %.200s%c requires an integer in range(256) or a single bytenot all arguments converted during bytes formattingPyBytes_FromFormatV(): %c format expects an integer in range [0; 255]%.200s() takes no positional argumentsCannot install a trace function while another trace function is being installedcannot modify read-only memorymemoryview slice assignments are currently restricted to ndim = 1memoryview assignment: lvalue and rvalue have different structuresdecoder must return a tuple (object,integer)bad operand type for unary +: '%.200s'complex() can't take second arg if first is a stringcomplex() second arg can't be a stringcomplex() first argument must be a string or a number, not '%.200s'complex() second argument must be a number, not '%.200s'__complex__ returned non-complex (type %.200s)__complex__ returned non-complex (type %.200s). The ability to return an instance of a strict subclass of complex is deprecated, and may be removed in a future version of Python.an instance of ContextVar was expectedexpected at most 1 arguments, got %zdupdate() takes at most 1 positional argument (%zd given)need more than 0 values to unpackneed more than 1 value to unpacktoo many values to unpack (expected 2)%.200s attribute must be bytesOn;encoding error handler must return (str/bytes, int) tuple%.200s attribute must be unicodecharacter mapping must be in range(256)character mapping must return integer, bytes or None, not %.400sABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/partial character in shift sequencenon-zero padding bits in shift sequenceinvalid whence (%i, should be 0, 1 or 2)OrderedDict mutated during iterationOrderedDict changed size during iterationzip_longest() got an unexpected keyword argumentInvalid whence (%i, should be 0, 1 or 2)Can't do nonzero cur-relative seeksmemoryview: internal error in richcompareregular expression scanner already executing__defaults__ must be set to a tuple object__get__(None, None) is invalidsum() can't sum strings [use ''.join(seq) instead]sum() can't sum bytes [use b''.join(seq) instead]sum() can't sum bytearray [use b''.join(seq) instead]__await__() returned a coroutine__await__() returned non-iterator of type '%.100s'object %.100s can't be used in 'await' expressionpopitem(): dictionary is empty__bool__ should return bool, returned %s0.0 to a negative or complex powerfield 'target' is required for AnnAssignfield 'annotation' is required for AnnAssignfield 'target' is required for AsyncForfield 'iter' is required for AsyncForcomplex() arg is a malformed stringZero padding is not allowed in complex format specifier'=' alignment flag is not allowed in complex format specifierUnknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'can only assign string to %s.__qualname__, not '%s'iiiiiiiii;strftime(): illegal time tuple argumentTuple or struct_time argument requiredcannot re-enter the tee iteratortimestamp out of range for platform time_tcannot convert Infinity to integer ratiocannot convert NaN to integer ratioiiiiiiiii;mktime(): illegal time tuple argumentfill character is bigger than the string maximum charactersleep length must be non-negativenon-integer arguments in division'%S' is an invalid keyword argument for %.200s%sPyUnicode_FromUnicode(NULL, size) is deprecated; use PyUnicode_New() insteadmaxdigits must be 0 or larger than %dhexadecimal string too long to converthexadecimal value too large to represent as a floatinvalid hexadecimal floating-point string__setformat__() argument 1 must be 'double' or 'float'__setformat__() argument 2 must be 'unknown', 'IEEE, little-endian' or 'IEEE, big-endian'can only set %s format to 'unknown' or the detected platform valuefirst argument must be callablerequired field "lineno" missing from stmtrequired field "col_offset" missing from stmtrequired field "name" missing from FunctionDef while traversing 'FunctionDef' noderequired field "args" missing from FunctionDefrequired field "body" missing from FunctionDefFunctionDef field "body" must be a list, not a %.200sFunctionDef field "body" changed size during iterationrequired field "decorator_list" missing from FunctionDefFunctionDef field "decorator_list" must be a list, not a %.200sFunctionDef field "decorator_list" changed size during iterationrequired field "name" missing from AsyncFunctionDef while traversing 'AsyncFunctionDef' noderequired field "args" missing from AsyncFunctionDefrequired field "body" missing from AsyncFunctionDefAsyncFunctionDef field "body" must be a list, not a %.200sAsyncFunctionDef field "body" changed size during iterationrequired field "decorator_list" missing from AsyncFunctionDefAsyncFunctionDef field "decorator_list" must be a list, not a %.200sAsyncFunctionDef field "decorator_list" changed size during iterationrequired field "name" missing from ClassDef while traversing 'ClassDef' noderequired field "bases" missing from ClassDefClassDef field "bases" must be a list, not a %.200sClassDef field "bases" changed size during iterationrequired field "keywords" missing from ClassDefClassDef field "keywords" must be a list, not a %.200sClassDef field "keywords" changed size during iterationrequired field "body" missing from ClassDefClassDef field "body" must be a list, not a %.200sClassDef field "body" changed size during iterationrequired field "decorator_list" missing from ClassDefClassDef field "decorator_list" must be a list, not a %.200sClassDef field "decorator_list" changed size during iteration while traversing 'Return' noderequired field "targets" missing from DeleteDelete field "targets" must be a list, not a %.200s while traversing 'Delete' nodeDelete field "targets" changed size during iterationrequired field "targets" missing from AssignAssign field "targets" must be a list, not a %.200s while traversing 'Assign' nodeAssign field "targets" changed size during iterationrequired field "value" missing from Assignfield 'value' is required for Assignrequired field "target" missing from AugAssign while traversing 'AugAssign' noderequired field "op" missing from AugAssignrequired field "value" missing from AugAssignrequired field "target" missing from AnnAssign while traversing 'AnnAssign' noderequired field "annotation" missing from AnnAssignrequired field "simple" missing from AnnAssignrequired field "target" missing from Forrequired field "iter" missing from Forrequired field "body" missing from ForFor field "body" must be a list, not a %.200sFor field "body" changed size during iterationrequired field "orelse" missing from ForFor field "orelse" must be a list, not a %.200sFor field "orelse" changed size during iterationrequired field "target" missing from AsyncFor while traversing 'AsyncFor' noderequired field "iter" missing from AsyncForrequired field "body" missing from AsyncForAsyncFor field "body" must be a list, not a %.200sAsyncFor field "body" changed size during iterationrequired field "orelse" missing from AsyncForAsyncFor field "orelse" must be a list, not a %.200sAsyncFor field "orelse" changed size during iterationrequired field "test" missing from While while traversing 'While' noderequired field "body" missing from WhileWhile field "body" must be a list, not a %.200sWhile field "body" changed size during iterationrequired field "orelse" missing from WhileWhile field "orelse" must be a list, not a %.200sWhile field "orelse" changed size during iterationfield 'test' is required for Whilerequired field "test" missing from Ifrequired field "body" missing from IfIf field "body" must be a list, not a %.200sIf field "body" changed size during iterationrequired field "orelse" missing from IfIf field "orelse" must be a list, not a %.200sIf field "orelse" changed size during iterationrequired field "items" missing from WithWith field "items" must be a list, not a %.200sWith field "items" changed size during iterationrequired field "body" missing from WithWith field "body" must be a list, not a %.200sWith field "body" changed size during iterationrequired field "items" missing from AsyncWithAsyncWith field "items" must be a list, not a %.200s while traversing 'AsyncWith' nodeAsyncWith field "items" changed size during iterationrequired field "body" missing from AsyncWithAsyncWith field "body" must be a list, not a %.200sAsyncWith field "body" changed size during iterationrequired field "subject" missing from Match while traversing 'Match' noderequired field "cases" missing from MatchMatch field "cases" must be a list, not a %.200srequired field "pattern" missing from match_case while traversing 'match_case' noderequired field "body" missing from match_casematch_case field "body" must be a list, not a %.200smatch_case field "body" changed size during iterationfield 'pattern' is required for match_caseMatch field "cases" changed size during iterationfield 'subject' is required for Match while traversing 'Raise' noderequired field "body" missing from TryTry field "body" must be a list, not a %.200sTry field "body" changed size during iterationrequired field "handlers" missing from TryTry field "handlers" must be a list, not a %.200srequired field "lineno" missing from excepthandler while traversing 'excepthandler' noderequired field "col_offset" missing from excepthandler while traversing 'ExceptHandler' noderequired field "body" missing from ExceptHandlerExceptHandler field "body" must be a list, not a %.200sExceptHandler field "body" changed size during iterationexpected some sort of excepthandler, but got %RTry field "handlers" changed size during iterationrequired field "orelse" missing from TryTry field "orelse" must be a list, not a %.200sTry field "orelse" changed size during iterationrequired field "finalbody" missing from TryTry field "finalbody" must be a list, not a %.200sTry field "finalbody" changed size during iterationrequired field "test" missing from Assert while traversing 'Assert' nodefield 'test' is required for Assertrequired field "names" missing from ImportImport field "names" must be a list, not a %.200s while traversing 'Import' nodeImport field "names" changed size during iteration while traversing 'ImportFrom' noderequired field "names" missing from ImportFromImportFrom field "names" must be a list, not a %.200sImportFrom field "names" changed size during iterationrequired field "names" missing from GlobalGlobal field "names" must be a list, not a %.200s while traversing 'Global' nodeGlobal field "names" changed size during iterationrequired field "names" missing from NonlocalNonlocal field "names" must be a list, not a %.200s while traversing 'Nonlocal' nodeNonlocal field "names" changed size during iterationrequired field "value" missing from Exprexpected some sort of stmt, but got %Rrequired field "lineno" missing from exprrequired field "col_offset" missing from exprrequired field "op" missing from BoolOp while traversing 'BoolOp' nodeexpected some sort of boolop, but got %Rrequired field "values" missing from BoolOpBoolOp field "values" must be a list, not a %.200sBoolOp field "values" changed size during iterationrequired field "target" missing from NamedExpr while traversing 'NamedExpr' noderequired field "value" missing from NamedExprrequired field "left" missing from BinOp while traversing 'BinOp' noderequired field "op" missing from BinOprequired field "right" missing from BinOprequired field "op" missing from UnaryOp while traversing 'UnaryOp' nodeexpected some sort of unaryop, but got %Rrequired field "operand" missing from UnaryOprequired field "args" missing from Lambda while traversing 'Lambda' noderequired field "body" missing from Lambdarequired field "test" missing from IfExp while traversing 'IfExp' noderequired field "body" missing from IfExprequired field "orelse" missing from IfExprequired field "keys" missing from DictDict field "keys" must be a list, not a %.200sDict field "keys" changed size during iterationrequired field "values" missing from DictDict field "values" must be a list, not a %.200sDict field "values" changed size during iterationrequired field "elts" missing from SetSet field "elts" must be a list, not a %.200sSet field "elts" changed size during iterationrequired field "elt" missing from ListComp while traversing 'ListComp' noderequired field "generators" missing from ListCompListComp field "generators" must be a list, not a %.200sListComp field "generators" changed size during iterationfield 'elt' is required for ListComprequired field "elt" missing from SetComp while traversing 'SetComp' noderequired field "generators" missing from SetCompSetComp field "generators" must be a list, not a %.200sSetComp field "generators" changed size during iterationfield 'elt' is required for SetComprequired field "key" missing from DictComp while traversing 'DictComp' noderequired field "value" missing from DictComprequired field "generators" missing from DictCompDictComp field "generators" must be a list, not a %.200sDictComp field "generators" changed size during iterationrequired field "elt" missing from GeneratorExp while traversing 'GeneratorExp' noderequired field "generators" missing from GeneratorExpGeneratorExp field "generators" must be a list, not a %.200sGeneratorExp field "generators" changed size during iterationfield 'elt' is required for GeneratorExprequired field "value" missing from Await while traversing 'Await' nodefield 'value' is required for Await while traversing 'Yield' noderequired field "value" missing from YieldFrom while traversing 'YieldFrom' nodefield 'value' is required for YieldFromrequired field "left" missing from Compare while traversing 'Compare' noderequired field "ops" missing from CompareCompare field "ops" must be a list, not a %.200sexpected some sort of cmpop, but got %RCompare field "ops" changed size during iterationrequired field "comparators" missing from CompareCompare field "comparators" must be a list, not a %.200sCompare field "comparators" changed size during iterationfield 'left' is required for Comparerequired field "func" missing from Callrequired field "args" missing from CallCall field "args" must be a list, not a %.200sCall field "args" changed size during iterationrequired field "keywords" missing from CallCall field "keywords" must be a list, not a %.200sCall field "keywords" changed size during iterationrequired field "value" missing from FormattedValue while traversing 'FormattedValue' noderequired field "conversion" missing from FormattedValuefield 'value' is required for FormattedValuerequired field "values" missing from JoinedStrJoinedStr field "values" must be a list, not a %.200s while traversing 'JoinedStr' nodeJoinedStr field "values" changed size during iterationrequired field "value" missing from Constant while traversing 'Constant' noderequired field "value" missing from Attribute while traversing 'Attribute' noderequired field "attr" missing from Attributerequired field "ctx" missing from Attributerequired field "value" missing from Subscript while traversing 'Subscript' noderequired field "slice" missing from Subscriptrequired field "ctx" missing from Subscriptrequired field "value" missing from Starred while traversing 'Starred' noderequired field "ctx" missing from Starredrequired field "id" missing from Namerequired field "ctx" missing from Namerequired field "elts" missing from ListList field "elts" must be a list, not a %.200sList field "elts" changed size during iterationrequired field "ctx" missing from Listrequired field "elts" missing from TupleTuple field "elts" must be a list, not a %.200s while traversing 'Tuple' nodeTuple field "elts" changed size during iterationrequired field "ctx" missing from Tuple while traversing 'Slice' nodeexpected some sort of expr, but got %RAST identifier must be of type strexpected some sort of expr_context, but got %Rexpected some sort of operator, but got %RAnnAssign with simple non-Name targetRaise with cause but no exceptionTry has neither except handlers nor finalbodyTry has orelse but no except handlersNone disallowed in statement listNone disallowed in expression listexpression which can't be assigned to in %s contextexpression must have %s context but has %s insteadBoolOp with less than 2 valuesDict doesn't have the same number of keys as valuesCompare has a different number of comparators and operandsidentifier field can't represent '%s' constantgot an invalid type in Constant: %s'%U' codec can't decode byte 0x%02x in position %zd: %U'%U' codec can't decode bytes in position %zd-%zd: %Uswitch interval must be strictly positive__dict__ must be set to a dictionary, not a '%.200s'Cannot recover from stack overflow.maximum recursion depth exceeded%sreduce() arg 2 must support iterationreduce() of empty iterable with no initial valuefirst argument must be callable or None'%.200s' object is unsliceableunexpected expression in assignment %d (line %d)clock_gettime(CLOCK_PROCESS_CPUTIME_ID)the processor time used is not available or its value cannot be representedStop argument for islice() must be None or an integer: 0 <= x <= sys.maxsize.Indices for islice() must be None or an integer: 0 <= x <= sys.maxsize.Step for islice() must be a positive integer or None./builddir/build/BUILD/Python-3.10.16/Objects/methodobject.crecursion limit must be greater or equal than 1cannot set the recursion limit to %i at the recursion depth %i: the limit is too lowinteger argument expected, got '%s'multi-dimensional sub-views are not implementedindex out of bounds on dimension %dcannot hash writable memoryview objectmemoryview: hashing is restricted to formats 'B', 'b' or 'c'/builddir/build/BUILD/Python-3.10.16/Objects/memoryobject.cmemoryview: invalid type for format '%s'memoryview: invalid value for format '%s'cannot index %zd-dimension view with %zd-element tuplemethodcaller needs at least one argument, the method namekeywords dict changed size during iterationargument of type '%.200s' is not iterablesequence.index(x): x not in sequencepositional patterns follow keyword patternsreal number required in complex literalfield 'value' is required for MatchValuefield 'value' is required for MatchSingletonimaginary number required in complex literalfield 'cls' is required for MatchClasspatterns may only match literals and attribute lookupsmultiple starred names in sequence patterntoo many expressions in star-unpacking sequence patternmultiple starred expressions in sequence patternkeys (%d) / patterns (%d) length mismatch in mapping patterntoo many sub-patterns in mapping patterncan't use NULL keys in MatchMapping (set 'rest' parameter instead)mapping pattern keys may only match literals and attribute lookupskwd_attrs (%d) / kwd_patterns (%d) length mismatch in class patterntoo many sub-patterns in class pattern %Rattribute name repeated in class pattern: %Uname capture %R makes remaining patterns unreachablewildcard makes remaining patterns unreachablemultiple assignments to name %R in patternalternative patterns bind different namesinvalid match pattern node in AST (kind=%d)%s() got multiple sub-patterns for attribute %Rexpected PickleBuffer, %.200s foundoperation forbidden on released PickleBuffer objectcannot extract raw buffer from non-contiguous bufferIn structseq_repr(), member %zd name is NULL for type %.500scan only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of classes, not '%s'a __bases__ item causes an inheritance cycle%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'bytesiobuf_getbuffer: view==NULL argument is obsolete%U argument after ** must be a mapping, not %.200s%U got multiple values for keyword argument '%S'no positional arguments expectedcan't delete tb_next attributeexpected traceback object, got '%s'<%s object; span=(%zd, %zd), match=%.50R>'%U' codec can't encode character '\x%02x' in position %zd: %U'%U' codec can't encode character '\u%04x' in position %zd: %U'%U' codec can't encode character '\U%08x' in position %zd: %U'%U' codec can't encode characters in position %zd-%zd: %Ufloat too large to pack with e formatstrerror() argument out of rangeiiiiiiiii;asctime(): illegal time tuple argumentclock_gettime(CLOCK_THREAD_CPUTIME_ID)The fill character must be a unicode character, not %.100sThe fill character must be exactly one character longfree variable '%.200s' referenced before assignment in enclosing scopeSmall block threshold = %d, in %u size classes. class size num pools blocks in use avail blocks ----- ---- --------- ------------- ------------ # bytes lost to arena alignment# bytes lost to arena map rootStack (most recent call first): unable to get the interpreter stateunable to get the thread head statesys.set_asyncgen_hook_finalizersys.set_asyncgen_hook_firstiterfailed to reinitialize lock at forkfailed to create init interpreter ID mutexTokens can only be created by ContextVarsThis object has no __weakref__EllipsisType takes no argumentsNotImplementedType takes no argumentsissubclass() argument 2 cannot be a parameterized genericisinstance() argument 2 cannot be a parameterized genericexception cause must be None or derive from BaseException__context__ may not be deletedexception context must be None or derive from BaseExceptionPyCapsule_GetName called with invalid PyCapsule objectPyCapsule_GetDestructor called with invalid PyCapsule objectPyCapsule_GetContext called with invalid PyCapsule objectPyCapsule_SetName called with invalid PyCapsule objectPyCapsule_SetDestructor called with invalid PyCapsule objectPyCapsule_SetContext called with invalid PyCapsule objectPyCapsule_SetPointer called with null pointerPyCapsule_SetPointer called with invalid PyCapsule objectEnable tracemalloc to get the memory block allocation traceback Memory block allocated at (most recent call first): Debug memory block at address p=%p: %zu bytes originally requested The %d pad bytes at p-%d are Because memory is corrupted at the start, the count of bytes requested may be bogus, and checking the trailing pad bytes may segfault. The %d pad bytes at tail=%p are not all FORBIDDENBYTE (0x%02x): issubclass() argument 2 cannot contain a parameterized generic<%s %s object owner=%ld count=%lu at %p> [Previous line repeated %ld more times] [Previous line repeated %ld more time] , <%s object>>unable to raise a stack overflow (allocated %zu bytes on the stack, %zu recursive calls)unrecognized interpreter ID %llda ContextVar key was expected, got %Ran instance of Context was expectedcannot exit context: %R has not been enteredcannot exit context: thread state references a different context objecttracemalloc_realloc() failed to allocate a trace%s:%d: bad argument to internal functionWeakref proxy referenced a non-iterator '%.200s' objectContext() does not accept any argumentsPython int too large for C unsigned int/builddir/build/BUILD/Python-3.10.16/Objects/funcobject.cnon-dict keyword only default argscannot enter context: %R is already enteredbad argument to internal functionPyState_RemoveModule called on module with slotsInterpreters module-list not accessible.run() missing 1 required positional argumentCannot install a profile function while another profile function is being installednull argument to internal routine%S does not support cross-interpreter dataexpected a writable bytes-like objectan instance of Token was expected%R was created by a different ContextVar%R was created in a different Contextexpected an instance of Token, got %Rcannot reuse already awaited __anext__()/asend()anext(): asynchronous generator is already runningwrite could not complete without blockingdeque already at its maximum sizemaximum recursion limit exceededinternal error in regular expression enginefield 'returns' is required for FunctionTypefield 'tag' is required for TypeIgnoreargument must be str or None, not %.50sargument must be str, not %.50sobject %.50s does not have __anext__ methodobject %.50s does not have __aiter__ methodobject %.50s does not have __await__ methodAST string must be of type strkeyword list must be a dictionarycannot set '__annotations__' attribute of immutable type '%s'expected tuple for closure, got '%.100s'__await__ returned a non-iterable'|=' is not supported by %s; use '|' insteadboth destination and source must be bytes-like objectsdestination is too small to receive data from sourceunderlying buffer is not writablewritable contiguous buffer requested for a non-contiguous object.a strictly positive integer is requiredmust have a sched_param objectuid should be integer, not %.200sgid should be integer, not %.200scan't jump into the body of a try statementcan't jump into an 'except' block as there's no exceptioncan't jump into the body of a for loopcan't jump into the body of a with statementcannot find bytecode for specified linecan't jump from the 'call' trace event of a new framecan only jump from a 'line' trace eventf_lineno can only be set by a trace functionline %d comes before the current code blockline %d comes after the current code blockcan't jump out of an 'except' blockinterpreter ID must be an int, got %.100sinterpreter ID must be a non-negative int, got %Rfloat argument required, not %.200s'%.200s' object can't be repeated'%.200s' object is not an async iterableaiter() returned not an async iterator of type '%.100s''%.200s' object is not an async iterator%s() expects an error PyStatusdon't know how to handle %.200s in error callbackthis __dict__ descriptor does not support '%.200s' objectsexpected traceback object or None, got '%s'reentrant call inside %s.__repr__<_io.FileIO fd=%d mode='%s' closefd=%s><_io.FileIO name=%R mode='%s' closefd=%s>%.200s() must return a deque, not %.200s'%.200s' object doesn't support slice deletion'%.200s' object doesn't support slice assignment%.200s.__divmod__() must return a 2-tuple, not %.200sthe tracemalloc module has been unloadedthe number of frames must be in range [1; %lu]signal only works in main thread of the main interpretersignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable objectsetgroups argument must be a sequencesignal number %ld out of rangeinvalid signal number %ld, please use valid_signals()negative value for 'count' not allowedexpected an iterator of ints, but iterator yielded %Rcould not allocate a large enough CPU setreadv() arg 2 must be a sequencepreadv2() arg 2 must be a sequencewritev() arg 2 must be a sequencepwritev() arg 2 must be a sequenceinvalid decimal Unicode stringcan't prepend path0 to sys.pathunable to determine login namename tuples must contain only strings, not '%.500s'Can't convert '%.100s' object to str implicitlyFatal Python error from unexpected signum: comprehension with no generatorsunexpected constant inside of a literal patternmore positional defaults than args on argumentslength of kwonlyargs is not the same as kw_defaults on argumentscan't capture name '_' in patternsMatchSingleton can only contain True, False and NoneMatchMapping doesn't have the same number of keys as patternsMatchClass doesn't have the same number of keyword attributes as patternsMatchClass cls field can only contain Name or Attribute nodes.MatchAs must specify a target name if a pattern is givenMatchOr requires at least 2 patternscomparing strings with non-ASCII characters is not supportedunsupported operand types(s) or combination of types: '%.100s' and '%.100s'Buffer must be single dimensionunknown expression kind inside f-stringunknown f-value conversion kindCannot create a consistent method resolution order (MRO) for basesdomain must be a non-empty stringgetpwnam(): name not found: %Rsize must be 0 or a positive valuesetting stack size not supportedset_wakeup_fd only works in main thread of the main interpreterthe fd %i must be in non-blocking modecallable finalizer expected, got %.50scallable firstiter expected, got %.50smodule_globals must be a dict, not '%.200s'str() or repr() returned '%.100s'required field "name" missing from alias while traversing 'alias' noderequired field "lineno" missing from aliasrequired field "col_offset" missing from aliascan only concatenate deque (not "%.200s") to dequeisinstance() argument 2 cannot contain a parameterized generic while traversing 'keyword' noderequired field "value" missing from keywordrequired field "lineno" missing from keywordrequired field "col_offset" missing from keywordrequired field "arg" missing from argrequired field "lineno" missing from argrequired field "col_offset" missing from argrequired field "posonlyargs" missing from argumentsarguments field "posonlyargs" must be a list, not a %.200s while traversing 'arguments' nodearguments field "posonlyargs" changed size during iterationrequired field "args" missing from argumentsarguments field "args" must be a list, not a %.200sarguments field "args" changed size during iterationrequired field "kwonlyargs" missing from argumentsarguments field "kwonlyargs" must be a list, not a %.200sarguments field "kwonlyargs" changed size during iterationrequired field "kw_defaults" missing from argumentsarguments field "kw_defaults" must be a list, not a %.200sarguments field "kw_defaults" changed size during iterationrequired field "defaults" missing from argumentsarguments field "defaults" must be a list, not a %.200sarguments field "defaults" changed size during iterationrequired field "target" missing from comprehension while traversing 'comprehension' noderequired field "iter" missing from comprehensionrequired field "ifs" missing from comprehensioncomprehension field "ifs" must be a list, not a %.200scomprehension field "ifs" changed size during iterationrequired field "is_async" missing from comprehensionrequired field "context_expr" missing from withitem while traversing 'withitem' noderequired field "lineno" missing from pattern while traversing 'pattern' noderequired field "col_offset" missing from patternrequired field "end_lineno" missing from patternrequired field "end_col_offset" missing from patternrequired field "value" missing from MatchValue while traversing 'MatchValue' noderequired field "value" missing from MatchSingleton while traversing 'MatchSingleton' noderequired field "patterns" missing from MatchSequenceMatchSequence field "patterns" must be a list, not a %.200s while traversing 'MatchSequence' nodeMatchSequence field "patterns" changed size during iterationrequired field "keys" missing from MatchMappingMatchMapping field "keys" must be a list, not a %.200s while traversing 'MatchMapping' nodeMatchMapping field "keys" changed size during iterationrequired field "patterns" missing from MatchMappingMatchMapping field "patterns" must be a list, not a %.200sMatchMapping field "patterns" changed size during iterationrequired field "cls" missing from MatchClass while traversing 'MatchClass' noderequired field "patterns" missing from MatchClassMatchClass field "patterns" must be a list, not a %.200sMatchClass field "patterns" changed size during iterationrequired field "kwd_attrs" missing from MatchClassMatchClass field "kwd_attrs" must be a list, not a %.200sMatchClass field "kwd_attrs" changed size during iterationrequired field "kwd_patterns" missing from MatchClassMatchClass field "kwd_patterns" must be a list, not a %.200sMatchClass field "kwd_patterns" changed size during iteration while traversing 'MatchStar' node while traversing 'MatchAs' noderequired field "patterns" missing from MatchOrMatchOr field "patterns" must be a list, not a %.200s while traversing 'MatchOr' nodeMatchOr field "patterns" changed size during iterationexpected some sort of pattern, but got %RThere are no type variables left in %Renv.keys() or env.values() is not a listIt is not possible to set the encoding or newline of stream after the first readException ignored when trying to write to the signal wakeup fd: the BufferedRWPair object is being garbage-collectedis_symlink() takes no argumentsPy_HasFileSystemDefaultEncodingPy_FileSystemDefaultEncodeErrors_Py_HasFileSystemDefaultEncodeErrors_thread.excepthook argument type must be ExceptHookArgsPyType_HasFeature((((PyObject*)(op))->ob_type), (1UL << 28))kind == PyUnicode_1BYTE_KIND || kind == PyUnicode_2BYTE_KIND || kind == PyUnicode_4BYTE_KINDcompact->utf8_length == ascii->lengthcompact->wstr_length == ascii->length((Py_UCS4) ((kind) == PyUnicode_1BYTE_KIND ? ((const Py_UCS1 *)(data))[(ascii->length)] : ((kind) == PyUnicode_2BYTE_KIND ? ((const Py_UCS2 *)(data))[(ascii->length)] : ((const Py_UCS4 *)(data))[(ascii->length)] ) )) == 0!_PyObject_IsFreed((PyObject *)type)_Py_REFCNT(((const PyObject*)(type))) >= 1_PyType_Check(((PyObject*)(type)))!(type->tp_flags & (1UL << 13))_PyDict_ContainsId(type->tp_dict, &PyId___new__) == 0PyType_HasFeature((((PyObject*)(op))->ob_type), (1UL << 29))0 <= mp->ma_used && mp->ma_used <= usable(((keys->dk_size) & (keys->dk_size-1)) == 0)0 <= keys->dk_usable && keys->dk_usable <= usable0 <= keys->dk_nentries && keys->dk_nentries <= usablekeys->dk_usable + keys->dk_nentries <= usableentry->me_value != ((void *)0)entry->me_value == ((void *)0)mp->ma_values[i] != ((void *)0)_Py_REFCNT(((const PyObject*)(op))) >= 1Py_ExitStatusException() must not be called on successcannot reuse already awaited aclose()/athrow()aclose(): asynchronous generator is already runningathrow(): asynchronous generator is already runningcan't translate character '\x%02x' in position %zd: %Ucan't translate character '\u%04x' in position %zd: %Ucan't translate character '\U%08x' in position %zd: %Ucan't translate characters in position %zd-%zd: %U%.200s.__setstate__ argument should be 3-tuple, got %.200ssecond item of state must be an integer, not %.200sposition value cannot be negativethird item of state should be a dict, got a %.200sIgnoring unimportable $PYTHONBREAKPOINT: "%s"Can't reinitialize pending calls lockFailed to reinitialize runtime locksutime: you may specify either 'times' or 'ns' but not bothutime: 'times' must be either a tuple of two ints or Noneutime: 'ns' must be a tuple of two ints%s: argv must be a tuple or list%s: environment must be a mapping object%s: argv first element cannot be emptyfile_actions must be a sequence or NoneEach file_actions element must be a non-empty tupleOiO&ik;A open file_action tuple must have 5 elementsOi;A close file_action tuple must have 2 elementsOii;A dup2 file_action tuple must have 3 elementsUnknown file_actions identifierOO;A scheduler tuple must have two elements'yield' inside list comprehension'yield' inside set comprehension'yield' inside dict comprehension'yield' inside generator expressionBUG: internal directive bookkeeping brokencan't delete __class__ attribute__class__ must be set to a class, not '%s' object__class__ assignment only supported for mutable types or ModuleType subclasses__kwdefaults__ must be set to a dict objectfailed to change existing open_code hookfork not supported for subinterpreterslink: src and dst must be the same typesymlink: src and dst must be the same typeexecv() arg 2 must be a tuple or listexecv() arg 2 must not be emptyexecv() arg 2 first element cannot be emptyexecve: argv must be a tuple or listexecve: argv must not be emptyexecve: environment must be a mapping objectexecve: argv first element cannot be emptygeneration parameter must be less than the number of available generations (%i)generation parameter cannot be negativecode: argcount must not be negativecode: posonlyargcount must not be negativecode: kwonlyargcount must not be negativecode: nlocals must not be negativearg 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be None or tuple%U requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %sstate argument must be a tupleOK;setstate(): illegal state argumentpeek() should have returned a bytes object, not '%.200s'read() should have returned a bytes object, not '%.200s'file.read() returned not bytes but %.100sunderlying stream is not seekabletelling position disabled by next() callcan't reconstruct logical file position%.400s constructor takes at most %zd positional argument%s%.400s got multiple values for argument '%U'can't do nonzero cur-relative seekscan't do nonzero end-relative seeksinvalid whence (%d, should be %d, %d or %d)underlying read() should have returned a bytes object, not '%.200s'can't restore logical file position%.200s.__setstate__ argument should be 4-tuple, got %.200sthird item of state must be an integer, got %.200sfourth item of state should be a dict, got a %.200sPyUnicode_AsDecodedObject() is deprecated; use PyCodec_Decode() to decode from strPyUnicode_AsDecodedUnicode() is deprecated; use PyCodec_Decode() to decode from str to strPyUnicode_AsEncodedObject() is deprecated; use PyUnicode_AsEncodedString() to encode from str to bytes or PyCodec_Encode() for generic encodingPyUnicode_AsEncodedUnicode() is deprecated; use PyCodec_Encode() to encode from str to str'%.400s' encoder returned '%.400s' instead of 'str'; use codecs.encode() to encode to arbitrary typesPyUnicode_InternImmortal() is deprecated; use PyUnicode_InternInPlace() insteadNotImplemented should not be used in a boolean contextFailed calling sys.__interactivehook__ Py_Initialize must be called firstUnable to decode the command line argument #%i the __main__ module is not frozensymtable() arg 3 must be 'exec' or 'eval' or 'single'expected an indented block after 'except' statement on line %dexpression cannot contain assignment, perhaps you meant "=="?expected an indented block after 'with' statement on line %dexpected an indented block after 'for' statement on line %dexpected an indented block after 'while' statement on line %dexpected an indented block after 'if' statement on line %dan int variable for demonstration purposesenable(file=sys.stderr, all_threads=True): enable the fault handlerdisable(): disable the fault handleris_enabled()->bool: check if the handler is enableddump_traceback(file=sys.stderr, all_threads=True): dump the traceback of the current thread, or of all threads if all_threads is True, into filedump_traceback_later(timeout, repeat=False, file=sys.stderrn, exit=False): dump the traceback of all threads in timeout seconds, or each timeout seconds if repeat is True. If exit is True, call _exit(1) which is not safe.cancel_dump_traceback_later(): cancel the previous call to dump_traceback_later().register(signum, file=sys.stderr, all_threads=True, chain=False): register a handler for the signal 'signum': dump the traceback of the current thread, or of all threads if all_threads is True, into fileunregister(signum): unregister the handler of the signal 'signum' registered by register()_read_null(): read from NULL, raise a SIGSEGV or SIGBUS signal depending on the platform_sigsegv(release_gil=False): raise a SIGSEGV signalfatal_error_c_thread(): call Py_FatalError() in a new C thread._sigabrt(): raise a SIGABRT signal_sigfpe(): raise a SIGFPE signal_stack_overflow(): recursive call to raise a stack overflowTrue if the file descriptor will be closed by close().day of week, range [0, 6], Monday is 01 if summer time is in effect, 0 if not, and -1 if unknownThe time value as returned by gmtime(), localtime(), and strptime(), and accepted by asctime(), mktime() and strftime(). May be considered as a sequence of 9 integers. Note that several fields' values are not the same as those defined by the C language standard for struct tm. For example, the value of the field tm_year is the actual year, not year - 1900. See individual fields' descriptions for details.errno associated with this signalreal user ID of sending processitertools.combinations_with_replacementmaximum size of a deque or None if unboundedFactory for default value called by __missing__()._collections._deque_reverse_iteratorfunction object to use in future partial callstuple of arguments to future partial callsdictionary of keyword arguments to future partial callsValue wrapped by a key function.Weak-reference support module.A dictionary mapping group names to group numbers.The pattern string from which the RE object was compiled.The number of capturing groups in the pattern.The integer index of the last matched capturing group.The name of the last matched capturing group.The string passed to match() or search().The regular expression object.The index into the string at which the RE engine started looking for a match.The index into the string beyond which the RE engine will not go.integer time of last modificationtime of last access in nanosecondstime of last modification in nanosecondstime of last change in nanosecondsname of machine on network (implementation-defined)elapsed time since an arbitrary point in the pastwidth of the terminal window in charactersheight of the terminal window in charactersthe entry's base filename, relative to scandir() "path" argumentthe entry's full path name; equivalent to os.path.join(scandir_path, entry.name)SC_THREAD_DESTRUCTOR_ITERATIONSCS_XBS5_ILP32_OFFBIG_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_LINTFLAGS.cpython-310-x86_64-linux-gnu.soname of the thread implementationname of the lock implementationname and version of the thread libraryHook to intercept first iterationHook to intercept finalizationwidth of the type used for hashing, in bitsprime number giving the modulus on which the hash function is basedvalue to be used for hash of a positive infinityvalue to be used for hash of a nanmultiplier used for the imaginary part of a complex numbername of the algorithm for hashing of str, bytes and memoryviewsinternal output size of hash algorithmsmall string optimization cutoff'alpha', 'beta', 'candidate', or 'final'set_coroutine_origin_tracking_depthget_coroutine_origin_tracking_depthImplements the 'strict' error handling, which raises a UnicodeError on coding errors.Implements the 'ignore' error handling, which ignores malformed data and continues.Implements the 'replace' error handling, which replaces malformed data with a replacement marker.Implements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.Implements the 'backslashreplace' error handling, which replaces malformed data with a backslashed escape sequence.Implements the 'namereplace' error handling, which replaces an unencodable character with a \N{...} escape sequence.Type variables in the types.UnionType.Represent a PEP 604 union type E.g. for int | strReturn the size (in bytes) of this objectsplit the argument as a field nameparse the argument as a format string__prepare__() -> dict used to create the namespace for the class statementthe instance invoking super(); may be Nonethe type of the instance invoking super(); may be None__new__($type, *args, **kwargs) -- Create and return a new object. See help(type) for accurate signature.__repr__($self, /) -- Return repr(self).__hash__($self, /) -- Return hash(self).__call__($self, /, *args, **kwargs) -- Call self as a function.__str__($self, /) -- Return str(self).__getattribute__($self, name, /) -- Return getattr(self, name).__setattr__($self, name, value, /) -- Implement setattr(self, name, value).__delattr__($self, name, /) -- Implement delattr(self, name).__lt__($self, value, /) -- Return selfvalue.__ge__($self, value, /) -- Return self>=value.__iter__($self, /) -- Implement iter(self).__next__($self, /) -- Implement next(self).__get__($self, instance, owner=None, /) -- Return an attribute of instance, which is of type owner.__set__($self, instance, value, /) -- Set an attribute of instance to value.__delete__($self, instance, /) -- Delete an attribute of instance.__init__($self, /, *args, **kwargs) -- Initialize self. See help(type(self)) for accurate signature.__new__(type, /, *args, **kwargs) -- Create and return new object. See help(type) for accurate signature.__await__($self, /) -- Return an iterator to be used in await expression.__aiter__($self, /) -- Return an awaitable, that resolves in asynchronous iterator.__anext__($self, /) -- Return a value or raise StopAsyncIteration.__add__($self, value, /) -- Return self+value.__radd__($self, value, /) -- Return value+self.__sub__($self, value, /) -- Return self-value.__rsub__($self, value, /) -- Return value-self.__mul__($self, value, /) -- Return self*value.__rmul__($self, value, /) -- Return value*self.__mod__($self, value, /) -- Return self%value.__rmod__($self, value, /) -- Return value%self.__divmod__($self, value, /) -- Return divmod(self, value).__rdivmod__($self, value, /) -- Return divmod(value, self).__pow__($self, value, mod=None, /) -- Return pow(self, value, mod).__rpow__($self, value, mod=None, /) -- Return pow(value, self, mod).__abs__($self, /) -- abs(self)__bool__($self, /) -- True if self else False__invert__($self, /) -- ~self__lshift__($self, value, /) -- Return self<>value.__rrshift__($self, value, /) -- Return value>>self.__and__($self, value, /) -- Return self&value.__rand__($self, value, /) -- Return value&self.__xor__($self, value, /) -- Return self^value.__rxor__($self, value, /) -- Return value^self.__or__($self, value, /) -- Return self|value.__ror__($self, value, /) -- Return value|self.__int__($self, /) -- int(self)__float__($self, /) -- float(self)__iadd__($self, value, /) -- Return self+=value.__isub__($self, value, /) -- Return self-=value.__imul__($self, value, /) -- Return self*=value.__imod__($self, value, /) -- Return self%=value.__ipow__($self, value, /) -- Return self**=value.__ilshift__($self, value, /) -- Return self<<=value.__irshift__($self, value, /) -- Return self>>=value.__iand__($self, value, /) -- Return self&=value.__ixor__($self, value, /) -- Return self^=value.__ior__($self, value, /) -- Return self|=value.__floordiv__($self, value, /) -- Return self//value.__rfloordiv__($self, value, /) -- Return value//self.__truediv__($self, value, /) -- Return self/value.__rtruediv__($self, value, /) -- Return value/self.__ifloordiv__($self, value, /) -- Return self//=value.__itruediv__($self, value, /) -- Return self/=value.__index__($self, /) -- Return self converted to an integer, if self is suitable for use as an index into a list.__matmul__($self, value, /) -- Return self@value.__rmatmul__($self, value, /) -- Return value@self.__imatmul__($self, value, /) -- Return self@=value.__len__($self, /) -- Return len(self).__getitem__($self, key, /) -- Return self[key].__setitem__($self, key, value, /) -- Set self[key] to value.__delitem__($self, key, /) -- Delete self[key].__contains__($self, key, /) -- Return key in self.__iadd__($self, value, /) -- Implement self+=value.__imul__($self, value, /) -- Implement self*=value.dictionary for instance variables (if defined)list of weak references to the object (if defined)Wrapper for potentially out-of-band buffers__dir__() -> list specialized dir() implementationdictionary that this view refers tothe real part of a complex numberthe imaginary part of a complex numberthe numerator of a rational number in lowest termsthe denominator of a rational number in lowest termsReturns self, the complex conjugate of any int.Truncating an Integral returns itself.Flooring an Integral returns itself.Ceiling of an Integral returns itself.size in bytes of the C type used to represent a digitmaximum string conversion digits limitationminimum positive value for int_max_str_digitsDBL_MAX -- maximum representable finite floatDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representableDBL_MAX_10_EXP -- maximum int e such that 10**e is representableDBL_MIN -- Minimum positive normalized floatDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalized floatDBL_DIG -- maximum number of decimal digits that can be faithfully represented in a floatDBL_MANT_DIG -- mantissa digitsDBL_EPSILON -- Difference between 1 and the next representable floatFLT_RADIX -- radix of exponentFLT_ROUNDS -- rounding mode used for arithmetic operationsqualified name of the generatorobject being iterated by yield from, or Nonequalified name of the coroutineobject being awaited on, or Nonequalified name of the async generatorA wrapper object implementing __await__ for coroutines.Type variables in the GenericAlias.Operation only works on directories.Operation doesn't work on directories.Base class for warnings about resource usage.Base class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.Base class for warnings about Unicode related problems, mostly related to conversion problems.Base class for warnings about probable mistakes in module importsBase class for warnings about constructs that will change semantically in the future.Base class for warnings about dubious runtime behavior.Base class for warnings about dubious syntax.Base class for warnings about features which will be deprecated in the future.Base class for warnings about deprecated features.Base class for warnings about encodings.Base class for warnings generated by user code.Base class for warning categories.Weak ref proxy used after referent went away.Internal error in the Python interpreter. Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.Second argument to a division or modulo operation was zero.Result too large to be represented.Floating point operation failed.Base class for arithmetic errors.Inappropriate argument value (of correct type).Improper mixture of spaces and tabs.Local name referenced but not bound to a value.Method or function hasn't been implemented yet.Base class for I/O related errors.Import can't find module, or can't find name in module.Request to exit from the interpreter.Request that a generator exit.Signal the end from iterator.__next__().Signal the end from iterator.__anext__().Common base class for all non-exit exceptions.Common base class for all exceptionsD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.keys() -> a set-like object providing a view on D's keysD.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.copy() -> a shallow copy of DD.__reversed__() -> reverse iteratorthe function (or other callable) implementing a methodthe instance to which a method is boundutf810dev----help-c-mstrictalwaysnever,utf-8asciiUTF-8ignoreLibos.pyrb home =warn_default_encoding--versionbBc:dEhiIJm:OqRsStuvVW:xX:?error::BytesWarningdefault::BytesWarningsurrogateescapepython3defaultshowrefcountfaulthandlerimporttimetracemallocint_max_str_digitspycache_prefixpyvenv.cfgpython310.zipbackslashreplacesurrogatepassxmlcharrefreplaceModules/Setup.locallib-dynloadpybuilddir.txt__main__check-hash-based-pycs8&&,DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD@CDDYDDDS{XO+ + + + sX+ U+ + + + + + + + + + + Q+ Q+ + V+ + + + W+ + + + + + U+ + + + I W+ + + + + V] + + + + + U+ R+ + .W+ V+ + iW+ + + + + HO:QVU+ + ZkV !_F!!3!!3=%!!ʛ҉yˆƽһߵ!!!!!!!!!!!!!!(9!)p!$kR ǓJܘUJ!!]=ؑP!AC(!ۄ,! CJJ|ʐЗh!!ks5Gk{GHHH&EHHHHHH HHHhH4HHHHHHHjE9AH HH^HHHH4HH8 T@#@*T?S?SSSS??%T@S?DT:T@S]NT]\\2\N\Y[[ZaZ2\N]Nӫymt(Gfe(Y?v% 5$lQ[:Q9>;!:=8<<:N?=9 < ?=;;U>::::8GaKLIJLwMKML]NM MGMGIHHPLGGmJGGK@IKMOONAOOZOPPPPoPP G G G G G G=R#RER tr.ytsux[rvw{t{xsZv{Twu vxvw@zz-r04444444444A44X3333X3333333333X333_ZUdXXXXXXXXXXXX1!a˗>}qFe546הd'(<=yc==oJ0e87>8]2hEPEhQ_I%(%(::::::::h \ ; h UN%UNUN%xNMM%MN%%r ~ 7 ]%$p% = -v.S..-------...z.-----..------.--b.------- . .0..-------..j.----------.'. ..---.----++,++,++++++++,,,,,,,,,,,,,,,,,,,,,,,,,+++,+,,++++++,,+,+,,* 4e"## $$##t"%e"e"S%SwS%wSSS%%%%%SS%%%%%%%v<9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>@9>9>9>9>4@9>9>9>9>9>9>9>9>>>>>>>>>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>9>g@9>9>9>9>9>9>?9>9>9>9>9>9>?9>9>9>9>AA9>9>9>RA9>9>9>9>9>9>9>=9>9>9>??9>q??XUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV V V V V V V V VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVGh:hVVVVVVVVVVV]VVVVjVVwVVVVU,-+,.,u,N2221b132]]]][`[``_\\\\6]aY]]b ]]\\ ]\\a^\^cdS#TssĴ$\L4-$0n/c7Tt7H$|TfCİ|^ [\KLkk|TD,ع%(f'zg~5555595555K5555555555555555K:::::::::::::::::::::::::G::::}$ , A L /5nQhX|N-"Ag$X$v$$u|$$/3a=MvCMM@VVie>^@MMfM>?<<:DCC>C'6&;Yzqh_QH HM D ; 2 )   G z q h G G w n e \ LGLGS J A 8 / & G3 * !    F w n e \ S FFFFFFFF gF ~ u l c Z Q H %F E9 0 '    E z q h _ V ED>?Y@ Azk@AHBqqh_VMD;2)  qh_VMD;2)  D {ri`WNE<3eD+DTKB90'CCCCCCC`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`C`CvmoBBBtkbYPG>5,#AAAAAAtkbYPG>5,#xof]TKBAsA4=A=A=A+"=A=A=A=A=A=A4+"~ulcZZQH?6-$@;;;;;;;Hz<<<<<~ulcZ<<<~:>~:>==============kC=bYPC=C=C=C=C=C=G<< <{ri`WNE<3*<<<<<<<<<<<<<<<<<<<<<<{ri`WNE<3*B90' ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;B90' :.% :}tkbY:V4444m`6N6h4M4M4D4d36!64[RRv4 ypg^ULC:1( }tA66778T88k<556=777'8]89p ~ulcZQH?6-$ 666666666666666666666666666666666666Z64+"c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c5c54+"4}tkbYPG44]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4]4wne\SJA8/& 3wne\SJAXOF=4+"wne\&3ZQH?6-$222222222222222222222222ZQH?6-$;2_VMD221ypg^ULC:1x1vmd[1{ri`WNE0000000{ri`WNE<3*!wne\SJA8w0J02) /zqh_VM//7.% /{ri`W`/3/|s|sjaXOF=4+".. O.ypg^ULC:".Z);*++E,,,-S-c)D* ++N,,,-\-l)M*++W,,,&-e-u)V*++`,,,/-n-~)_*~)-)(*u)~)Z);*++E,,,-S-c)D* ++N,,,-\-l)M*++W,,,&-e-u)V*++`,,,/-n-Z)+,M*u)(-)md[RI@7.%q *S&\&e&y*%&(%&%{r%&iwn("J$e$n$$$$$$y(}tkbYPG>5,#6('''''}tkbYPG'&QH?6-$r&~u<& &'!k""#l$$%V%%}tkbYP%C.Up~ߺ^.~ )  !+BSjMߣc@sdZeddS)Tz Hello world!N)Z initializedprintrrzs c@sPdZddlZddlmZmZddlZddlZddlZddl Z ddl Z ddl Z ddl Z ddgZ ejZejddZGdddeZiZee ZdZd Zd ZGd ddejZed d d feddd fddfZddZddZddZddZdZ da!ddZ"ddZ#dd Z$d!d"Z%ee%j&Z'd#d$Z(d%d&Z)d'd(Z*d)d*Z+d+d,Z,d-d.Z-dS)/aPzipimport provides support for importing Python modules from Zip archives. This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files. It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives. N)_unpack_uint16_unpack_uint32ZipImportError zipimporterc@s eZdZdS)rN)__name__ __module__ __qualname__r r r"ssPKic@s~eZdZdZddZdddZdddZdd d Zd d Zd dZ ddZ ddZ ddZ ddZ ddZddZddZdS)razipimporter(archivepath) -> zipimporter object Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive. 'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive. The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted. c Cs$t|tsddl}||}|std|dtr|tt}g} zt |}Wn#t t fyKt |\}}||krBtd|d|}| |Ynw|jd@dkrYtd|dnq!zt|}Wntyrt|}|t|<Ynw||_||_tj|ddd|_|jr|jt7_dSdS) Nrzarchive path is emptypathTznot a Zip fileii) isinstancestrosZfsdecoder alt_path_sepreplacepath_sep_bootstrap_externalZ _path_statOSError ValueErrorZ _path_splitappendZst_mode_zip_directory_cacheKeyError_read_directory_filesarchive _path_joinprefix)selfr rrZstZdirnameZbasenamefilesr r r __init__@sD         zzipimporter.__init__NcCsZtdtt||}|dur|gfSt||}t||r)d|jt|gfSdgfS)a/find_loader(fullname, path=None) -> self, str or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, a string containing the full path name if it's possibly a portion of a namespace package, or None otherwise. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol. Deprecated since Python 3.10. Use find_spec() instead. zfzipimporter.find_loader() is deprecated and slated for removal in Python 3.12; use find_spec() insteadN) _warningswarnDeprecationWarning_get_module_info_get_module_path_is_dirrr)r fullnamer mimodpathr r r find_loaderns    zzipimporter.find_loadercCstdt|||dS)afind_module(fullname, path=None) -> self or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, or None if it wasn't. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol. Deprecated since Python 3.10. Use find_spec() instead. zfzipimporter.find_module() is deprecated and slated for removal in Python 3.12; use find_spec() insteadr)r#r$r%r,)r r)r r r r find_modules zzipimporter.find_modulecCslt||}|durtj|||dSt||}t||r4|jt|}tj|ddd}|j ||SdS)zkCreate a ModuleSpec for the specified module. Returns None if the module cannot be found. N) is_packageT)nameZloaderr.) r& _bootstrapZspec_from_loaderr'r(rrZ ModuleSpecZsubmodule_search_locationsr)r r)ZtargetZ module_infor+r Zspecr r r find_specs    zzipimporter.find_speccCst||\}}}|S)zget_code(fullname) -> code object. Return the code object for the specified module. Raise ZipImportError if the module couldn't be imported. _get_module_coder r)code ispackager+r r r get_codeszzipimporter.get_codecCsptr|tt}|}||jtr|t|jtd}z|j|}Wn ty1tdd|wt |j|S)zget_data(pathname) -> string with file data. Return the data associated with 'pathname'. Raise OSError if the file wasn't found. Nr) rrr startswithrlenrrr _get_data)r pathnameZkey toc_entryr r r get_datas    zzipimporter.get_datacCst||\}}}|S)zget_filename(fullname) -> filename string. Return the filename for the specified module or raise ZipImportError if it couldn't be imported. r2r4r r r get_filenameszzipimporter.get_filenamecCs~t||}|durtd||dt||}|r t|d}n|d}z|j|}Wn ty6YdSwt|j| S)zget_source(fullname) -> source string. Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it. Ncan't find module r/ __init__.py.py) r&rr'rrrrr;rdecode)r r)r*r fullpathr=r r r get_sources    zzipimporter.get_sourcecCs(t||}|durtd||d|S)zis_package(fullname) -> bool. Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found. Nr@rA)r&r)r r)r*r r r r.s zzipimporter.is_packagec Csd}t|tt||\}}}tj|}|dust|ts(t|}|tj|<||_ z*|r>t ||}t |j |}|g|_t|dsFt|_t |j||t||jWntj|=ztj|}Wntyttd|dwtd|||S)a@load_module(fullname) -> module. Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it could not be imported. Deprecated since Python 3.10. Use exec_module() instead. zrzipimport.zipimporter.load_module() is deprecated and slated for removal in Python 3.12; use exec_module() insteadN __builtins__zLoaded module z not found in sys.moduleszimport {} # loaded from Zip {})r#r$r%r3sysmodulesgetr _module_type __loader__r'rrrZ__path__hasattrrGZ_fix_up_module__dict__execr ImportErrorr0_verbose_message) r r)msgr5r6r+Zmodr rEr r r load_modules6      zzipimporter.load_modulecCs@z ||s WdSWn tyYdSwddlm}|||S)zReturn the ResourceReader for a package in a zip file. If 'fullname' is a package within the zip file, return the 'ResourceReader' object for the package. Otherwise return None. Nr) ZipReader)r.rZimportlib.readersrT)r r)rTr r r get_resource_reader;s    zzipimporter.get_resource_readercCsHzt|j|_|jt|j<WdSty#t|jdi|_YdSw)z)Reload the file data of the archive path.N)rrrrrpopr r r r invalidate_cachesJs   zzipimporter.invalidate_cachescCsd|jt|jdS)Nz)rrrrWr r r __repr__Tszzipimporter.__repr__N)rrr__doc__r"r,r-r1r7r>r?rFr.rSrUrXrYr r r r r.s . %    + z __init__.pycTrBF)z.pycTF)rCFFcCs|j|ddS)N.)r rpartition)r r)r r r r'fsr'cCs|t}||jvSrZ)rr)r r Zdirpathr r r r(js r(cCs8t||}tD]\}}}||}||jvr|SqdSrZ)r'_zip_searchorderr)r r)r suffix isbytecoder6rEr r r r&ss  r&c Cszt|}Wntytd||dw|T|}z@z|t d|}|t}WntyDtd||dwt|tkrTtd||d|ddt krz |dd|}Wntyxtd||dwt |t td}z |||}Wntytd||dw| t }|dkrtd||d|||t}t|tkrtd||d|t||}t |d d } t |d d } || krtd ||d|| krtd ||d|| 8}|| } | dkrtd||di} d} z||Wnty+td||dw |d}t|dkr=td|dddkrHnt|dkrStdt|dd}t|dd }t|d d}t|dd }t |d d }t |d d}t |dd}t|dd}t|dd}t|dd}t |dd}|||} || krtd||d|| 7}z||}Wntytd||dwt||krtd||dzt|| || |krtd||dWntytd||dw|d@r!|}nz|d}Wnty:|dt}Ynw|d t}t||}||||||||f}|| |<| d!7} q-W||n||wWdn 1sswYtd"| || S)#Nzcan't open Zip file: r r]can't read Zip file: rznot a Zip file: zcorrupt Zip file: zbad central directory size: zbad central directory offset: z&bad central directory size or offset: T.EOF read where not expectedsPK  "*zbad local header offset: iasciiZlatin1/rz!zipimport: found {} names in {!r})_io open_coderrZtellseekEND_CENTRAL_DIR_SIZEreadr:STRING_END_ARCHIVEmaxMAX_COMMENT_LENrfindrEOFErrorrrDUnicodeDecodeError translate cp437_tablerrrrr0rQ)rfpZ start_offsetZheader_positionbuffer file_sizeZmax_comment_startdataZpos header_sizeZ header_offsetZ arc_offsetr!countflagscompresstimedatecrc data_size name_size extra_sizeZ comment_size file_offsetr/r tr r r rs                       2tru  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ÇüéâäàåçêëèïîìÄÅÉæÆôöòûùÿÖÜ¢£¥₧ƒáíóúñѪº¿⌐¬½¼¡«»░▒▓│┤╡╢╖╕╣║╗╝╜╛┐└┴┬├─┼╞╟╚╔╩╦╠═╬╧╨╤╥╙╘╒╓╫╪┘┌█▄▌▐▀αßΓπΣσµτΦΘΩδ∞φε∩≡±≥≤⌠⌡÷≈°∙·√ⁿ²■ cCsjtr tdtddazzddlm}Wnty&tdtdwWdandawtd|S)Nzzipimport: zlib UNAVAILABLE)can't decompress data; zlib not availableTr decompressFzzipimport: zlib available)_importing_zlibr0rQrZzlibr Exceptionrr r r _get_decompress_func7s     rc Csx|\}}}}}}}} |dkrtdt|} z| |Wnty/td||dw| d} t| dkr?td| dddkrPtd ||dt| d d } t| d d} d| | }||7}z| |Wntytd||dw| |}t||krtd Wdn1swY|dkr|Szt }Wn t ytd w||dS)Nrznegative data sizerbr rnrhrcsPKzbad local file header: rmzzipimport: can't read datari) rrtrurvrrxr:r}rrr)rr=ZdatapathrrrrrrrrrrrrZraw_datarr r r r;LsH           r;cCst||dkS)Nr)abs)Zt1Zt2r r r _eq_mtimezsrcCs||d}t|||}|d@dk}|r?|d@dk}tjdkr>|s&tjdkr>t||} | dur>ttj| } t|| ||n(t||\} } | rgt t |dd| r]t |dd | krgt d |dSt |d d} t| ts}td |d | S) N)r/r rrr]ZneverZalwaysrirdrezbytecode is stale for zcompiled module z is not a code object)rZ _classify_pyc_impZcheck_hash_based_pycs_get_pyc_source source_hashZ_RAW_MAGIC_NUMBERZ_validate_hash_pyc_get_mtime_and_size_of_sourcerrr0rQmarshalZloadsr _code_type TypeError)r r<rEr)rZ exc_detailsrZ hash_basedZ check_sourceZ source_bytesrZ source_mtimeZ source_sizer5r r r _unmarshal_codesD      rcCs|dd}|dd}|S)Ns   )r)sourcer r r _normalize_line_endingss  rcCst|}t||dddS)NrOT)Z dont_inherit)rcompile)r<rr r r _compile_sourcesrc CsDt|d?d|d?d@|d@|d?|d?d@|d@dd d d f S) N i ?r]r)rZmktime)drr r r _parse_dostimes    rc Csnz)|dddvs J|dd}|j|}|d}|d}|d}t|||fWStttfy6YdSw)Nrcor)rr)rrr IndexErrorr)r r r=rrZuncompressed_sizer r r rs  rcCsP|dddvs J|dd}z|j|}Wn ty!YdSwt|j|S)Nrr)rrr;r)r r r=r r r rs   rc Cst||}d}tD]f\}}}||}tjd|jt|ddz|j|}Wn ty-Yq w|d} t|j|} d} |r[z t || ||| } Wnt yZ} z| }WYd} ~ n d} ~ wwt | | } | dureq |d} | || fS|r~d|} t | |d|t d||d)Nz trying {}{}{}r])Z verbosityrzmodule load failed: rAr@) r'r_r0rQrrrrr;rrPrr)r r)r Z import_errorr`rar6rEr=r+rr5ZexcrRr r r r3s:     r3).r[Z_frozen_importlib_externalrrrZ_frozen_importlibr0rrtrrHrr#Z__all__rZpath_separatorsrrPrrtyperKrwryr{Z _LoaderBasicsrr_r'r(r&rrrrr;rr__code__rrrrrrr3r r r r s\ 2   . (  c@sdZdaddlZddlZddlZddlZddlZejdkZer(ddl Z ddl Z nddl Z er3ddgZ ndgZ edde DsAJe dZee Zde Z d d e DZd Zd ZeeZd dZeZddZddZddZerwddZnddZddZddZddZddZ d d!Z!erd"d#Z"nd$d#Z"dpd&d'Z#e$e#j%Z&d('d)d*d+Z(e)*e(d*Z+d,Z,d-Z-d.gZ.ere./d/e0Z1d0gZ2e2Z3Z4dqdd1d2d3Z5d4d5Z6d6d7Z7d8d9Z8d:d;Z9dd?Z;d@dAZdrdFdGZ?dsdHdIZ@dtdKdLZAdMdNZBeCZDdqdeDdOdPdQZEGdRdSdSZFGdTdUdUZGGdVdWdWeGZHGdXdYdYZIGdZd[d[eIeHZJGd\d]d]eIeGZKGd^d_d_eIeGZLGd`dadaZMGdbdcdcZNGdddedeZOGdfdgdgZPdqdhdiZQdjdkZRdldmZSdndoZTdS)ua^Core implementation of path-based import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. NZwin32\/ccs|] }t|dkVqdS)N)len).0sepr& .sr cCsh|]}d|qS):r)rsrrr 2sr )win)ZcygwinZdarwincs>tjtrtjtrdndfdd}|Sdd}|S)NZ PYTHONCASEOKs PYTHONCASEOKcstjj o tjvS)z^True if filenames must be checked case-insensitively and ignore environment flags are not set.)sysflagsignore_environment_osZenvironrkeyrr _relax_caseCz%_make_relax_case.._relax_casecSdS)z5True if filenames must be checked case-insensitively.FrrrrrrG)rplatform startswith_CASE_INSENSITIVE_PLATFORMS#_CASE_INSENSITIVE_PLATFORMS_STR_KEY)rrrr_make_relax_case<s   rcCst|d@ddS)z*Convert a 32-bit integer to little-endian.little)intto_bytes)xrrr _pack_uint32Orr$cCt|dksJt|dS)z/Convert 4 bytes in little-endian to an integer.rr rr! from_bytesdatarrr_unpack_uint32T r*cCr%)z/Convert 2 bytes in little-endian to an integer.r r&r(rrr_unpack_uint16Yr+r-cGs|sdSt|dkr|dSd}g}ttj|D]=\}}|ts&|tr3|tp,|}t |g}q|drL| | krF|}|g}q| |q|pO|}| |qdd|D}t|dkrk|dsk|t S|t |S)Replacement for os.path.join().r rrr cSg|] }|r|tqSrrstrippath_separatorsrprrr ws_path_join..) rmapr_path_splitrootrpath_sep_tupleendswithr1r2path_sepcasefoldappendjoin) path_partsrootpathZnew_roottailrrr _path_join`s*     rCcGstdd|DS)r.cSr/rr0)rpartrrrr5sr6)r;r>)r?rrrrC~s csBtfddtD}|dkrdfSd||ddfS)z Replacement for os.path.split().c3s|]}|VqdSN)rfindr3rArrr sz_path_split..rr Nr)maxr2)rAirrGr _path_splitsrJcCs t|S)z~Stat the path. Made a separate function to make it easier to override in experiments (e.g. cache stat results). )rZstatrGrrr _path_stats rKcCs0zt|}Wn tyYdSw|jd@|kS)z1Test whether the path is the specified mode type.Fi)rKOSErrorst_mode)rAmodeZ stat_inforrr_path_is_mode_types   rOcCs t|dS)zReplacement for os.path.isfile.i)rOrGrrr _path_isfile rPcCs|st}t|dS)zReplacement for os.path.isdir.i@)rgetcwdrOrGrrr _path_isdirs rScCs>|sdSt|ddd}t|dko|dp|dS)Replacement for os.path.isabs.Frrrrz\\)rr8replacerrr:)rAr@rrr _path_isabss rVcCs |tS)rT)rr2rGrrrrVrQc Csd|t|}t|tjtjBtjB|d@}z$t|d }| |Wdn1s/wYt ||WdSt yTzt |Wt ySYww)zBest-effort function to write data to a path atomically. Be prepared to handle a FileExistsError if concurrent writing of the temporary file is attempted.{}.{}rWZwbN) formatidrZopenZO_EXCLZO_CREATZO_WRONLY_ioFileIOwriterUrLZunlink)rAr)rNZpath_tmpZfdfilerrr _write_atomics$    r_io r,r s Z __pycache__zopt-z.pyz.pywz.pyc) optimizationc CsP|durtdt|durd}t||rdnd}t|}t|\}}|d\}}}tj j } | dur9t dd |r?|n||| g} |durVtj jdkrRd}ntj j}t|}|dkrp|sitd |d | t|} | td} tjdurt|stt|}|dd kr|dtvr|d d}ttj|t| St|t| S) aGiven the path to a .py file, return the path to its .pyc file. The .py file does not need to exist; this simply returns the path to the .pyc file calculated as if the .py file were imported. The 'optimization' parameter controls the presumed optimization level of the bytecode file. If 'optimization' is not None, the string representation of the argument is taken and verified to be alphanumeric (else ValueError is raised). The debug_override parameter is deprecated. If debug_override is not None, a True value is the same as setting 'optimization' to the empty string while a False value is equivalent to setting 'optimization' to '1'. If sys.implementation.cache_tag is None then NotImplementedError is raised. NzFthe debug_override parameter is deprecated; use 'optimization' insteadz2debug_override or optimization must be set to Noner r.$sys.implementation.cache_tag is Nonerz{!r} is not alphanumericz{}.{}{}r r,) _warningswarnDeprecationWarning TypeErrorrfspathrJ rpartitionrimplementation cache_tagNotImplementedErrorr>roptimizestrisalnum ValueErrorrY_OPTBYTECODE_SUFFIXESpycache_prefixrVrCrRr2lstrip_PYCACHE) rAZdebug_overrider`messageheadrBZbaserrestZtagZalmost_filenamefilenamerrrcache_from_source|sH         ryc Cs(tjjdur tdt|}t|\}}d}tjdur3tjt }| |t r3|t |d}d}|sHt|\}}|t krHtt d||d}|dvrXtd||d kr|dd d }| tsptd t|t td}|std |d|dd} t|| tdS)anGiven the path to a .pyc. file, return the path to its .py file. The .pyc file does not need to exist; this simply returns the path to the .py file calculated to correspond to the .pyc file. If path does not conform to PEP 3147/488 format, ValueError will be raised. If sys.implementation.cache_tag is None then NotImplementedError is raised. NrbFTz not bottom-level directory in ra>r,zexpected only 2 or 3 dots in rzr,z5optimization portion of filename does not start with zoptimization level z is not an alphanumeric valuer)rrirjrkrrgrJrrr1r2rr;rrtrocountrsplitrprn partitionrCSOURCE_SUFFIXES) rArvZpycache_filenameZfound_in_pycache_prefixZ stripped_pathZpycacheZ dot_countr`Z opt_levelZ base_filenamerrrsource_from_caches<        rc Cs|t|dkrdS|d\}}}|r|dddkr|Szt|}Wnttfy5|dd}Ynwt|r<|S|S)zConvert a bytecode file path to a source path (if possible). This function exists purely for backwards-compatibility for PyImport_ExecCodeModuleWithFilenames() in the C API. rNraZpy)rrhlowerrrkrorP) bytecode_pathrw_Z extension source_pathrrr_get_sourcefiles  rcCsD|ttrzt|WStyYdSw|ttr |SdSrE)r:tuplerryrkrq)rxrrr _get_cacheds  rcCs2zt|j}Wn tyd}Ynw|dO}|S)z3Calculate the mode permissions for a bytecode file.rW)rKrMrL)rArNrrr _calc_mode s rcs4dfdd }tdurtj}ndd}|||S)zDecorator to verify that the module being requested matches the one the loader can handle. The first argument (self) must define _name which the second argument is compared against. If the comparison fails then ImportError is raised. NcsH|dur|j}n|j|krtd|j|f|d||g|Ri|S)Nzloader for %s cannot handle %sname)r ImportError)selfrargskwargsmethodrr_check_name_wrappers z(_check_name.._check_name_wrappercSs8dD]}t||rt||t||q|j|jdS)N) __module____name__ __qualname____doc__)hasattrsetattrgetattr__dict__update)ZnewZoldrUrrr_wrap+s  z_check_name.._wraprE) _bootstrapr)rrrrrr _check_names   rcCsHtdt||\}}|dur"t|r"d}t||dt|S)zTry to find a loader for the specified module by delegating to self.find_loader(). This method is deprecated in favor of finder.find_spec(). zZfind_module() is deprecated and slated for removal in Python 3.12; use find_spec() insteadNz,Not importing directory {}: missing __init__r)rcrdre find_loaderrrY ImportWarning)rfullnameloaderportionsmsgrrr_find_module_shim5srcCs|dd}|tkr d|d|}td|t|fi|t|dkr5d|}td|t|t|dd}|d @rQd |d |}t|fi||S) aTPerform basic validity checking of a pyc header and return the flags field, which determines how the pyc should be further validated against the source. *data* is the contents of the pyc file. (Only the first 16 bytes are required, though.) *name* is the name of the module being imported. It is used for logging. *exc_details* is a dictionary passed to ImportError if it raised for improved debugging. ImportError is raised when the magic number is incorrect or when the flags field is invalid. EOFError is raised when the data is found to be truncated. Nrzbad magic number in z: {}z(reached EOF while reading pyc header of zinvalid flags z in ) MAGIC_NUMBERr_verbose_messagerrEOFErrorr*)r)r exc_detailsZmagicrurrrr _classify_pycIs     rcCs|t|dd|d@krd|}td|t|fi||dur:t|dd|d@krB}|t|t|dksJ|||t||S)z&Produce the data for a hash-based pyc.rr)rrrr$rrr)rrZcheckedr)rrrr_code_to_hash_pycs  rcCs>ddl}t|j}||}tdd}|||dS)zyDecode bytes representing source code and return the string. Universal newline support is used in the decoding. rNT)tokenizer[ZBytesIOZreadlineZdetect_encodingZIncrementalNewlineDecoderdecode) source_bytesrZsource_bytes_readlineencodingZnewline_decoderrrr decode_sources    rrsubmodule_search_locationsc Cs6|durd}t|drz||}Wn&tyYnwnt|}t|s9z tt|}Wn ty8Ynwt j |||d}d|_ |durct D]\}}| t|r`|||}||_nqKdS|turt|drz||}Wn ty|Yn w|rg|_n||_|jgkr|rt|d}|j||S)a=Return a module spec based on a file location. To indicate that the module is a package, set submodule_search_locations to a list of directory paths. An empty list is sufficient, though its not otherwise useful to the import system. The loader must take a spec as its only __init__() arg. Nz get_filenameoriginT is_packager)rrrrrgrVrCrRrLr ModuleSpecZ _set_fileattr_get_supported_file_loadersr:rr _POPULATErrrJr=) rZlocationrrspec loader_classsuffixesrZdirnamerrrspec_from_file_locationsT            rc@sXeZdZdZdZdZeodevZe ddZ e ddZ e dd d Z e dd d Zd S)WindowsRegistryFinderz>Meta path finder for modules declared in the Windows registry.z;Software\Python\PythonCore\{sys_version}\Modules\{fullname}zASoftware\Python\PythonCore\{sys_version}\Modules\{fullname}\Debugz_d.pydcCs2zttj|WStyttj|YSwrE)winregZOpenKeyZHKEY_CURRENT_USERrLZHKEY_LOCAL_MACHINErrrr_open_registry&s  z$WindowsRegistryFinder._open_registrycCs|jr|j}n|j}|j|dtjddd}z ||}t|d}WdW|S1s1wYW|St yBYdSw)Nz%d.%dr,)rZ sys_versionr ) DEBUG_BUILDREGISTRY_KEY_DEBUG REGISTRY_KEYrYr version_inforrZ QueryValuerL)clsrZ registry_keyrZhkeyfilepathrrr_search_registry-s    z&WindowsRegistryFinder._search_registryNcCsx||}|dur dSzt|Wn tyYdSwtD]\}}|t|r9tj|||||d}|SqdS)Nr)rrKrLrr:rrspec_from_loader)rrrAtargetrrrrrrr find_spec<s"   zWindowsRegistryFinder.find_speccCs*tdt|||}|dur|jSdS)zjFind module named in the registry. This method is deprecated. Use find_spec() instead. zpWindowsRegistryFinder.find_module() is deprecated and slated for removal in Python 3.12; use find_spec() insteadNrcrdrerrrrrArrrr find_moduleLs z!WindowsRegistryFinder.find_moduleNNrE)rrrrrr _MS_WINDOWSEXTENSION_SUFFIXESr staticmethodr classmethodrrrrrrrrs    rc@s0eZdZdZddZddZddZdd Zd S) _LoaderBasicszSBase class of common code needed by both SourceLoader and SourcelessFileLoader.cCs@t||d}|ddd}|dd}|dko|dkS)zConcrete implementation of InspectLoader.is_package by checking if the path returned by get_filename has a filename of '__init__.py'.rrarr,__init__)rJrr}rh)rrrxZ filename_baseZ tail_namerrrrbsz_LoaderBasics.is_packagecCrz*Use default semantics for module creation.Nrrrrrr create_modulejz_LoaderBasics.create_modulecCs8||j}|durtd|jtt||jdS)zExecute the module.Nz4cannot load module {!r} when get_code() returns None)get_coderrrYr_call_with_frames_removedexecr)rmodulerrrr exec_modulems z_LoaderBasics.exec_modulecCs t||S)zThis method is deprecated.)r_load_module_shimrrrrr load_moduleus z_LoaderBasics.load_moduleN)rrrrrrrrrrrrr]s  rc@sJeZdZddZddZddZddZd d Zd d d dZddZ dS) SourceLoadercCst)zOptional method that returns the modification time (an int) for the specified path (a str). Raises OSError when the path cannot be handled. )rLrrArrr path_mtime}szSourceLoader.path_mtimecCsd||iS)aOptional method returning a metadata dict for the specified path (a str). Possible keys: - 'mtime' (mandatory) is the numeric timestamp of last source code modification; - 'size' (optional) is the size in bytes of the source code. Implementing this method allows the loader to read bytecode files. Raises OSError when the path cannot be handled. r)rrrrr path_statss zSourceLoader.path_statscCs |||S)zOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. The source path is needed in order to correctly transfer permissions )set_data)rrZ cache_pathr)rrr_cache_bytecodes zSourceLoader._cache_bytecodecCr)zOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. Nr)rrAr)rrrrrzSourceLoader.set_datac CsF||}z ||}Wt|Sty"}ztd|d|d}~ww)z4Concrete implementation of InspectLoader.get_source.z'source not available through get_data()rN)rget_datarLrr)rrrArexcrrr get_sources  zSourceLoader.get_sourcer) _optimizecCstjt||dd|dS)zReturn the code object compiled from source. The 'data' argument can be any object type that compile() supports. rT) dont_inheritrl)rrcompile)rr)rArrrrsource_to_codes zSourceLoader.source_to_codec Cs||}d}d}d}d}d}zt|}Wn ty d}Ynwz||} Wn ty1Ynwt| d}z||} Wn tyHYnhw||d} zGt| || } t| dd} | d@dk}|r| d @dk}t j d kr|swt j d kr||}t t |}t | ||| n t| || d || Wn ttfyYnwtd ||t| |||dS|dur||}|||}td|tjs|dur|dur|r|durt |}t|||} nt||t|} z |||| W|StyY|Sw|S)zConcrete implementation of InspectLoader.get_code. Reading of bytecode requires path_stats to be implemented. To write bytecode, set_data must also be implemented. NFTrrrrrr,ZneverZalwayssizez {} matches {})rrrzcode object from {})rryrkrrLr!rr memoryviewrZcheck_hash_based_pycsr_RAW_MAGIC_NUMBERrrrrrrrrrdont_write_bytecoderrrr)rrrrrrZ hash_basedZ check_sourcerstr)rrZ bytes_dataZ code_objectrrrrs                 zSourceLoader.get_codeN) rrrrrrrrrrrrrrr{s  rcs\eZdZdZddZddZddZefdd Zed d Z d d Z eddZ Z S) FileLoaderzgBase file loader class which implements the loader protocol methods that require file system usage.cCs||_||_dS)zKCache the module name and the path to the file found by the finder.Nr)rrrArrrrs zFileLoader.__init__cC|j|jko |j|jkSrE __class__rrZotherrrr__eq__  zFileLoader.__eq__cCt|jt|jASrEhashrrArrrr__hash__zFileLoader.__hash__cstt||S)zdLoad a module from a file. This method is deprecated. Use exec_module() instead. )superr rrrrrrs zFileLoader.load_modulecC|jSz:Return the path to the source file as found by the finder.rGrrrrr)zFileLoader.get_filenamecCst|ttfr$tt| }|WdS1swYdSt|d }|WdS1s9wYdS)z'Return the data from path as raw bytes.Nr)rrExtensionFileLoaderr[Z open_codermZreadr\)rrAr^rrrr.s$$zFileLoader.get_datacCsddlm}||S)Nr) FileReader)importlib.readersr)rrrrrrget_resource_reader7s zFileLoader.get_resource_reader) rrrrrrrrrrrr!Z __classcell__rrrrr  s  r c@s.eZdZdZddZddZdddd Zd S) SourceFileLoaderz>Concrete implementation of SourceLoader using the file system.cCst|}|j|jdS)z!Return the metadata for the path.)rr)rKst_mtimeZst_size)rrAr rrrrAszSourceFileLoader.path_statscCst|}|j|||dS)N_mode)rr)rrrr)rNrrrrFsz SourceFileLoader._cache_bytecoderWr$c Cst|\}}g}|rt|st|\}}|||rt|rt|D]1}t||}zt|Wq#ty:Yq#tyT}zt d||WYd}~dSd}~wwzt |||t d|WdSty~}zt d||WYd}~dSd}~ww)zWrite bytes data to a file.zcould not create {!r}: {!r}Nz created {!r}) rJrSr=reversedrCrZmkdirFileExistsErrorrLrrr_) rrAr)r%parentrxr?rDrrrrrKs8        zSourceFileLoader.set_dataN)rrrrrrrrrrrr"=s r"c@s eZdZdZddZddZdS)SourcelessFileLoaderz-Loader which handles sourceless file imports.cCsD||}||}||d}t|||tt|dd||dS)Nrr)rr)rrrrr)rrrAr)rrrrrns   zSourcelessFileLoader.get_codecCr)z'Return None as there is no source code.Nrrrrrr~rzSourcelessFileLoader.get_sourceN)rrrrrrrrrrr)js r)c@s\eZdZdZddZddZddZdd Zd d Zd d Z ddZ ddZ e ddZ dS)rz]Loader for extension modules. The constructor is designed to work with FileFinder. cCs||_||_dSrEr)rrrArrrrs zExtensionFileLoader.__init__cCr rEr rrrrrrzExtensionFileLoader.__eq__cCrrErrrrrrrzExtensionFileLoader.__hash__cCs$ttj|}td|j|j|S)z&Create an unitialized extension modulez&extension module {!r} loaded from {!r})rrrZcreate_dynamicrrrA)rrrrrrrsz!ExtensionFileLoader.create_modulecCs$ttj|td|j|jdS)zInitialize an extension modulez(extension module {!r} executed from {!r}N)rrrZ exec_dynamicrrrArrrrrrszExtensionFileLoader.exec_modulecs$t|jdtfddtDS)z1Return True if the extension module is a package.rc3s|] }d|kVqdS)rNrrsuffixZ file_namerrr sz1ExtensionFileLoader.is_package..)rJrAanyrrrr-rrs zExtensionFileLoader.is_packagecCr)z?Return None as an extension module cannot create a code object.NrrrrrrrzExtensionFileLoader.get_codecCr)z5Return None as extension modules have no source code.NrrrrrrrzExtensionFileLoader.get_sourcecCrrrGrrrrrrz ExtensionFileLoader.get_filenameN)rrrrrrrrrrrrrrrrrrrsrc@sleZdZdZdZddZddZddZd d Zd d Z d dZ ddZ ddZ ddZ ddZddZdS)_NamespacePatha&Represents a namespace package's path. It uses the module name to find its parent module, and from there it looks up the parent's __path__. When this changes, the module's own path is recomputed, using path_finder. For top-level modules, the parent module's path is sys.path.rcCs,||_||_t||_|j|_||_dSrE)_name_pathr_get_parent_path_last_parent_path_epoch _last_epoch _path_finderrrrAZ path_finderrrrrs  z_NamespacePath.__init__cCs&|jd\}}}|dkrdS|dfS)z>Returns a tuple of (parent-module-name, parent-path-attr-name)rar )rrAZ__path__)r0rh)rr(dotZmerrr_find_parent_path_namessz&_NamespacePath._find_parent_path_namescCs|\}}ttj||SrE)r9rrmodules)rZparent_module_nameZpath_attr_namerrrr2s z_NamespacePath._get_parent_pathcCsdt|}||jks|j|jkr/||j|}|dur(|jdur(|jr(|j|_ ||_|j|_|j SrE) rr2r3r4r5r6r0rrr1)rZ parent_pathrrrr _recalculates z_NamespacePath._recalculatecC t|SrE)iterr;rrrr__iter__ z_NamespacePath.__iter__cCs ||SrEr;)rindexrrr __getitem__r?z_NamespacePath.__getitem__cCs||j|<dSrE)r1)rrArArrr __setitem__sz_NamespacePath.__setitem__cCr<rE)rr;rrrr__len__r?z_NamespacePath.__len__cC d|jS)Nz_NamespacePath({!r}))rYr1rrrr__repr__r?z_NamespacePath.__repr__cCs ||vSrEr@ritemrrr __contains__r?z_NamespacePath.__contains__cCs|j|dSrE)r1r=rGrrrr=z_NamespacePath.appendN)rrrrr4rr9r2r;r>rBrCrDrFrIr=rrrrr/s  r/c@sXeZdZddZeddZddZddZd d Zd d Z d dZ ddZ ddZ dS)_NamespaceLoadercCst||||_dSrE)r/r1r7rrrrsz_NamespaceLoader.__init__cCstdtd|jS)zsReturn repr for the module. The method is deprecated. The import machinery does the job itself. zR_NamespaceLoader.module_repr() is deprecated and slated for removal in Python 3.12z)rcrdrerYr)rrrr module_reprs z_NamespaceLoader.module_reprcCr)NTrrrrrr z_NamespaceLoader.is_packagecCr)Nr rrrrrrrMz_NamespaceLoader.get_sourcecCstdddddS)Nr zrT)r)rrrrrrrJz_NamespaceLoader.get_codecCrrrrrrrrrz_NamespaceLoader.create_modulecCsdSrErr*rrrrrMz_NamespaceLoader.exec_modulecCstd|jt||S)zbLoad a namespace module. This method is deprecated. Use exec_module() instead. z&namespace module loaded with path {!r})rrr1rrrrrrs z_NamespaceLoader.load_modulecCsddlm}||jS)Nr)NamespaceReader)r rNr1)rrrNrrrr!'s  z$_NamespaceLoader.get_resource_readerN) rrrrrrLrrrrrrr!rrrrrKs   rKc@sveZdZdZeddZeddZeddZedd Z edd d Z edd dZ edddZ eddZ d S) PathFinderz>Meta path finder for sys.path and package __path__ attributes.cCsNttjD]\}}|durtj|=qt|dr|qtjd7_dS)z}Call the invalidate_caches() method on all path entry finders stored in sys.path_importer_caches (where implemented).Ninvalidate_cachesr)listrpath_importer_cacheitemsrrPr/r4)rfinderrrrrP2s  zPathFinder.invalidate_cachesc CsLtjdurtjstdttjD]}z||WSty#YqwdS)z.Search sys.path_hooks for a finder for 'path'.Nzsys.path_hooks is empty)r path_hooksrcrdrr)rAZhookrrr _path_hooks?s   zPathFinder._path_hookscCsd|dkrzt}Wn tyYdSwztj|}W|Sty1||}|tj|<Y|Sw)zGet the finder for the path entry from sys.path_importer_cache. If the path entry is not in the cache, find the appropriate finder and cache it. If no finder is available, store None. r N)rrRFileNotFoundErrorrrRKeyErrorrV)rrArTrrr_path_importer_cacheLs     zPathFinder._path_importer_cachecCst|drt|d}t|t||\}}nt|d}t|t||}g}|dur:t||St |d}||_ |S)Nrz5.find_spec() not found; falling back to find_loader()z5.find_spec() not found; falling back to find_module()) rrZ _object_namercrdrrrrrr)rrrTrrrrrrr_legacy_get_specbs      zPathFinder._legacy_get_specNc Csg}|D]C}t|ttfsq||}|durGt|dr#|||}n|||}|dur.q|jdur7|S|j}|durBt d| |qt |d}||_|S)z?Find the loader or namespace_path for this module/package name.Nrzspec missing loader) rrmbytesrYrrrZrrrrrr) rrrArnamespace_pathZentryrTrrrrr _get_specws*      zPathFinder._get_speccCs^|durtj}||||}|durdS|jdur-|j}|r+d|_t|||j|_|SdS|S)zTry to find a spec for 'fullname' on sys.path or 'path'. The search is based on sys.path_hooks and sys.path_importer_cache. N)rrAr]rrrr/)rrrArrr\rrrrs zPathFinder.find_speccCs*tdt|||}|durdS|jS)zfind the module on sys.path or 'path' based on sys.path_hooks and sys.path_importer_cache. This method is deprecated. Use find_spec() instead. zePathFinder.find_module() is deprecated and slated for removal in Python 3.12; use find_spec() insteadNrrrrrrs zPathFinder.find_modulecOsddlm}|j|i|S)a  Find distributions. Return an iterable of all Distribution instances capable of loading the metadata for packages matching ``context.name`` (or all names if ``None`` indicated) along the paths in the list of directories ``context.path``. r)MetadataPathFinder)Zimportlib.metadatar^find_distributions)rrr^rrrr_s zPathFinder.find_distributionsrEr)rrrrrrPrVrrYrZr]rrr_rrrrrO.s$       rOc@sZeZdZdZddZddZeZddZdd Z dd d Z d dZ e ddZ ddZd S) FileFinderzFile-based finder. Interactions with the file system are cached for performance, being refreshed when the directory the finder is handling has been modified. cspg}|D]\}|fdd|Dq||_|pd|_t|js+tt|j|_d|_t|_ t|_ dS)zInitialize with the path to search on and a variable number of 2-tuples containing the loader and the file suffixes the loader recognizes.c3s|]}|fVqdSrErr+rrrr sz&FileFinder.__init__..rarN) r_loadersrArVrCrrR _path_mtimeset _path_cache_relaxed_path_cache)rrAloader_detailsZloadersrrrarrs    zFileFinder.__init__cCs d|_dS)zInvalidate the directory mtime.rN)rcrrrrrPrQzFileFinder.invalidate_cachescCs6tdt||}|durdgfS|j|jpgfS)zTry to find a loader for the specified module, or the namespace package portions. Returns (loader, list-of-portions). This method is deprecated. Use find_spec() instead. zeFileFinder.find_loader() is deprecated and slated for removal in Python 3.12; use find_spec() insteadN)rcrdrerrr)rrrrrrrs zFileFinder.find_loadercCs|||}t||||dS)Nr)r)rrrrAZsmslrrrrrr]s zFileFinder._get_specNc Cszd}|dd}z t|jptj}Wn ty d}Ynw||jkr-|||_t r8|j }| }n|j }|}||vrlt |j|}|jD]\} } d| } t || } t| rg|| || |g|SqJt|}|jD]7\} } z t |j|| } Wn tyYdSwtjd| dd|| |vrt| r|| || d|Sqo|rtd |t|d} |g| _| SdS) zoTry to find a spec for the specified module. Returns the matching spec, or None if not found. Frar,rrNz trying {})Z verbosityzpossible namespace for {})rhrKrArrRr#rLrc _fill_cacherrfrrerCrbrPr]rSrorrrr)rrrZ is_namespaceZ tail_modulerZcacheZ cache_moduleZ base_pathr,rZ init_filenameZ full_pathrrrrrsV          zFileFinder.find_specc Cs|j}z t|p t}Wntttfyg}Ynwtj ds)t ||_ n%t }|D]}| d\}}}|rCd ||}n|}||q.||_ tj tr^dd|D|_dSdS)zDFill the cache of potential modules and packages for this directory.rrarXcSsh|]}|qSr)r)rZfnrrrr Psz)FileFinder._fill_cache..N)rArZlistdirrRrWPermissionErrorNotADirectoryErrorrrrrdrer~rYraddrrf) rrAZcontentsZlower_suffix_contentsrHrr8r,Znew_namerrrrh3s&    zFileFinder._fill_cachecsfdd}|S)aA class method which returns a closure to use on sys.path_hook which will return an instance using the specified loaders and the path called on the closure. If the path called on the closure is not a directory, ImportError is raised. cs$t|s td|d|gRS)z-Path hook for importlib.machinery.FileFinder.zonly directories are supportedrG)rSrrGrrgrrpath_hook_for_FileFinder\s z6FileFinder.path_hook..path_hook_for_FileFinderr)rrgrmrrlr path_hookRs zFileFinder.path_hookcCrE)NzFileFinder({!r}))rYrArrrrrFdr?zFileFinder.__repr__rE)rrrrrrPrrrr]rrhrrnrFrrrrr`s 3  r`cCs|d}|d}|s!|r|j}n||krt||}nt||}|s*t|||d}z||d<||d<||d<||d<WdStyGYdSw)N __loader____spec__raZ__file__Z __cached__)getrr)r"r Exception)ZnsrZpathnameZ cpathnamerrrrr_fix_up_modulejs$     rscCs&ttf}ttf}ttf}|||gS)z_Returns a list of file-based module loaders. Each item is a tuple (loader, suffixes). )rrextension_suffixesr"rr)rq)Z extensionsZsourceZbytecoderrrrs  rcCs|adSrE)r)_bootstrap_modulerrr_set_bootstrap_modulesrvcCs2t|t}tjtj|gtjt dS)z)Install the path-based import components.N) rvrrrUrr`rn meta_pathr=rO)ruZsupported_loadersrrr_installsrx)rWrE)NNN)rr)T)Urrrr[rrcrrrZntrrZposixr2allr;rr9r>Z_pathseps_with_colonrZ%_CASE_INSENSITIVE_PLATFORMS_BYTES_KEYrrrr$r*r-rCrJrKrOrPrSrVr_type__code__rr"rr!r'rrtrprr=rtrrqZDEBUG_BYTECODE_SUFFIXESZOPTIMIZED_BYTECODE_SUFFIXESryrrrrrrrrrrrrrobjectrrrrrr r"r)rr/rKrOr`rsrrvrxrrrrs            G(  !    IC2-5E1   c@sdZddZdZdZdZdaddZddZiZiZ Gdd d e Z Gd d d Z Gd d d Z GdddZddZddZddZddddZddZddZddZd d!ZGd"d#d#Zddd$d%d&Zd`d'd(Zd)d*d+d,Zd-d.Zd/d0Zd1d2Zd3d4Zd5d6Zd7d8Z Gd9d:d:Z!Gd;d<d<Z"Gd=d>d>Z#d?d@Z$dAdBZ%dadCdDZ&dEdFZ'dGZ(e(dHZ)dIdJZ*e+Z,dKdLZ-dbdNdOZ.d)dPdQdRZ/dSdTZ0dcdVdWZ1dXdYZ2dZd[Z3d\d]Z4d^d_Z5dS)daSCore implementation of import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. cCs&z|jWStyt|jYSwN) __qualname__AttributeErrortype)objr _object_names  rNcCs8dD]}t||rt||t||q|j|jdS)z/Simple substitute for functools.update_wrapper.) __module____name__r__doc__N)hasattrsetattrgetattr__dict__update)ZnewZoldreplacerrr_wrap(s  rcCs tt|Sr)rsysnamerrr _new_module0s rc@s eZdZdS)_DeadlockErrorN)r rrrrrrr=src@s8eZdZdZddZddZddZdd Zd d Zd S) _ModuleLockzA recursive lock implementation which is able to detect deadlocks (e.g. thread 1 trying to take locks A then B, and thread 2 trying to take locks B then A). cCs0t|_t|_||_d|_d|_d|_dSN)_threadZ allocate_locklockwakeuprownercountwaitersselfrrrr__init__Gs   z_ModuleLock.__init__cCsVt}|j}t} t|}|durdS|j}||krdS||vr%dS||q )NTF)r get_identrset _blocking_ongetadd)r!ZmetidZseenrrrr has_deadlockOs  z_ModuleLock.has_deadlockcCst}|t|<zW |j@|jdks|j|kr/||_|jd7_ WdWt|=dS|r9td||j drF|j d7_ Wdn1sPwY|j |j q t|=w)z Acquire the module lock. If a potential deadlock is detected, a _DeadlockError is raised. Otherwise, the lock is always acquired and True is returned. TrNzdeadlock detected by %rF) rr#r%rrrr)rracquirerreleaser!r(rrrr+ds*    z_ModuleLock.acquirecCst}|jG|j|krtd|jdksJ|jd8_|jdkr>d|_|jrF|jd8_|jWddSWddSWddS1sQwYdS)Ncannot release un-acquired lockrr*) rr#rr RuntimeErrorrrrr,r-rrrr,}s    "z_ModuleLock.releasecCd|jt|S)Nz_ModuleLock({!r}) at {}formatridr!rrr__repr__z_ModuleLock.__repr__N) r rrr r"r)r+r,r5rrrrrAs rc@s0eZdZdZddZddZddZdd Zd S) _DummyModuleLockzVA simple _ModuleLock equivalent for Python builds without multi-threading support.cCs||_d|_dSr)rrr rrrr" z_DummyModuleLock.__init__cCs|jd7_dS)Nr*T)rr4rrrr+sz_DummyModuleLock.acquirecCs$|jdkr td|jd8_dS)Nrr.r*)rr/r4rrrr,s z_DummyModuleLock.releasecCr0)Nz_DummyModuleLock({!r}) at {}r1r4rrrr5r6z_DummyModuleLock.__repr__N)r rrr r"r+r,r5rrrrr7s  r7c@s$eZdZddZddZddZdS)_ModuleLockManagercCs||_d|_dSr)_name_lockr rrrr"r8z_ModuleLockManager.__init__cCst|j|_|jdSr)_get_module_lockr:r;r+r4rrr __enter__s z_ModuleLockManager.__enter__cOs|jdSr)r;r,)r!argsZkwargsrrr__exit__sz_ModuleLockManager.__exit__N)r rrr"r=r?rrrrr9s r9cCstz@zt|}Wn tyd}Ynw|dur>tdur%t|}nt|}|fdd}t||t|<Wt |SWt |St w)zGet or create the module lock for a given module name. Acquire/release internally the global import lock to protect _module_locks.NcSsDtzt||urt|=WtdSWtdStwr)_imp acquire_lock _module_locksr& release_lock)refrrrrcbs z_get_module_lock..cb) r@rArBKeyErrorrr7r_weakrefrDrC)rrrErrrr<s&     r<cCs6t|}z|Wn tyYdSw|dS)zAcquires then releases the module lock for a given module name. This is used to ensure a module is completely initialized, in the event it is being imported by another thread. N)r<r+rr,)rrrrr_lock_unlock_modules   rHcOs||i|S)a.remove_importlib_frames in import.c will always remove sequences of importlib frames that end with a call to this function Use it instead of a normal call in places where including the importlib frames introduces unwanted noise into the traceback (e.g. when executing module code) r)fr>Zkwdsrrr_call_with_frames_removedsrJr*) verbositycGs:tjj|kr|dsd|}t|j|tjddSdS)z=Print the message to stderr if -v/PYTHONVERBOSE is turned on.)#zimport z# )ZfileN)rflagsverbose startswithprintr2stderr)messagerKr>rrr_verbose_messages  rScfdd}t||S)z1Decorator to verify the named module is built-in.cs&|tjvrtd||d||S)N{!r} is not a built-in moduler)rbuiltin_module_names ImportErrorr2r!fullnamefxnrr_requires_builtin_wrapper   z4_requires_builtin.._requires_builtin_wrapperr)r[r\rrZr_requires_builtin  r_crT)z/Decorator to verify the named module is frozen.cs&t|std||d||SNz{!r} is not a frozen moduler)r@ is_frozenrWr2rXrZrr_requires_frozen_wrapper r]z2_requires_frozen.._requires_frozen_wrapperr^)r[rcrrZr_requires_frozenr`rdcCsJd}t|tt||}|tjvr!tj|}t||tj|St|S)zLoad the specified module into sys.modules and return it. This method is deprecated. Use loader.exec_module() instead. zgthe load_module() method is deprecated and slated for removal in Python 3.12; use exec_module() instead) _warningswarnDeprecationWarningspec_from_loaderrmodules_exec_load)r!rYmsgspecmodulerrr_load_module_shims      rocCst|dd}t|dd}rt|St|dr'z||WSty&Ynwz|j}Wn ty7d}Ynwz|j}WntyW|durOd|YSd||YSwd||S) z,The implementation of ModuleType.__repr__(). __loader__N__spec__ module_repr? ) r _module_repr_from_specr rr Exceptionr r__file__r2)rnloaderrmrfilenamerrr _module_repr&s,         r|c@sreZdZdZddddddZddZdd Zed d Zej d d Zed dZ eddZ e j ddZ dS) ModuleSpecaThe specification for a module, used for loading. A module's spec is the source for information about the module. For data associated with the module, including source, use the spec's loader. `name` is the absolute name of the module. `loader` is the loader to use when loading the module. `parent` is the name of the package the module is in. The parent is derived from the name. `is_package` determines if the module is considered a package or not. On modules this is reflected by the `__path__` attribute. `origin` is the specific location used by the loader from which to load the module, if that information is available. When filename is set, origin will match. `has_location` indicates that a spec's "origin" reflects a location. When this is True, `__file__` attribute of the module is set. `cached` is the location of the cached bytecode file, if any. It corresponds to the `__cached__` attribute. `submodule_search_locations` is the sequence of path entries to search when importing submodules. If set, is_package should be True--and False otherwise. Packages are simply modules that (may) have submodules. If a spec has a non-None value in `submodule_search_locations`, the import system will consider modules loaded from the spec as packages. Only finders (see importlib.abc.MetaPathFinder and importlib.abc.PathEntryFinder) should modify ModuleSpec instances. N)origin loader_state is_packagecCs6||_||_||_||_|rgnd|_d|_d|_dS)NF)rrzr~rsubmodule_search_locations _set_fileattr_cached)r!rrzr~rrrrrr"es zModuleSpec.__init__cCsfd|jd|jg}|jdur|d|j|jdur(|d|jd|jjd|S)Nz name={!r}z loader={!r}z origin={!r}zsubmodule_search_locations={}z{}({})z, ) r2rrzr~appendr __class__r join)r!r>rrrr5qs    zModuleSpec.__repr__cCsf|j}z$|j|jko&|j|jko&|j|jko&||jko&|j|jko&|j|jkWSty2tYSwr)rrrzr~cached has_locationrNotImplemented)r!ZotherZsmslrrr__eq__{s       zModuleSpec.__eq__cCs:|jdur|jdur|jrtdurtt|j|_|jSr)rr~r_bootstrap_externalNotImplementedErrorZ _get_cachedr4rrrrs zModuleSpec.cachedcCs ||_dSr)r)r!rrrrrs cCs |jdur |jddS|jS)z The name of the module's parent.N.r)rr rpartitionr4rrrparents zModuleSpec.parentcCs|jSr)rr4rrrrszModuleSpec.has_locationcCst||_dSr)boolr)r!valuerrrrs) r rrr r"r5rpropertyrsetterrrrrrrr}@s"$       r}r~rcCst|dr%tdur ttj}|dur|||dS|rgnd}||||dS|durCt|drAz||}Wn ty@d}Ynwd}t||||dS)z5Return a module spec based on various loader methods.Z get_filenameN)rz)rzrrFr)r rrspec_from_file_locationrrWr})rrzr~rrZsearchrrrrhs&     rhcCs&z|j}Wn tyYnw|dur|S|j}|dur+z|j}Wn ty*Ynwz|j}Wn ty;d}Ynw|durW|durUz|j}Wn tyTd}Ynw|}z|j}Wn tygd}Ynwzt|j}Wn tyzd}Ynwt |||d}|durdnd|_ ||_ ||_ |S)Nr~FT) rqrr rpry_ORIGIN __cached__list__path__r}rrr)rnrzr~rmrZlocationrrrrr_spec_from_modulesT           rFoverridecCs|s t|dddurz|j|_Wn tyYnw|s$t|dddurW|j}|durH|jdurHtdur6ttj}| |}|j|_ ||_d|_ z||_ Wn tyVYnw|sat|dddurqz|j |_Wn typYnwz||_Wn tyYnw|st|dddur|jdurz|j|_Wn tyYnw|jr|st|dddurz|j|_ Wn tyYnw|st|dddur|jdurz|j|_W|StyY|Sw|S)Nr rp __package__rryr)r rr rrzrrr_NamespaceLoader__new__Z_pathryrprrrqrrr~rr)rmrnrrzrrrr_init_module_attrssr                   rcCsRd}t|jdr|j|}n t|jdrtd|dur"t|j}t|||S)z+Create a module based on the provided spec.N create_module exec_modulezBloaders that define exec_module() must also define create_module())r rzrrWrrrrmrnrrrmodule_from_spec4s    rcCsd|jdurdn|j}|jdur |jdurd|Sd||jS|jr*d||jSd|j|jS)z&Return the repr to use for the module.Nrsrtrurv)rr~rzr2r)rmrrrrrwEs   rwc Cs|j}t|{tj||urd|}t||dzP|jdur5|jdur-td|jdt ||ddn(t ||ddt |jdsWt |jd}t |t|j|n|j|Wtj|j}|tj|j<ntj|j}|tj|j<wWd|S1swY|S) zFExecute the spec's specified module in an existing module's namespace.zmodule {!r} not in sys.modulesrNmissing loaderTrr7.exec_module() not found; falling back to load_module())rr9rrir&r2rWrzrrr rrerf ImportWarning load_modulerpop)rmrnrrlrrrrjVs2         rjcCsz |j|jWn|jtjvr tj|j}|tj|j<tj|j}|tj|j<t|dddurFz|j|_Wn tyEYnwt|dddurlz|j |_ t |dsa|j dd|_ Wn tykYnwt|dddurz||_ W|StyY|Sw|S)Nrprrrrrq)rzrrrrirr rprr rr rrqrrrr_load_backward_compatibletsB        rc Cs|jdurt|jdst|jd}t|tt|St|}d|_zP|t j |j <z|jdur>|j dur=t d|j dn|j|Wnzt j |j =WtyYYwt j |j }|t j |j <td|j |jWd|_|Sd|_w)NrrTrrzimport {!r} # {!r}F)rzr rrerfrrrZ _initializingrrirrrWrrFrrS)rmrlrnrrr_load_unlockeds<          rcCs6t|j t|WdS1swYdS)zReturn a new module object, loaded by the spec's loader. The module is not added to its parent. If a module is already in sys.modules, that existing module gets clobbered. N)r9rrrmrrrrks $rkc@seZdZdZdZeddZedddZeddd Z ed d Z ed d Z ee ddZ ee ddZee ddZeeZdS)BuiltinImporterzMeta path import for built-in modules. All methods are either class or static methods to avoid the need to instantiate the class. zbuilt-incCs"tdtd|jdtjdS)sReturn repr for the module. The method is deprecated. The import machinery does the job itself. zQBuiltinImporter.module_repr() is deprecated and slated for removal in Python 3.12z)rerfrgr rrrnrrrrrszBuiltinImporter.module_reprNcCs*|durdSt|rt|||jdSdSNr)r@Z is_builtinrhrclsrYpathtargetrrr find_specs  zBuiltinImporter.find_speccCs*tdt|||}|dur|jSdS)zFind the built-in module. If 'path' is ever specified then the search is considered a failure. This method is deprecated. Use find_spec() instead. zjBuiltinImporter.find_module() is deprecated and slated for removal in Python 3.12; use find_spec() insteadN)rerfrgrrz)rrYrrmrrr find_modules   zBuiltinImporter.find_modulecCs.|jtjvrtd|j|jdttj|S)zCreate a built-in modulerUr)rrrVrWr2rJr@Zcreate_builtinrrrrrs   zBuiltinImporter.create_modulecCsttj|dS)zExec a built-in moduleN)rJr@Z exec_builtinrrrrr szBuiltinImporter.exec_modulecCdS)z9Return None as built-in modules do not have code objects.NrrrYrrrget_codezBuiltinImporter.get_codecCr)z8Return None as built-in modules do not have source code.Nrrrrr get_sourcerzBuiltinImporter.get_sourcecCr)z4Return False as built-in modules are never packages.FrrrrrrrzBuiltinImporter.is_packageNNr)r rrr r staticmethodrr classmethodrrrrr_rrrrorrrrrrs.         rc@seZdZdZdZeddZedddZeddd Z ed d Z ed d Z eddZ ee ddZee ddZee ddZdS)FrozenImporterzMeta path import for frozen modules. All methods are either class or static methods to avoid the need to instantiate the class. ZfrozencCstdtd|jtjS)rzPFrozenImporter.module_repr() is deprecated and slated for removal in Python 3.12r)rerfrgr2r rr)mrrrrr/szFrozenImporter.module_reprNcCst|r t|||jdSdSr)r@rbrhrrrrrr:s zFrozenImporter.find_speccCstdtt|r |SdS)z]Find a frozen module. This method is deprecated. Use find_spec() instead. ziFrozenImporter.find_module() is deprecated and slated for removal in Python 3.12; use find_spec() insteadN)rerfrgr@rb)rrYrrrrrAszFrozenImporter.find_modulecCr)z*Use default semantics for module creation.NrrrrrrMszFrozenImporter.create_modulecCs@|jj}t|std||dttj|}t||j dSra) rqrr@rbrWr2rJget_frozen_objectexecr)rnrcoderrrrQs   zFrozenImporter.exec_modulecCs t||S)z_Load a frozen module. This method is deprecated. Use exec_module() instead. )rorrrrrZs zFrozenImporter.load_modulecC t|S)z-Return the code object for the frozen module.)r@rrrrrrd zFrozenImporter.get_codecCr)z6Return None as frozen modules do not have source code.NrrrrrrjrzFrozenImporter.get_sourcecCr)z.Return True if the frozen module is a package.)r@Zis_frozen_packagerrrrrprzFrozenImporter.is_packagerr)r rrr rrrrrrrrrrrdrrrrrrrr$s0         rc@s eZdZdZddZddZdS)_ImportLockContextz$Context manager for the import lock.cC tdS)zAcquire the import lock.N)r@rAr4rrrr=} z_ImportLockContext.__enter__cCr)zYWdqYnw||||}Wdn1sQwY|dur|s|tjvrtj|}z|j } Wn t yx|YSw| dur|S| S|SqdS)zFind a module's spec.Nz5sys.meta_path is None, Python is likely shutting downzsys.meta_path is empty) r meta_pathrWrerfrrirrrrrq) rrrrZ is_reloadrrrmrnrqrrr _find_specsD           rcCsnt|tstdt||dkrtd|dkr)t|ts#td|s)td|s3|dkr5tddSdS)zVerify arguments are "sane".zmodule name must be str, not {}rzlevel must be >= 0z__package__ not set to a stringz6attempted relative import with no known parent packagezEmpty module nameN) isinstancestr TypeErrorr2r ValueErrorrWrrrrrr _sanity_checks   rzNo module named z{!r}c Csd}|dd}|r@|tjvrt|||tjvrtj|Stj|}z|j}Wnty?td||}t||ddwt ||}|durRtt||dt |}|rtj|}|dd}z t |||W|Styd|d|}t |tY|Sw|S)Nrrz; {!r} is not a packagerzCannot set an attribute on z for child module )rrrirJrr_ERR_MSGr2ModuleNotFoundErrorrrr rerfr) rimport_rrZ parent_modulerlrmrnZchildrrr_find_and_load_unlockeds<          rcCst|tj|t}|turt||WdSWdn1s&wY|dur:d|}t||dt||S)zFind and load the module.Nz(import of {} halted; None in sys.modulesr) r9rrir&_NEEDS_LOADINGrr2rrH)rrrnrRrrr_find_and_loads  rrcCs*t||||dkrt|||}t|tS)a2Import and return the module based on its name, the package the call is being made from, and the level adjustment. This function represents the greatest common denominator of functionality between import_module and __import__. This includes setting __package__ if the loader did not. r)rrr _gcd_importrrrrrs   r recursivec Cs|D]h}t|ts |r|jd}nd}td|dt|j|dkr5|s4t|dr4t||j|ddqt||sjd |j|}zt ||Wqt yi}z|j |krdt j |td urdWYd }~qd }~wwq|S) zFigure out what __import__ should return. The import_ parameter is a callable which takes the name of module to import. It is required to decouple the function from assuming importlib's import implementation is desired. z.__all__z ``from list''zItem in z must be str, not *__all__TrrN)rrr rrr _handle_fromlistrr2rJrrrrir&r)rnfromlistrrxZwhereZ from_nameZexcrrrrs6        rcCs|d}|d}|dur)|dur'||jkr'tjd|d|jdtdd|S|dur0|jStjd tdd|d }d |vrG|d d }|S)zCalculate what __package__ should be. __package__ is not guaranteed to be defined or could be set to None to represent that its proper value is unknown. rrqNz __package__ != __spec__.parent (z != ))Z stacklevelzYcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__r rrr)r&rrerfrr)globalsrrmrrr_calc___package__Bs*  rrc Cs|dkr t|}n|dur|ni}t|}t|||}|sJ|dkr*t|ddS|s.|St|t|dd}tj|jdt|j|St|drUt||tS|S)aImport a module. The 'globals' argument is used to infer where the import is occurring from to handle relative imports. The 'locals' argument is ignored. The 'fromlist' argument specifies what should exist as attributes on the module being imported (e.g. ``from module import ``). The 'level' argument represents the package location to import from in a relative import (e.g. ``from ..pkg import mod`` would have a 'level' of 2). rNrr) rr partitionrrrir r r) rrlocalsrrrnZglobals_rZcut_offrrr __import__]s    rcCs&t|}|durtd|t|S)Nzno built-in module named )rrrWr)rrmrrr_builtin_from_names  rc Cs|a|att}tjD]$\}}t||r1|tjvrt}n t|r&t }nq t ||}t ||q tjt }dD]}|tjvrEt |} ntj|} t||| q9dS)zSetup importlib by importing needed built-in modules and injecting them into the global namespace. As sys is needed for sys.modules access and _imp is needed to load built-in modules, those two modules must be explicitly passed in. )rrerGN)r@rrriitemsrrVrrbrrrr rr ) sys_module _imp_moduleZ module_typerrnrzrmZ self_moduleZ builtin_nameZbuiltin_modulerrr_setups(          rcCs&t||tjttjtdS)z0Install importers for builtin and frozen modulesN)rrrrrr)rrrrr_installs  rcCs ddl}|a|tjtdS)z9Install importers that require external filesystem accessrN)_frozen_importlib_externalrrrrir )rrrr_install_external_importerssrrrr)NNrr)6r rrrerGrrrrBr%r/rrr7r9r<rHrJrSr_rdror|r}rhrrrrwrjrrrkrrrrrrrZ_ERR_MSG_PREFIXrrobjectrrrrrrrrrrrrrrsh M%   e -H$-PU  /  % %# xxsubtype is an example module showing how to subtype builtin types from C. test_descr.py in the standard test suite requires it in order to complete. If you don't care about the examples, and don't intend to run the Python test suite, you can recompile Python without Modules/xxsubtype.c.symtable($module, source, filename, startstr, /) -- Return symbol and scope dictionaries used internally by compiler.reset_peak($module, /) -- Set the peak size of memory blocks traced by tracemalloc to the current size. Do nothing if the tracemalloc module is not tracing memory allocations.get_traced_memory($module, /) -- Get the current size and peak size of memory blocks traced by tracemalloc. Returns a tuple: (current: int, peak: int).get_tracemalloc_memory($module, /) -- Get the memory usage in bytes of the tracemalloc module. This memory is used internally to trace memory allocations.get_traceback_limit($module, /) -- Get the maximum number of frames stored in the traceback of a trace. By default, a trace of an allocated memory block only stores the most recent frame: the limit is 1.stop($module, /) -- Stop tracing Python memory allocations. Also clear traces of memory blocks allocated by Python.start($module, nframe=1, /) -- Start tracing Python memory allocations. Also set the maximum number of frames stored in the traceback of a trace to nframe._get_object_traceback($module, obj, /) -- Get the traceback where the Python object obj was allocated. Return a tuple of (filename: str, lineno: int) tuples. Return None if the tracemalloc module is disabled or did not trace the allocation of the object._get_traces($module, /) -- Get traces of all memory blocks allocated by Python. Return a list of (size: int, traceback: tuple) tuples. traceback is a tuple of (filename: str, lineno: int) tuples. Return an empty list if the tracemalloc module is disabled.clear_traces($module, /) -- Clear traces of memory blocks allocated by Python.is_tracing($module, /) -- Return True if the tracemalloc module is tracing Python memory allocations.Debug module to trace memory blocks allocated by Python.tracemalloc_reallocfaulthandler module._PyFaulthandler_Initfaulthandler_fatal_error_threadwritable($self, /) -- Returns True if the IO object can be written.readable($self, /) -- Returns True if the IO object can be read.seekable($self, /) -- Returns True if the IO object can be seeked.write($self, s, /) -- Write string to file. Returns the number of characters written, which is always equal to the length of the string.seek($self, pos, whence=0, /) -- Change stream position. Seek to character offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos must be 0; 2 End of stream - pos must be 0. Returns the new absolute position.truncate($self, pos=None, /) -- Truncate size to pos. The pos argument defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new absolute position.tell($self, /) -- Tell the current file position.readline($self, size=-1, /) -- Read until newline or EOF. Returns an empty string if EOF is hit immediately.read($self, size=-1, /) -- Read at most size characters, returned as a string. If the argument is negative or omitted, read until EOF is reached. Return an empty string at EOF.getvalue($self, /) -- Retrieve the entire contents of the object.close($self, /) -- Close the IO object. Attempting any further operation after the object is closed will raise a ValueError. This method has no effect if the file is already closed.StringIO(initial_value='', newline='\n') -- Text I/O implementation using an in-memory buffer. The initial_value argument sets the value of object. The newline argument is like the one of TextIOWrapper's constructor.Write string to stream. Returns the number of characters written (which is always equal to the length of the string). Read until newline or EOF. Returns an empty string if EOF is hit immediately. Read at most n characters from stream. Read from underlying buffer until we have n characters or we hit EOF. If n is negative or omitted, read until EOF. Separate the underlying buffer from the TextIOBase and return it. After the underlying buffer has been detached, the TextIO is in an unusable state. The error setting of the decoder or encoder. Subclasses should override. Line endings translated so far. Only line endings translated during reading are considered. Subclasses should override. Encoding of the text stream. Subclasses should override. Base class for text I/O. This class provides a character and line based interface to stream I/O. There is no readinto method because Python's character strings are immutable. reset($self, /) -- setstate($self, state, /) -- getstate($self, /) -- decode($self, /, input, final=False) -- IncrementalNewlineDecoder(decoder, translate, errors='strict') -- Codec used when reading a file in universal newlines mode. It wraps another incremental decoder, translating \r\n and \r into \n. It also records the types of newlines encountered. When used with translate=False, it ensures that the newline sequence is returned in one piece. When used with decoder=None, it expects unicode strings as decode input and translates newlines without first invoking an external decoder.truncate($self, pos=None, /) -- tell($self, /) -- seek($self, cookie, whence=0, /) -- isatty($self, /) -- writable($self, /) -- readable($self, /) -- seekable($self, /) -- fileno($self, /) -- close($self, /) -- flush($self, /) -- readline($self, size=-1, /) -- read($self, size=-1, /) -- write($self, text, /) -- reconfigure($self, /, *, encoding=None, errors=None, newline=None, line_buffering=None, write_through=None) -- Reconfigure the text stream with new parameters. This also does an implicit stream flush.detach($self, /) -- TextIOWrapper(buffer, encoding=None, errors=None, newline=None, line_buffering=False, write_through=False) -- Character and line based layer over a BufferedIOBase object, buffer. encoding gives the name of the encoding that the stream will be decoded or encoded with. It defaults to locale.getpreferredencoding(False). errors determines the strictness of encoding and decoding (see help(codecs.Codec) or the documentation for codecs.register) and defaults to "strict". newline controls how line endings are handled. It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If line_buffering is True, a call to flush is implied when a call to write contains a newline character.Write the given buffer to the IO stream. Returns the number of bytes written, which is always the length of b in bytes. Raises BlockingIOError if the buffer is full and the underlying raw stream cannot accept more data at the moment. readinto1($self, buffer, /) -- readinto($self, buffer, /) -- Read and return up to n bytes, with at most one read() call to the underlying raw stream. A short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. Read and return up to n bytes. If the argument is omitted, None, or negative, reads and returns all data until EOF. If the argument is positive, and the underlying raw stream is not 'interactive', multiple raw reads may be issued to satisfy the byte count (unless EOF is reached first). But for interactive raw streams (as well as sockets and pipes), at most one raw read will be issued, and a short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. Returns None if the underlying raw stream was open in non-blocking mode and no data is available at the moment. detach($self, /) -- Disconnect this buffer from its underlying raw stream and return it. After the raw stream has been detached, the buffer is in an unusable state.Base class for buffered IO objects. The main difference with RawIOBase is that the read() method supports omitting the size argument, and does not have a default implementation that defers to readinto(). In addition, read(), readinto() and write() may raise BlockingIOError if the underlying raw stream is in non-blocking mode and not ready; unlike their raw counterparts, they will never return None. A typical implementation should not inherit from a RawIOBase implementation, but wrap one. BufferedReader(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- Create a new buffered reader using the given readable raw IO object.BufferedWriter(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffer for a writeable sequential RawIO object. The constructor creates a BufferedWriter for the given writeable raw stream. If the buffer_size is not given, it defaults to DEFAULT_BUFFER_SIZE.BufferedRWPair(reader, writer, buffer_size=DEFAULT_BUFFER_SIZE, /) -- A buffered reader and writer object together. A buffered reader object and buffered writer object put together to form a sequential IO object that can read and write. This is typically used with a socket or two-way pipe. reader and writer are RawIOBase objects that are readable and writeable respectively. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.write($self, buffer, /) -- peek($self, size=0, /) -- readline($self, size=-1, /) -- readinto1($self, buffer, /) -- readinto($self, buffer, /) -- read1($self, size=-1, /) -- read($self, size=-1, /) -- truncate($self, pos=None, /) -- seek($self, target, whence=0, /) -- BufferedRandom(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffered interface to random access streams. The constructor creates a reader and writer for a seekable stream, raw, given in the first argument. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE._enter_buffered_busytruncate($self, size=None, /) -- Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new size.seek($self, pos, whence=0, /) -- Change stream position. Seek to byte offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos may be negative; 2 End of stream - pos usually negative. Returns the new absolute position.getvalue($self, /) -- Retrieve the entire contents of the BytesIO object.getbuffer($self, /) -- Get a read-write view over the contents of the BytesIO object.read($self, size=-1, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative, read until EOF is reached. Return an empty bytes object at EOF.readlines($self, size=None, /) -- List of bytes objects, each a line from the file. Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned.readline($self, size=-1, /) -- Next line from the file, as a bytes object. Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty bytes object at EOF.readinto($self, buffer, /) -- Read bytes into buffer. Returns number of bytes read (0 for EOF), or None if the object is set not to block and has no data to read.read1($self, size=-1, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative or omitted, read until EOF is reached. Return an empty bytes object at EOF.writelines($self, lines, /) -- Write lines to the file. Note that newlines are not added. lines can be any iterable object producing bytes-like objects. This is equivalent to calling write() for each element.write($self, b, /) -- Write bytes to file. Return the number of bytes written.tell($self, /) -- Current file position, an integer.isatty($self, /) -- Always returns False. BytesIO objects are not connected to a TTY-like device.flush($self, /) -- Does nothing.close($self, /) -- Disable all I/O operations.writable($self, /) -- Returns True if the IO object can be written.seekable($self, /) -- Returns True if the IO object can be seeked.readable($self, /) -- Returns True if the IO object can be read.BytesIO(initial_bytes=b'') -- Buffered I/O implementation using an in-memory bytes buffer.FileIO(file, mode='r', closefd=True, opener=None) -- Open a file. The mode can be 'r' (default), 'w', 'x' or 'a' for reading, writing, exclusive creation or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. A FileExistsError will be raised if it already exists when opened for creating. Opening a file for creating implies writing so this mode behaves in a similar way to 'w'.Add a '+' to the mode to allow simultaneous reading and writing. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling opener with (*name*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).isatty($self, /) -- True if the file is connected to a TTY device.fileno($self, /) -- Return the underlying file descriptor (an integer).writable($self, /) -- True if file was opened in a write mode.readable($self, /) -- True if file was opened in a read mode.seekable($self, /) -- True if file supports random-access.close($self, /) -- Close the file. A closed file cannot be used for further I/O operations. close() may be called more than once without error.truncate($self, size=None, /) -- Truncate the file to at most size bytes and return the truncated size. Size defaults to the current file position, as returned by tell(). The current file position is changed to the value of size.tell($self, /) -- Current file position. Can raise OSError for non seekable files.seek($self, pos, whence=0, /) -- Move to new file position and return the file position. Argument offset is a byte count. Optional argument whence defaults to SEEK_SET or 0 (offset from start of file, offset should be >= 0); other values are SEEK_CUR or 1 (move relative to current position, positive or negative), and SEEK_END or 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). Note that not all file objects are seekable.write($self, b, /) -- Write buffer b to file, return number of bytes written. Only makes one system call, so not all of the data may be written. The number of bytes actually written is returned. In non-blocking mode, returns None if the write would block.readinto($self, buffer, /) -- Same as RawIOBase.readinto().readall($self, /) -- Read all data from the file, returned as bytes. In non-blocking mode, returns as much as is immediately available, or None if no data is available. Return an empty bytes object at EOF.read($self, size=-1, /) -- Read at most size bytes, returned as bytes. Only makes one system call, so less data may be returned than requested. In non-blocking mode, returns None if no data is available. Return an empty bytes object at EOF.writelines($self, lines, /) -- Write a list of lines to stream. Line separators are not added, so it is usual for each of the lines provided to have a line separator at the end.readlines($self, hint=-1, /) -- Return a list of lines from the stream. hint can be specified to control the number of lines read: no more lines will be read if the total size (in bytes/characters) of all lines so far exceeds hint.readline($self, size=-1, /) -- Read and return a line from the stream. If size is specified, at most size bytes will be read. The line terminator is always b'\n' for binary files; for text files, the newlines argument to open can be used to select the line terminator(s) recognized.isatty($self, /) -- Return whether this is an 'interactive' stream. Return False if it can't be determined.fileno($self, /) -- Returns underlying file descriptor if one exists. OSError is raised if the IO object does not use a file descriptor.writable($self, /) -- Return whether object was opened for writing. If False, write() will raise OSError.readable($self, /) -- Return whether object was opened for reading. If False, read() will raise OSError.seekable($self, /) -- Return whether object supports random access. If False, seek(), tell() and truncate() will raise OSError. This method may need to do a test seek().close($self, /) -- Flush and close the IO object. This method has no effect if the file is already closed.flush($self, /) -- Flush write buffers, if applicable. This is not implemented for read-only and non-blocking streams.Truncate file to size bytes. File pointer is left unchanged. Size defaults to the current IO position as reported by tell(). Returns the new size.tell($self, /) -- Return current stream position.Change stream position. Change the stream position to the given byte offset. The offset is interpreted relative to the position indicated by whence. Values for whence are: * 0 -- start of stream (the default); offset should be zero or positive * 1 -- current stream position; offset may be negative * 2 -- end of stream; offset is usually negative Return the new absolute position.The abstract base class for all I/O classes. This class provides dummy implementations for many methods that derived classes can override selectively; the default implementations represent a file that cannot be read, written or seeked. Even though IOBase does not declare read, readinto, or write because their signatures will vary, implementations and clients should consider those methods part of the interface. Also, implementations may raise UnsupportedOperation when operations they do not support are called. The basic type used for binary data read from or written to a file is bytes. Other bytes-like objects are accepted as method arguments too. In some cases (such as readinto), a writable object is required. Text I/O classes work with str data. Note that calling any method (except additional calls to close(), which are ignored) on a closed stream should raise a ValueError. IOBase (and its subclasses) support the iterator protocol, meaning that an IOBase object can be iterated over yielding the lines in a stream. IOBase also supports the :keyword:`with` statement. In this example, fp is closed after the suite of the with statement is complete: with open('spam.txt', 'r') as fp: fp.write('Spam and eggs!') readall($self, /) -- Read until EOF, using multiple read() call.read($self, size=-1, /) -- Base class for raw binary I/O.open_code($module, /, path) -- Opens the provided file with the intent to import the contents. This may perform extra validation beyond open(), but is otherwise interchangeable with calling open(path, 'rb').text_encoding($module, encoding, stacklevel=2, /) -- A helper function to choose the text encoding. When encoding is not None, just return it. Otherwise, return the default text encoding (i.e. "locale"). This function emits an EncodingWarning if encoding is None and sys.flags.warn_default_encoding is true. This can be used in APIs with an encoding=None parameter. However, please consider using encoding="utf-8" for new APIs.open($module, /, file, mode='r', buffering=-1, encoding=None, errors=None, newline=None, closefd=True, opener=None) -- Open file and return a stream. Raise OSError upon failure. file is either a text or byte string giving the name (and the path if the file isn't in the current working directory) of the file to be opened or an integer file descriptor of the file to be wrapped. (If a file descriptor is given, it is closed when the returned I/O object is closed, unless closefd is set to False.) mode is an optional string that specifies the mode in which the file is opened. It defaults to 'r' which means open for reading in text mode. Other common values are 'w' for writing (truncating the file if it already exists), 'x' for creating and writing to a new file, and 'a' for appending (which on some Unix systems, means that all writes append to the end of the file regardless of the current seek position). In text mode, if encoding is not specified the encoding used is platform dependent: locale.getpreferredencoding(False) is called to get the current locale encoding. (For reading and writing raw bytes use binary mode and leave encoding unspecified.) The available modes are: ========= =============================================================== Character Meaning --------- --------------------------------------------------------------- 'r' open for reading (default) 'w' open for writing, truncating the file first 'x' create a new file and open it for writing 'a' open for writing, appending to the end of the file if it exists 'b' binary mode 't' text mode (default) '+' open a disk file for updating (reading and writing) 'U' universal newline mode (deprecated) ========= =============================================================== The default mode is 'rt' (open for reading text). For binary random access, the mode 'w+b' opens and truncates the file to 0 bytes, while 'r+b' opens the file without truncation. The 'x' mode implies 'w' and raises an `FileExistsError` if the file already exists. Python distinguishes between files opened in binary and text modes, even when the underlying operating system doesn't. Files opened in binary mode (appending 'b' to the mode argument) return contents as bytes objects without any decoding. In text mode (the default, or when 't' is appended to the mode argument), the contents of the file are returned as strings, the bytes having been first decoded using a platform-dependent encoding or using the specified encoding if given. 'U' mode is deprecated and will raise an exception in future versions of Python. It has no effect in Python 3. Use newline to control universal newlines mode. buffering is an optional integer used to set the buffering policy. Pass 0 to switch buffering off (only allowed in binary mode), 1 to select line buffering (only usable in text mode), and an integer > 1 to indicate the size of a fixed-size chunk buffer. When no buffering argument is given, the default buffering policy works as follows: * Binary files are buffered in fixed-size chunks; the size of the buffer is chosen using a heuristic trying to determine the underlying device's "block size" and falling back on `io.DEFAULT_BUFFER_SIZE`. On many systems, the buffer will typically be 4096 or 8192 bytes long. * "Interactive" text files (files for which isatty() returns True) use line buffering. Other text files use the policy described above for binary files. encoding is the name of the encoding used to decode or encode the file. This should only be used in text mode. The default encoding is platform dependent, but any encoding supported by Python can be passed. See the codecs module for the list of supported encodings. errors is an optional string that specifies how encoding errors are to be handled---this argument should not be used in binary mode. Pass 'strict' to raise a ValueError exception if there is an encoding error (the default of None has the same effect), or pass 'ignore' to ignore errors. (Note that ignoring encoding errors can lead to data loss.) See the documentation for codecs.register or run 'help(codecs.Codec)' for a list of the permitted encoding error strings. newline controls how universal newlines works (it only applies to text mode). It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If closefd is False, the underlying file descriptor will be kept open when the file is closed. This does not work when a file name is given and must be True in that case. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling *opener* with (*file*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None). open() returns a file object whose type depends on the mode, and through which the standard file operations such as reading and writing are performed. When open() is used to open a file in a text mode ('w', 'r', 'wt', 'rt', etc.), it returns a TextIOWrapper. When used to open a file in a binary mode, the returned class varies: in read binary mode, it returns a BufferedReader; in write binary and append binary modes, it returns a BufferedWriter, and in read/write mode, it returns a BufferedRandom. It is also possible to use a string or bytearray as a file for both reading and writing. For strings StringIO can be used like a file opened in a text mode, and for bytes a BytesIO can be used like a file opened in a binary mode.The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module. At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an OSError if they do not support a given operation. Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files. BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes. Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text. Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments. data: DEFAULT_BUFFER_SIZE An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. _get_locale_encoding($module, /) -- Get the current locale encoding.bind_textdomain_codeset($module, domain, codeset, /) -- Bind the C library's domain to codeset.bindtextdomain($module, domain, dir, /) -- Bind the C library's domain to dir.textdomain($module, domain, /) -- Set the C library's textdmain to domain, returning the new domain.dcgettext($module, domain, msg, category, /) -- Return translation of msg in domain and category.dgettext($module, domain, msg, /) -- dgettext(domain, msg) -> string Return translation of msg in domain.gettext($module, msg, /) -- gettext(msg) -> string Return translation of msg.nl_langinfo($module, key, /) -- Return the value for the locale information associated with key.strxfrm($module, string, /) -- Return a string that can be used as a key for locale-aware comparisons.strcoll($module, os1, os2, /) -- Compares two strings according to the locale.localeconv($module, /) -- Returns numeric and monetary locale-specific parameters.setlocale($module, category, locale=, /) -- Activates/queries locale processing.Support for POSIX locales.locked() -> bool (locked_lock() is an obsolete synonym) Return whether the lock is in the locked state.release() (release_lock() is an obsolete synonym) Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.acquire(blocking=True, timeout=-1) -> bool (acquire_lock() is an obsolete synonym) Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return True once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is interruptible.A lock object is a synchronization primitive. To create a lock, call threading.Lock(). Methods are: acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue._release_save() -> tuple For internal use by `threading.Condition`._acquire_restore(state) -> None For internal use by `threading.Condition`._is_owned() -> bool For internal use by `threading.Condition`.release() Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, and must be locked by the same thread that unlocks it; otherwise a `RuntimeError` is raised. Do note that if the lock was acquire()d several times in a row by the current thread, release() needs to be called as many times for the lock to be available for other threads.acquire(blocking=True) -> bool Lock the lock. `blocking` indicates whether we should wait for the lock to be available or not. If `blocking` is False and another thread holds the lock, the method will return False immediately. If `blocking` is True and another thread holds the lock, the method will wait for the lock to be released, take it and then return True. (note: the blocking operation is interruptible.) In all other cases, the method will return True immediately. Precisely, if the current thread already holds the lock, its internal counter is simply incremented. If nobody holds the lock, the lock is taken and its internal counter initialized to 1.ExceptHookArgs Type used to pass arguments to threading.excepthook.excepthook(exc_type, exc_value, exc_traceback, thread) Handle uncaught Thread.run() exception._set_sentinel() -> lock Set a sentinel lock that will be released when the current thread state is finalized (after it is untied from the interpreter). This is a private API for the threading module.stack_size([size]) -> size Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself. Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32 KiB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4 KiB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information)._count() -> integer Return the number of currently running Python threads, excluding the main thread. The returned number comprises all threads created through `start_new_thread()` as well as `threading.Thread`, and not yet finished. This function is meant for internal and specialized purposes only. In most applications `threading.enumerate()` should be used instead.get_native_id() -> integer Return a non-negative integer identifying the thread as reported by the OS (kernel). This may be used to uniquely identify a particular thread within a system.get_ident() -> integer Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.interrupt_main(signum=signal.SIGINT, /) Simulate the arrival of the given signal in the main thread, where the corresponding signal handler will be executed. If *signum* is omitted, SIGINT is assumed. A subthread can use this function to interrupt the main thread. Note: the default signal handler for SIGINT raises ``KeyboardInterrupt``.exit() (exit_thread() is an obsolete synonym) This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.allocate_lock() -> lock object (allocate() is an obsolete synonym) Create a new lock object. See help(type(threading.Lock())) for information about locks.start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym) Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. This module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.get_clock_info(name: str) -> dict Get information of the specified clock.perf_counter_ns() -> int Performance counter for benchmarking as nanoseconds.perf_counter() -> float Performance counter for benchmarking.thread_time() -> int Thread time for profiling as nanoseconds: sum of the kernel and user-space CPU time.thread_time() -> float Thread time for profiling: sum of the kernel and user-space CPU time.process_time() -> int Process time for profiling as nanoseconds: sum of the kernel and user-space CPU time.process_time() -> float Process time for profiling: sum of the kernel and user-space CPU time.monotonic_ns() -> int Monotonic clock, cannot go backward, as nanoseconds.monotonic() -> float Monotonic clock, cannot go backward.tzset() Initialize, or reinitialize, the local timezone to the value stored in os.environ['TZ']. The TZ environment variable should be specified in standard Unix timezone format as documented in the tzset man page (eg. 'US/Eastern', 'Europe/Amsterdam'). Unknown timezones will silently fall back to UTC. If the TZ environment variable is not set, the local timezone is set to the systems best guess of wallclock time. Changing the TZ environment variable without calling tzset *may* change the local timezone used by methods such as localtime, but this behaviour should not be relied on.strptime(string, format) -> struct_time Parse a string to a time tuple according to a format specification. See the library reference manual for formatting codes (same as strftime()). Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. strftime(format[, tuple]) -> string Convert a time tuple to a string according to a format specification. See the library reference manual for formatting codes. When the time tuple is not present, current time as returned by localtime() is used. Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. mktime(tuple) -> floating point number Convert a time tuple in local time to seconds since the Epoch. Note that mktime(gmtime(0)) will not generally return zero for most time zones; instead the returned value will either be equal to that of the timezone or altzone attributes on the time module.ctime(seconds) -> string Convert a time in seconds since the Epoch to a string in local time. This is equivalent to asctime(localtime(seconds)). When the time tuple is not present, current time as returned by localtime() is used.asctime([tuple]) -> string Convert a time tuple to a string, e.g. 'Sat Jun 06 16:26:11 1998'. When the time tuple is not present, current time as returned by localtime() is used.localtime([seconds]) -> (tm_year,tm_mon,tm_mday,tm_hour,tm_min, tm_sec,tm_wday,tm_yday,tm_isdst) Convert seconds since the Epoch to a time tuple expressing local time. When 'seconds' is not passed in, convert the current time instead.gmtime([seconds]) -> (tm_year, tm_mon, tm_mday, tm_hour, tm_min, tm_sec, tm_wday, tm_yday, tm_isdst) Convert seconds since the Epoch to a time tuple expressing UTC (a.k.a. GMT). When 'seconds' is not passed in, convert the current time instead. If the platform supports the tm_gmtoff and tm_zone, they are available as attributes only.sleep(seconds) Delay execution for a given number of seconds. The argument may be a floating point number for subsecond precision.pthread_getcpuclockid(thread_id) -> int Return the clk_id of a thread's CPU time clock.clock_getres(clk_id) -> floating point number Return the resolution (precision) of the specified clock clk_id.clock_settime_ns(clk_id, time) Set the time of the specified clock clk_id with nanoseconds.clock_settime(clk_id, time) Set the time of the specified clock clk_id.clock_gettime_ns(clk_id) -> int Return the time of the specified clock clk_id as nanoseconds.clock_gettime(clk_id) -> float Return the time of the specified clock clk_id.time_ns() -> int Return the current time in nanoseconds since the Epoch.time() -> floating point number Return the current time in seconds since the Epoch. Fractions of a second may be present if the system clock provides them.This module provides various functions to manipulate time values. There are two standard representations of time. One is the number of seconds since the Epoch, in UTC (a.k.a. GMT). It may be an integer or a floating point number (to represent fractions of seconds). The Epoch is system-defined; on Unix, it is generally January 1st, 1970. The actual value can be retrieved by calling gmtime(0). The other representation is a tuple of 9 integers giving local time. The tuple items are: year (including century, e.g. 1998) month (1-12) day (1-31) hours (0-23) minutes (0-59) seconds (0-59) weekday (0-6, Monday is 0) Julian day (day in the year, 1-366) DST (Daylight Savings Time) flag (-1, 0 or 1) If the DST flag is 0, the time is given in the regular time zone; if it is 1, the time is given in the DST time zone; if it is -1, mktime() should guess based on the date and time. SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecConvert a file's mode to a string of the form '-rwxrwxrwx'Return the portion of the file's mode that describes the file type.Return the portion of the file's mode that can be set by os.chmod().S_ISWHT(mode) -> bool Return True if mode is from a whiteout.S_ISPORT(mode) -> bool Return True if mode is from an event port.S_ISDOOR(mode) -> bool Return True if mode is from a door.S_ISSOCK(mode) -> bool Return True if mode is from a socket.S_ISLNK(mode) -> bool Return True if mode is from a symbolic link.S_ISFIFO(mode) -> bool Return True if mode is from a FIFO (named pipe).S_ISREG(mode) -> bool Return True if mode is from a regular file.S_ISBLK(mode) -> bool Return True if mode is from a block special device file.S_ISCHR(mode) -> bool Return True if mode is from a character special device file.S_ISDIR(mode) -> bool Return True if mode is from a directory.S_IFMT_: file type bits S_IFDIR: directory S_IFCHR: character device S_IFBLK: block device S_IFREG: regular file S_IFIFO: fifo (named pipe) S_IFLNK: symbolic link S_IFSOCK: socket file S_IFDOOR: door S_IFPORT: event port S_IFWHT: whiteout S_ISUID: set UID bit S_ISGID: set GID bit S_ENFMT: file locking enforcement S_ISVTX: sticky bit S_IREAD: Unix V7 synonym for S_IRUSR S_IWRITE: Unix V7 synonym for S_IWUSR S_IEXEC: Unix V7 synonym for S_IXUSR S_IRWXU: mask for owner permissions S_IRUSR: read by owner S_IWUSR: write by owner S_IXUSR: execute by owner S_IRWXG: mask for group permissions S_IRGRP: read by group S_IWGRP: write by group S_IXGRP: execute by group S_IRWXO: mask for others (not in group) permissions S_IROTH: read by others S_IWOTH: write by others S_IXOTH: execute by others UF_NODUMP: do not dump file UF_IMMUTABLE: file may not be changed UF_APPEND: file may only be appended to UF_OPAQUE: directory is opaque when viewed through a union stack UF_NOUNLINK: file may not be renamed or deleted UF_COMPRESSED: OS X: file is hfs-compressed UF_HIDDEN: OS X: file should not be displayed SF_ARCHIVED: file may be archived SF_IMMUTABLE: file may not be changed SF_APPEND: file may only be appended to SF_NOUNLINK: file may not be renamed or deleted SF_SNAPSHOT: file is a snapshot file ST_MODE ST_INO ST_DEV ST_NLINK ST_UID ST_GID ST_SIZE ST_ATIME ST_MTIME ST_CTIME FILE_ATTRIBUTE_*: Windows file attribute constants (only present on Windows) struct_siginfo: Result from sigwaitinfo or sigtimedwait. This object may be accessed either as a tuple of (si_signo, si_code, si_errno, si_pid, si_uid, si_status, si_band), or via the attributes si_signo, si_code, and so on.valid_signals($module, /) -- Return a set of valid signal numbers on this platform. The signal numbers returned by this function can be safely passed to functions like `pthread_sigmask`.sigtimedwait($module, sigset, timeout, /) -- Like sigwaitinfo(), but with a timeout. The timeout is specified in seconds, with floating point numbers allowed.sigwaitinfo($module, sigset, /) -- Wait synchronously until one of the signals in *sigset* is delivered. Returns a struct_siginfo containing information about the signal.sigwait($module, sigset, /) -- Wait for a signal. Suspend execution of the calling thread until the delivery of one of the signals specified in the signal set sigset. The function accepts the signal and returns the signal number.sigpending($module, /) -- Examine pending signals. Returns a set of signal numbers that are pending for delivery to the calling thread.pthread_sigmask($module, how, mask, /) -- Fetch and/or change the signal mask of the calling thread.pthread_kill($module, thread_id, signalnum, /) -- Send a signal to a thread.pidfd_send_signal($module, pidfd, signalnum, siginfo=None, flags=0, /) -- Send a signal to a process referred to by a pid file descriptor.pause($module, /) -- Wait until a signal arrives.siginterrupt($module, signalnum, flag, /) -- Change system call restart behaviour. If flag is False, system calls will be restarted when interrupted by signal sig, else system calls will be interrupted.set_wakeup_fd(fd, *, warn_on_full_buffer=True) -> fd Sets the fd to be written to (with the signal number) when a signal comes in. A library can use this to wakeup select or poll. The previous fd or -1 is returned. The fd must be non-blocking.getsignal($module, signalnum, /) -- Return the current action for the given signal. The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handlerstrsignal($module, signalnum, /) -- Return the system description of the given signal. The return values can be such as "Interrupt", "Segmentation fault", etc. Returns None if the signal is not recognized.raise_signal($module, signalnum, /) -- Send a signal to the executing process.signal($module, signalnum, handler, /) -- Set the action for the given signal. The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.getitimer($module, which, /) -- Returns current value of given itimer.setitimer($module, which, seconds, interval=0.0, /) -- Sets given itimer (one of ITIMER_REAL, ITIMER_VIRTUAL or ITIMER_PROF). The timer will fire after value seconds and after that every interval seconds. The itimer can be cleared by setting seconds to zero. Returns old values as a tuple: (delay, interval).alarm($module, seconds, /) -- Arrange for SIGALRM to arrive after the given number of seconds.default_int_handler($module, signalnum, frame, /) -- The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.This module provides mechanisms to use signal handlers in Python. Functions: alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame._PyOS_InterruptOccurred_ncallbacks() -> int Return the number of registered exit functions._run_exitfuncs() -> None Run all registered exit functions. If a callback raises an exception, it is logged with sys.unraisablehook.unregister(func) -> None Unregister an exit function which was previously registered using atexit.register func - function to be unregistered_clear() -> None Clear the list of previously registered exit functions.register(func, *args, **kwargs) -> func Register a function to be executed upon normal program termination func - function to be called at exit args - optional arguments to pass to func kwargs - optional keyword arguments to pass to func func is returned to facilitate usage as a decorator.allow programmer to define multiple exit functions to be executed upon normal program termination. Two public functions, register and unregister, are defined. _PyAtExit_Initpairwise(iterable, /) -- Return an iterator of overlapping pairs taken from the input iterator. s -> (s0,s1), (s1,s2), (s2, s3), ...groupby(iterable, key=None) -- make an iterator that returns consecutive keys and groups from the iterable iterable Elements to divide into groups according to the key function. key A function for computing the group category for each element. If the key function is not specified or is None, the element itself is used for grouping.teedataobject(iterable, values, next, /) -- Data container common to multiple tee objects._tee(iterable, /) -- Iterator wrapped to make it copyable.cycle(iterable, /) -- Return elements from the iterable until it is exhausted. Then repeat the sequence indefinitely.dropwhile(predicate, iterable, /) -- Drop items from the iterable while predicate(item) is true. Afterwards, return every element until the iterable is exhausted.takewhile(predicate, iterable, /) -- Return successive entries from an iterable as long as the predicate evaluates to true for each entry.starmap(function, iterable, /) -- Return an iterator whose values are returned from the function evaluated with an argument tuple taken from the given sequence.combinations(iterable, r) -- Return successive r-length combinations of elements in the iterable. combinations(range(4), 3) --> (0,1,2), (0,1,3), (0,2,3), (1,2,3)combinations_with_replacement(iterable, r) -- Return successive r-length combinations of elements in the iterable allowing individual elements to have successive repeats. combinations_with_replacement('ABC', 2) --> ('A','A'), ('A','B'), ('A','C'), ('B','B'), ('B','C'), ('C','C')permutations(iterable, r=None) -- Return successive r-length permutations of elements in the iterable. permutations(range(3), 2) --> (0,1), (0,2), (1,0), (1,2), (2,0), (2,1)accumulate(iterable, func=None, *, initial=None) -- Return series of accumulated sums (or other binary function results).compress(data, selectors) -- Return data elements corresponding to true selector elements. Forms a shorter iterator from selected data elements using the selectors to choose the data elements.filterfalse(function, iterable, /) -- Return those items of iterable for which function(item) is false. If function is None, return the items that are false.count(start=0, step=1) -- Return a count object whose .__next__() method returns consecutive values. Equivalent to: def count(firstval=0, step=1): x = firstval while 1: yield x x += stepReturns an independent iterator.islice(iterable, stop) --> islice object islice(iterable, start, stop[, step]) --> islice object Return an iterator whose next() method returns selected values from an iterable. If start is specified, will skip all preceding elements; otherwise, start defaults to zero. Step defaults to one. If specified as another value, step determines how many values are skipped between successive calls. Works like a slice() on a list but returns an iterator.chain(*iterables) --> chain object Return a chain object whose .__next__() method returns elements from the first iterable until it is exhausted, then elements from the next iterable, until all of the iterables are exhausted.from_iterable($type, iterable, /) -- Alternative chain() constructor taking a single iterable argument that evaluates lazily.product(*iterables, repeat=1) --> product object Cartesian product of input iterables. Equivalent to nested for-loops. For example, product(A, B) returns the same as: ((x,y) for x in A for y in B). The leftmost iterators are in the outermost for-loop, so the output tuples cycle in a manner similar to an odometer (with the rightmost element changing on every iteration). To compute the product of an iterable with itself, specify the number of repetitions with the optional repeat keyword argument. For example, product(A, repeat=4) means the same as product(A, A, A, A). product('ab', range(3)) --> ('a',0) ('a',1) ('a',2) ('b',0) ('b',1) ('b',2) product((0,1), (0,1), (0,1)) --> (0,0,0) (0,0,1) (0,1,0) (0,1,1) (1,0,0) ...Returns size in memory, in bytes.Private method returning an estimate of len(list(it)).repeat(object [,times]) -> create an iterator which returns the object for the specified number of times. If not specified, returns the object endlessly.Set state information for unpickling.Return state information for pickling.zip_longest(iter1 [,iter2 [...]], [fillvalue=None]) --> zip_longest object Return a zip_longest object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the longest iterable in the argument sequence is exhausted and then it raises StopIteration. When the shorter iterables are exhausted, the fillvalue is substituted in their place. The fillvalue defaults to None or can be specified by a keyword argument. tee($module, iterable, n=2, /) -- Returns a tuple of n independent iterators.Functional tools for creating and using iterators. Infinite iterators: count(start=0, step=1) --> start, start+step, start+2*step, ... cycle(p) --> p0, p1, ... plast, p0, p1, ... repeat(elem [,n]) --> elem, elem, elem, ... endlessly or up to n times Iterators terminating on the shortest input sequence: accumulate(p[, func]) --> p0, p0+p1, p0+p1+p2 chain(p, q, ...) --> p0, p1, ... plast, q0, q1, ... chain.from_iterable([p, q, ...]) --> p0, p1, ... plast, q0, q1, ... compress(data, selectors) --> (d[0] if s[0]), (d[1] if s[1]), ... dropwhile(pred, seq) --> seq[n], seq[n+1], starting when pred fails groupby(iterable[, keyfunc]) --> sub-iterators grouped by value of keyfunc(v) filterfalse(pred, seq) --> elements of seq where pred(elem) is False islice(seq, [start,] stop [, step]) --> elements from seq[start:stop:step] pairwise(s) --> (s[0],s[1]), (s[1],s[2]), (s[2], s[3]), ... starmap(fun, seq) --> fun(*seq[0]), fun(*seq[1]), ... tee(it, n=2) --> (it1, it2 , ... itn) splits one iterator into n takewhile(pred, seq) --> seq[0], seq[1], until pred fails zip_longest(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ... Combinatoric generators: product(p, q, ... [repeat=1]) --> cartesian product permutations(p[, r]) combinations(p, r) combinations_with_replacement(p, r) Internal state held by ABC machinery._abc_subclasscheck($module, self, subclass, /) -- Internal ABC helper for subclasss checks. Should be never used outside abc module._abc_instancecheck($module, self, instance, /) -- Internal ABC helper for instance checks. Should be never used outside abc module._abc_register($module, self, subclass, /) -- Internal ABC helper for subclasss registration. Should be never used outside abc module._get_dump($module, self, /) -- Internal ABC helper for cache and registry debugging. Return shallow copies of registry, of both caches, and negative cache version. Don't call this function directly, instead use ABC._dump_registry() for a nice repr._reset_caches($module, self, /) -- Internal ABC helper to reset both caches of a given class. Should be only used by refleak.py_reset_registry($module, self, /) -- Internal ABC helper to reset registry of a given class. Should be only used by refleak.py_abc_init($module, self, /) -- Internal ABC helper for class set-up. Should be never used outside abc module.get_cache_token($module, /) -- Returns the current ABC cache token. The token is an opaque object (supporting equality testing) identifying the current version of the ABC cache for virtual subclasses. The token changes with every call to register() on any ABC.Module contains faster C implementation of abc.ABCMetaD.__sizeof__() -- size of D in memory, in bytesRotate the deque n steps to the right (default n=1). If n is negative, rotates left.D.reverse() -- reverse *IN PLACE*D.__reversed__() -- return a reverse iterator over the dequeD.remove(value) -- remove first occurrence of value.Remove and return the leftmost element.Remove and return the rightmost element.D.insert(index, object) -- insert object before indexD.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.Extend the left side of the deque with elements from the iterableExtend the right side of the deque with elements from the iterableD.count(value) -> integer -- return number of occurrences of valueReturn a shallow copy of a deque.Remove all elements from the deque.Add an element to the left side of the deque.Add an element to the right side of the deque.deque([iterable[, maxlen]]) --> deque object A list-like sequence optimized for data accesses near its endpoints.Private method returning an estimate of len(list(it)).Return state information for pickling.D.copy() -> a shallow copy of D.__missing__(key) # Called by __getitem__ for missing key; pseudo-code: if self.default_factory is None: raise KeyError((key,)) self[key] = value = self.default_factory() return value defaultdict(default_factory=None, /, [...]) --> dict with default factory The default factory is called without arguments to produce a new value when a key is not present, in __getitem__ only. A defaultdict compares equal to a dict with the same items. All remaining arguments are treated the same as if they were passed to the dict constructor, including keyword arguments. _count_elements($module, mapping, iterable, /) -- Count elements in the iterable, updating the mappingHigh performance data structures. - deque: ordered collection accessible from endpoints only - defaultdict: dict subclass with a default value factory length_hint($module, obj, default=0, /) -- Return an estimate of the number of items in obj. This is useful for presizing containers when building from an iterable. If the object supports len(), the result will be exact. Otherwise, it may over- or under-estimate by an arbitrary amount. The result will be an integer >= 0._compare_digest($module, a, b, /) -- Return 'a == b'. This function uses an approach designed to prevent timing analysis, making it appropriate for cryptography. a and b must both be of the same type: either str (ASCII only), or any bytes-like object. Note: If a and b are of different lengths, or if an error occurs, a timing attack could theoretically reveal information about the types and lengths of a and b--but not their values.ge($module, a, b, /) -- Same as a >= b.gt($module, a, b, /) -- Same as a > b.le($module, a, b, /) -- Same as a <= b.lt($module, a, b, /) -- Same as a < b.ne($module, a, b, /) -- Same as a != b.eq($module, a, b, /) -- Same as a == b.ipow($module, a, b, /) -- Same as a **= b.pow($module, a, b, /) -- Same as a ** b.delitem($module, a, b, /) -- Same as del a[b].setitem($module, a, b, c, /) -- Same as a[b] = c.getitem($module, a, b, /) -- Same as a[b].iconcat($module, a, b, /) -- Same as a += b, for a and b sequences.concat($module, a, b, /) -- Same as a + b, for a and b sequences.ior($module, a, b, /) -- Same as a |= b.ixor($module, a, b, /) -- Same as a ^= b.iand($module, a, b, /) -- Same as a &= b.irshift($module, a, b, /) -- Same as a >>= b.ilshift($module, a, b, /) -- Same as a <<= b.imod($module, a, b, /) -- Same as a %= b.itruediv($module, a, b, /) -- Same as a /= b.ifloordiv($module, a, b, /) -- Same as a //= b.imatmul($module, a, b, /) -- Same as a @= b.imul($module, a, b, /) -- Same as a *= b.isub($module, a, b, /) -- Same as a -= b.iadd($module, a, b, /) -- Same as a += b.or_($module, a, b, /) -- Same as a | b.xor($module, a, b, /) -- Same as a ^ b.and_($module, a, b, /) -- Same as a & b.not_($module, a, /) -- Same as not a.rshift($module, a, b, /) -- Same as a >> b.lshift($module, a, b, /) -- Same as a << b.invert($module, a, /) -- Same as ~a.inv($module, a, /) -- Same as ~a.abs($module, a, /) -- Same as abs(a).pos($module, a, /) -- Same as +a.neg($module, a, /) -- Same as -a.mod($module, a, b, /) -- Same as a % b.truediv($module, a, b, /) -- Same as a / b.floordiv($module, a, b, /) -- Same as a // b.matmul($module, a, b, /) -- Same as a @ b.mul($module, a, b, /) -- Same as a * b.sub($module, a, b, /) -- Same as a - b.add($module, a, b, /) -- Same as a + b.index($module, a, /) -- Same as a.__index__()is_not($module, a, b, /) -- Same as a is not b.is_($module, a, b, /) -- Same as a is b.countOf($module, a, b, /) -- Return the number of items in a which are, or which equal, b.indexOf($module, a, b, /) -- Return the first index of b in a.contains($module, a, b, /) -- Same as b in a (note reversed operands).truth($module, a, /) -- Return True if a is true, False otherwise.itemgetter(item, ...) --> itemgetter object Return a callable object that fetches the given item(s) from its operand. After f = itemgetter(2), the call f(r) returns r[2]. After g = itemgetter(2, 5, 3), the call g(r) returns (r[2], r[5], r[3])attrgetter(attr, ...) --> attrgetter object Return a callable object that fetches the given attribute(s) from its operand. After f = attrgetter('name'), the call f(r) returns r.name. After g = attrgetter('name', 'date'), the call g(r) returns (r.name, r.date). After h = attrgetter('name.first', 'name.last'), the call h(r) returns (r.name.first, r.name.last).Return state information for picklingmethodcaller(name, ...) --> methodcaller object Return a callable object that calls the given method on its operand. After f = methodcaller('name'), the call f(r) returns r.name(). After g = methodcaller('name', 'date', foo=1), the call g(r) returns r.name('date', foo=1).Operator interface. This module exports a set of functions implemented in C corresponding to the intrinsic operators of Python. For example, operator.add(x, y) is equivalent to the expression x+y. The function names are those used for special methods; variants without leading and trailing '__' are also provided for convenience.partial(func, *args, **keywords) - new function with partial application of the given arguments and keywords. Create a cached callable that wraps another function. user_function: the function being cached maxsize: 0 for no caching None for unlimited cache size n for a bounded cache typed: False cache f(3) and f(3.0) as identical calls True cache f(3) and f(3.0) as distinct calls cache_info_type: namedtuple class with the fields: hits misses currsize maxsize Tools that operate on functions.Convert a cmp= function into a key= function.reduce(function, iterable[, initial]) -> value Apply a function of two arguments cumulatively to the items of a sequence or iterable, from left to right, so as to reduce the iterable to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the iterable in the calculation, and serves as a default when the iterable is empty.proxy(object[, callback]) -- create a proxy object that weakly references 'object'. 'callback', if given, is called with a reference to the proxy when 'object' is about to be finalized.getweakrefs(object) -- return a list of all weak reference objects that point to 'object'._remove_dead_weakref($module, dct, key, /) -- Atomically remove key from dict if it points to a dead weakref.getweakrefcount($module, object, /) -- Return the number of weak references to 'object'.lookup_error($module, name, /) -- lookup_error(errors) -> handler Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name.register_error($module, errors, handler, /) -- Register the specified error handler under the name errors. handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple.readbuffer_encode($module, data, errors=None, /) -- charmap_build($module, map, /) -- charmap_decode($module, data, errors=None, mapping=None, /) -- charmap_encode($module, str, errors=None, mapping=None, /) -- ascii_decode($module, data, errors=None, /) -- ascii_encode($module, str, errors=None, /) -- latin_1_decode($module, data, errors=None, /) -- latin_1_encode($module, str, errors=None, /) -- raw_unicode_escape_decode($module, data, errors=None, final=True, /) -- raw_unicode_escape_encode($module, str, errors=None, /) -- unicode_escape_decode($module, data, errors=None, final=True, /) -- unicode_escape_encode($module, str, errors=None, /) -- utf_32_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_32_be_decode($module, data, errors=None, final=False, /) -- utf_32_le_decode($module, data, errors=None, final=False, /) -- utf_32_decode($module, data, errors=None, final=False, /) -- utf_32_be_encode($module, str, errors=None, /) -- utf_32_le_encode($module, str, errors=None, /) -- utf_32_encode($module, str, errors=None, byteorder=0, /) -- utf_16_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_16_be_decode($module, data, errors=None, final=False, /) -- utf_16_le_decode($module, data, errors=None, final=False, /) -- utf_16_decode($module, data, errors=None, final=False, /) -- utf_16_be_encode($module, str, errors=None, /) -- utf_16_le_encode($module, str, errors=None, /) -- utf_16_encode($module, str, errors=None, byteorder=0, /) -- utf_7_decode($module, data, errors=None, final=False, /) -- utf_7_encode($module, str, errors=None, /) -- utf_8_decode($module, data, errors=None, final=False, /) -- utf_8_encode($module, str, errors=None, /) -- escape_decode($module, data, errors=None, /) -- escape_encode($module, data, errors=None, /) -- decode($module, /, obj, encoding='utf-8', errors='strict') -- Decodes obj using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.encode($module, /, obj, encoding='utf-8', errors='strict') -- Encodes obj using the codec registered for encoding. The default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.lookup($module, encoding, /) -- Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.unregister($module, search_function, /) -- Unregister a codec search function and clear the registry's cache. If the search function is not registered, do nothing.register($module, search_function, /) -- Register a codec search function. Search functions are expected to take one argument, the encoding name in all lower case letters, and either return None, or a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object).__deepcopy__($self, memo, /) -- __copy__($self, /) -- scanner($self, /, string, pos=0, endpos=sys.maxsize) -- finditer($self, /, string, pos=0, endpos=sys.maxsize) -- Return an iterator over all non-overlapping matches for the RE pattern in string. For each match, the iterator returns a match object.split($self, /, string, maxsplit=0) -- Split string by the occurrences of pattern.findall($self, /, string, pos=0, endpos=sys.maxsize) -- Return a list of all non-overlapping matches of pattern in string.subn($self, /, repl, string, count=0) -- Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.sub($self, /, repl, string, count=0) -- Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.search($self, /, string, pos=0, endpos=sys.maxsize) -- Scan through string looking for a match, and return a corresponding match object instance. Return None if no position in the string matches.fullmatch($self, /, string, pos=0, endpos=sys.maxsize) -- Matches against all of the string.match($self, /, string, pos=0, endpos=sys.maxsize) -- Matches zero or more characters at the beginning of the string.Compiled regular expression object.__deepcopy__($self, memo, /) -- __copy__($self, /) -- expand($self, /, template) -- Return the string obtained by doing backslash substitution on the string template, as done by the sub() method.groupdict($self, /, default=None) -- Return a dictionary containing all the named subgroups of the match, keyed by the subgroup name. default Is used for groups that did not participate in the match.groups($self, /, default=None) -- Return a tuple containing all the subgroups of the match, from 1. default Is used for groups that did not participate in the match.span($self, group=0, /) -- For match object m, return the 2-tuple (m.start(group), m.end(group)).end($self, group=0, /) -- Return index of the end of the substring matched by group.start($self, group=0, /) -- Return index of the start of the substring matched by group.group([group1, ...]) -> str or tuple. Return subgroup(s) of the match by indices or names. For 0 returns the entire match.The result of re.match() and re.search(). Match objects always have a boolean value of True.search($self, /) -- match($self, /) -- unicode_tolower($module, character, /) -- ascii_tolower($module, character, /) -- unicode_iscased($module, character, /) -- ascii_iscased($module, character, /) -- getcodesize($module, /) -- compile($module, /, pattern, flags, code, groups, groupindex, indexgroup) -- SRE 2.2.2 Copyright (c) 1997-2002 by Secret Labs AB pwd.struct_passwd: Results from getpw*() routines. This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.This module provides access to the Unix password database. It is available on all Unix versions. Password database entries are reported as 7-tuples containing the following items from the password database (see `'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.getpwall($module, /) -- Return a list of all available password database entries, in arbitrary order. See help(pwd) for more on password database entries.getpwnam($module, name, /) -- Return the password database entry for the given user name. See `help(pwd)` for more on password database entries.getpwuid($module, uidobj, /) -- Return the password database entry for the given numeric user ID. See `help(pwd)` for more on password database entries.This module makes available standard errno system symbols. The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2. The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'. Symbols that are not relevant to the underlying system are not defined. To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.stat_result: Result from stat, fstat, or lstat. This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on. Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only. See os.stat for more information.statvfs_result: Result from statvfs or fstatvfs. This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on. See os.statvfs for more information.waitid_result: Result from waitid. This object may be accessed either as a tuple of (si_pid, si_uid, si_signo, si_status, si_code), or via the attributes si_pid, si_uid, and so on. See os.waitid for more information.uname_result: Result from os.uname(). This object may be accessed either as a tuple of (sysname, nodename, release, version, machine), or via the attributes sysname, nodename, release, version, and machine. See os.uname for more information.sched_param(sched_priority) -- Currently has only one field: sched_priority sched_priority A scheduling parameter.times_result: Result from os.times(). This object may be accessed either as a tuple of (user, system, children_user, children_system, elapsed), or via the attributes user, system, children_user, children_system, and elapsed. See os.times for more information.A tuple of (columns, lines) for holding terminal window size__fspath__($self, /) -- Returns the path for the entry.inode($self, /) -- Return inode of the entry; cached per entry.stat($self, /, *, follow_symlinks=True) -- Return stat_result object for the entry; cached per entry.is_symlink($self, /) -- Return True if the entry is a symbolic link; cached per entry.is_file($self, /, *, follow_symlinks=True) -- Return True if the entry is a file; cached per entry.is_dir($self, /, *, follow_symlinks=True) -- Return True if the entry is a directory; cached per entry.waitstatus_to_exitcode($module, /, status) -- Convert a wait status to an exit code. On Unix: * If WIFEXITED(status) is true, return WEXITSTATUS(status). * If WIFSIGNALED(status) is true, return -WTERMSIG(status). * Otherwise, raise a ValueError. On Windows, return status shifted right by 8 bits. On Unix, if the process is being traced or if waitpid() was called with WUNTRACED option, the caller must first check if WIFSTOPPED(status) is true. This function must not be called if WIFSTOPPED(status) is true.eventfd_write($module, /, fd, value) -- Write eventfd value.eventfd_read($module, /, fd) -- Read eventfd valueeventfd($module, /, initval, flags=EFD_CLOEXEC) -- Creates and returns an event notification file descriptor.memfd_create($module, /, name, flags=MFD_CLOEXEC) -- getrandom($module, /, size, flags=0) -- Obtain a series of random bytes.fspath($module, /, path) -- Return the file system path representation of the object. If the object is str or bytes, then allow it to pass through as-is. If the object defines __fspath__(), then return the result of that method. All other types raise a TypeError.scandir($module, /, path=None) -- Return an iterator of DirEntry objects for given path. path can be specified as either str, bytes, or a path-like object. If path is bytes, the names of yielded DirEntry objects will also be bytes; in all other circumstances they will be str. If path is None, uses the path='.'.set_blocking($module, fd, blocking, /) -- Set the blocking mode of the specified file descriptor. Set the O_NONBLOCK flag if blocking is False, clear the O_NONBLOCK flag otherwise.get_blocking($module, fd, /) -- Get the blocking mode of the file descriptor. Return False if the O_NONBLOCK flag is set, True if the flag is cleared.set_inheritable($module, fd, inheritable, /) -- Set the inheritable flag of the specified file descriptor.get_inheritable($module, fd, /) -- Get the close-on-exe flag of the specified file descriptor.cpu_count($module, /) -- Return the number of CPUs in the system; return None if indeterminable. This number is not equivalent to the number of CPUs the current process can use. The number of usable CPUs can be obtained with ``len(os.sched_getaffinity(0))``get_terminal_size($module, fd=, /) -- Return the size of the terminal window as (columns, lines). The optional argument fd (default standard output) specifies which file descriptor should be queried. If the file descriptor is not connected to a terminal, an OSError is thrown. This function will only be defined if an implementation is available for this system. shutil.get_terminal_size is the high-level function which should normally be used, os.get_terminal_size is the low-level implementation.listxattr($module, /, path=None, *, follow_symlinks=True) -- Return a list of extended attributes on path. path may be either None, a string, a path-like object, or an open file descriptor. if path is None, listxattr will examine the current directory. If follow_symlinks is False, and the last element of the path is a symbolic link, listxattr will examine the symbolic link itself instead of the file the link points to.removexattr($module, /, path, attribute, *, follow_symlinks=True) -- Remove extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, removexattr will modify the symbolic link itself instead of the file the link points to.setxattr($module, /, path, attribute, value, flags=0, *, follow_symlinks=True) -- Set extended attribute attribute on path to value. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, setxattr will modify the symbolic link itself instead of the file the link points to.getxattr($module, /, path, attribute, *, follow_symlinks=True) -- Return the value of extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, getxattr will examine the symbolic link itself instead of the file the link points to.getresgid($module, /) -- Return a tuple of the current process's real, effective, and saved group ids.getresuid($module, /) -- Return a tuple of the current process's real, effective, and saved user ids.setresgid($module, rgid, egid, sgid, /) -- Set the current process's real, effective, and saved group ids.setresuid($module, ruid, euid, suid, /) -- Set the current process's real, effective, and saved user ids.urandom($module, size, /) -- Return a bytes object containing random bytes suitable for cryptographic use.getloadavg($module, /) -- Return average recent system load information. Return the number of processes in the system run queue averaged over the last 1, 5, and 15 minutes as a tuple of three floats. Raises OSError if the load average was unobtainable.abort($module, /) -- Abort the interpreter immediately. This function 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system. This function never returns.pathconf($module, /, path, name) -- Return the configuration limit name for the file or directory path. If there is no limit, return -1. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fpathconf($module, fd, name, /) -- Return the configuration limit name for the file descriptor fd. If there is no limit, return -1.sysconf($module, name, /) -- Return an integer-valued system configuration variable.confstr($module, name, /) -- Return a string-valued system configuration variable.statvfs($module, /, path) -- Perform a statvfs system call on the given path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fstatvfs($module, fd, /) -- Perform an fstatvfs system call on the given fd. Equivalent to statvfs(fd).WSTOPSIG($module, /, status) -- Return the signal that stopped the process that provided the status value.WTERMSIG($module, /, status) -- Return the signal that terminated the process that provided the status value.WEXITSTATUS($module, /, status) -- Return the process return code from status.WIFEXITED($module, /, status) -- Return True if the process returning status exited via the exit() system call.WIFSIGNALED($module, /, status) -- Return True if the process returning status was terminated by a signal.WIFSTOPPED($module, /, status) -- Return True if the process returning status was stopped.WIFCONTINUED($module, /, status) -- Return True if a particular process was continued from a job control stop. Return True if the process returning status was continued from a job control stop.WCOREDUMP($module, status, /) -- Return True if the process returning status was dumped to a core file.fdatasync($module, /, fd) -- Force write of fd to disk without forcing update of metadata.sync($module, /) -- Force write of everything to disk.fsync($module, /, fd) -- Force write of fd to disk.fchdir($module, /, fd) -- Change to the directory of the given file descriptor. fd must be opened on a directory, not a file. Equivalent to os.chdir(fd).strerror($module, code, /) -- Translate an error code to a message string.unsetenv($module, name, /) -- Delete an environment variable.putenv($module, name, value, /) -- Change or add an environment variable.posix_fadvise($module, fd, offset, length, advice, /) -- Announce an intention to access data in a specific pattern. Announce an intention to access data in a specific pattern, thus allowing the kernel to make optimizations. The advice applies to the region of the file specified by fd starting at offset and continuing for length bytes. advice is one of POSIX_FADV_NORMAL, POSIX_FADV_SEQUENTIAL, POSIX_FADV_RANDOM, POSIX_FADV_NOREUSE, POSIX_FADV_WILLNEED, or POSIX_FADV_DONTNEED.posix_fallocate($module, fd, offset, length, /) -- Ensure a file has allocated at least a particular number of bytes on disk. Ensure that the file specified by fd encompasses a range of bytes starting at offset bytes from the beginning and continuing for length bytes.truncate($module, /, path, length) -- Truncate a file, specified by path, to a specific length. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ftruncate($module, fd, length, /) -- Truncate a file, specified by file descriptor, to a specific length.makedev($module, major, minor, /) -- Composes a raw device number from the major and minor device numbers.minor($module, device, /) -- Extracts a device minor number from a raw device number.major($module, device, /) -- Extracts a device major number from a raw device number.mknod($module, /, path, mode=384, device=0, *, dir_fd=None) -- Create a node in the file system. Create a node in the file system (file, device special file or named pipe) at path. mode specifies both the permissions to use and the type of node to be created, being combined (bitwise OR) with one of S_IFREG, S_IFCHR, S_IFBLK, and S_IFIFO. If S_IFCHR or S_IFBLK is set on mode, device defines the newly created device special file (probably using os.makedev()). Otherwise device is ignored. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.mkfifo($module, /, path, mode=438, *, dir_fd=None) -- Create a "fifo" (a POSIX named pipe). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.pipe2($module, flags, /) -- Create a pipe with flags set atomically. Returns a tuple of two file descriptors: (read_fd, write_fd) flags can be constructed by ORing together one or more of these values: O_NONBLOCK, O_CLOEXEC.pipe($module, /) -- Create a pipe. Returns a tuple of two file descriptors: (read_fd, write_fd)isatty($module, fd, /) -- Return True if the fd is connected to a terminal. Return True if the file descriptor is an open file descriptor connected to the slave end of a terminal.fstat($module, /, fd) -- Perform a stat system call on the given file descriptor. Like stat(), but for an open file descriptor. Equivalent to os.stat(fd).sendfile($module, /, out_fd, in_fd, offset, count) -- Copy count bytes from file descriptor in_fd to file descriptor out_fd.pwritev($module, fd, buffers, offset, flags=0, /) -- Writes the contents of bytes-like objects to a file descriptor at a given offset. Combines the functionality of writev() and pwrite(). All buffers must be a sequence of bytes-like objects. Buffers are processed in array order. Entire contents of first buffer is written before proceeding to second, and so on. The operating system may set a limit (sysconf() value SC_IOV_MAX) on the number of buffers that can be used. This function writes the contents of each object to the file descriptor and returns the total number of bytes written. The flags argument contains a bitwise OR of zero or more of the following flags: - RWF_DSYNC - RWF_SYNC - RWF_APPEND Using non-zero flags requires Linux 4.7 or newer.pwrite($module, fd, buffer, offset, /) -- Write bytes to a file descriptor starting at a particular offset. Write buffer to fd, starting at offset bytes from the beginning of the file. Returns the number of bytes writte. Does not change the current file offset.writev($module, fd, buffers, /) -- Iterate over buffers, and write the contents of each to a file descriptor. Returns the total number of bytes written. buffers must be a sequence of bytes-like objects.write($module, fd, data, /) -- Write a bytes object to a file descriptor.preadv($module, fd, buffers, offset, flags=0, /) -- Reads from a file descriptor into a number of mutable bytes-like objects. Combines the functionality of readv() and pread(). As readv(), it will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data. Its fourth argument, specifies the file offset at which the input operation is to be performed. It will return the total number of bytes read (which can be less than the total capacity of all the objects). The flags argument contains a bitwise OR of zero or more of the following flags: - RWF_HIPRI - RWF_NOWAIT Using non-zero flags requires Linux 4.6 or newer.pread($module, fd, length, offset, /) -- Read a number of bytes from a file descriptor starting at a particular offset. Read length bytes from file descriptor fd, starting at offset bytes from the beginning of the file. The file offset remains unchanged.readv($module, fd, buffers, /) -- Read from a file descriptor fd into an iterable of buffers. The buffers should be mutable buffers accepting bytes. readv will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data. readv returns the total number of bytes read, which may be less than the total capacity of all the buffers.read($module, fd, length, /) -- Read from a file descriptor. Returns a bytes object.lseek($module, fd, position, how, /) -- Set the position of a file descriptor. Return the new position. Return the new cursor position in number of bytes relative to the beginning of the file.lockf($module, fd, command, length, /) -- Apply, test or remove a POSIX lock on an open file descriptor. fd An open file descriptor. command One of F_LOCK, F_TLOCK, F_ULOCK or F_TEST. length The number of bytes to lock, starting at the current position.dup2($module, /, fd, fd2, inheritable=True) -- Duplicate file descriptor.dup($module, fd, /) -- Return a duplicate of a file descriptor.device_encoding($module, /, fd) -- Return a string describing the encoding of a terminal's file descriptor. The file descriptor must be attached to a terminal. If the device is not a terminal, return None.closerange($module, fd_low, fd_high, /) -- Closes all file descriptors in [fd_low, fd_high), ignoring errors.close($module, /, fd) -- Close a file descriptor.open($module, /, path, flags, mode=511, *, dir_fd=None) -- Open a file for low level IO. Returns a file descriptor (integer). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.tcsetpgrp($module, fd, pgid, /) -- Set the process group associated with the terminal specified by fd.tcgetpgrp($module, fd, /) -- Return the process group associated with the terminal specified by fd.setpgid($module, pid, pgrp, /) -- Call the system call setpgid(pid, pgrp).setsid($module, /) -- Call the system call setsid().getsid($module, pid, /) -- Call the system call getsid(pid) and return the result.pidfd_open($module, /, pid, flags=0) -- Return a file descriptor referring to the process *pid*. The descriptor can be used to perform process management without races and signals.waitpid($module, pid, options, /) -- Wait for completion of a given child process. Returns a tuple of information regarding the child process: (pid, status) The options argument is ignored on Windows.waitid($module, idtype, id, options, /) -- Returns the result of waiting for a process or processes. idtype Must be one of be P_PID, P_PGID or P_ALL. id The id to wait on. options Constructed from the ORing of one or more of WEXITED, WSTOPPED or WCONTINUED and additionally may be ORed with WNOHANG or WNOWAIT. Returns either waitid_result or None if WNOHANG is specified and there are no children in a waitable state.wait4($module, /, pid, options) -- Wait for completion of a specific child process. Returns a tuple of information about the child process: (pid, status, rusage)wait3($module, /, options) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status, rusage)wait($module, /) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status)setpgrp($module, /) -- Make the current process the leader of its process group.getpgid($module, /, pid) -- Call the system call getpgid(), and return the result.initgroups($module, username, gid, /) -- Initialize the group access list. Call the system initgroups() to initialize the group access list with all of the groups of which the specified username is a member, plus the specified group id.setgroups($module, groups, /) -- Set the groups of the current process to list.setregid($module, rgid, egid, /) -- Set the current process's real and effective group ids.setegid($module, egid, /) -- Set the current process's effective group id.setgid($module, gid, /) -- Set the current process's group id.setreuid($module, ruid, euid, /) -- Set the current process's real and effective user ids.seteuid($module, euid, /) -- Set the current process's effective user id.setuid($module, uid, /) -- Set the current process's user id.killpg($module, pgid, signal, /) -- Kill a process group with a signal.kill($module, pid, signal, /) -- Kill a process with a signal.getlogin($module, /) -- Return the actual login name.getuid($module, /) -- Return the current process's user id.getppid($module, /) -- Return the parent's process id. If the parent process has already exited, Windows machines will still return its id; others systems will return the id of the 'init' process (1).getpgrp($module, /) -- Return the current process group id.getpid($module, /) -- Return the current process id.getgroups($module, /) -- Return list of supplemental group IDs for the process.getgrouplist($module, user, group, /) -- Returns a list of groups to which a user belongs. user username to lookup group base group id of the usergetgid($module, /) -- Return the current process's group id.geteuid($module, /) -- Return the current process's effective user id.getegid($module, /) -- Return the current process's effective group id.forkpty($module, /) -- Fork a new process with a new pseudo-terminal as controlling tty. Returns a tuple of (pid, master_fd). Like fork(), return pid of 0 to the child process, and pid of child to the parent process. To both, return fd of newly opened pseudo-terminal.openpty($module, /) -- Open a pseudo-terminal. Return a tuple of (master_fd, slave_fd) containing open file descriptors for both the master and slave ends.sched_getaffinity($module, pid, /) -- Return the affinity of the process identified by pid (or the current process if zero). The affinity is returned as a set of CPU identifiers.sched_setaffinity($module, pid, mask, /) -- Set the CPU affinity of the process identified by pid to mask. mask should be an iterable of integers identifying CPUs.sched_yield($module, /) -- Voluntarily relinquish the CPU.sched_setscheduler($module, pid, policy, param, /) -- Set the scheduling policy for the process identified by pid. If pid is 0, the calling process is changed. param is an instance of sched_param.sched_setparam($module, pid, param, /) -- Set scheduling parameters for the process identified by pid. If pid is 0, sets parameters for the calling process. param should be an instance of sched_param.sched_rr_get_interval($module, pid, /) -- Return the round-robin quantum for the process identified by pid, in seconds. Value returned is a float.sched_getscheduler($module, pid, /) -- Get the scheduling policy for the process identified by pid. Passing 0 for pid returns the scheduling policy for the calling process.sched_getparam($module, pid, /) -- Returns scheduling parameters for the process identified by pid. If pid is 0, returns parameters for the calling process. Return value is an instance of sched_param.sched_get_priority_min($module, /, policy) -- Get the minimum scheduling priority for policy.sched_get_priority_max($module, /, policy) -- Get the maximum scheduling priority for policy.register_at_fork($module, /, *, before=, after_in_child=, after_in_parent=) -- Register callables to be called when forking a new process. before A callable to be called in the parent before the fork() syscall. after_in_child A callable to be called in the child after fork(). after_in_parent A callable to be called in the parent after fork(). 'before' callbacks are called in reverse order. 'after_in_child' and 'after_in_parent' callbacks are called in order.fork($module, /) -- Fork a child process. Return 0 to child process and PID of child to parent process.execve($module, /, path, argv, env) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings.execv($module, path, argv, /) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings._exit($module, /, status) -- Exit to the system with specified status, without normal exit processing.times($module, /) -- Return a collection containing process timing information. The object returned behaves like a named tuple with these fields: (utime, stime, cutime, cstime, elapsed_time) All fields are floating point numbers.utime($module, /, path, times=None, *, ns=, dir_fd=None, follow_symlinks=True) -- Set the access and modified time of path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If times is not None, it must be a tuple (atime, mtime); atime and mtime should be expressed as float seconds since the epoch. If ns is specified, it must be a tuple (atime_ns, mtime_ns); atime_ns and mtime_ns should be expressed as integer nanoseconds since the epoch. If times is None and ns is unspecified, utime uses the current time. Specifying tuples for both times and ns is an error. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, utime will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be available on your platform. If they are unavailable, using them will raise a NotImplementedError.remove($module, /, path, *, dir_fd=None) -- Remove a file (same as unlink()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.unlink($module, /, path, *, dir_fd=None) -- Remove a file (same as remove()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.uname($module, /) -- Return an object identifying the current operating system. The object behaves like a named tuple with the following fields: (sysname, nodename, release, version, machine)umask($module, mask, /) -- Set the current numeric umask and return the previous umask.system($module, /, command) -- Execute the command in a subshell.symlink($module, /, src, dst, target_is_directory=False, *, dir_fd=None) -- Create a symbolic link pointing to src named dst. target_is_directory is required on Windows if the target is to be interpreted as a directory. (On Windows, symlink requires Windows 6.0 or greater, and raises a NotImplementedError otherwise.) target_is_directory is ignored on non-Windows platforms. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.rmdir($module, /, path, *, dir_fd=None) -- Remove a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.replace($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory, overwriting the destination. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.rename($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.splice($module, /, src, dst, count, offset_src=None, offset_dst=None, flags=0) -- Transfer count bytes from one pipe to a descriptor or vice versa. src Source file descriptor. dst Destination file descriptor. count Number of bytes to copy. offset_src Starting offset in src. offset_dst Starting offset in dst. flags Flags to modify the semantics of the call. If offset_src is None, then src is read from the current position; respectively for offset_dst. The offset associated to the file descriptor that refers to a pipe must be None.copy_file_range($module, /, src, dst, count, offset_src=None, offset_dst=None) -- Copy count bytes from one file descriptor to another. src Source file descriptor. dst Destination file descriptor. count Number of bytes to copy. offset_src Starting offset in src. offset_dst Starting offset in dst. If offset_src is None, then src is read from the current position; respectively for offset_dst.readlink($module, /, path, *, dir_fd=None) -- Return a string representing the path to which the symbolic link points. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.posix_spawnp($module, path, argv, env, /, *, file_actions=(), setpgroup=, resetids=False, setsid=False, setsigmask=(), setsigdef=(), scheduler=) -- Execute the program specified by path in a new process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings. file_actions A sequence of file action tuples. setpgroup The pgroup to use with the POSIX_SPAWN_SETPGROUP flag. resetids If the value is `True` the POSIX_SPAWN_RESETIDS will be activated. setsid If the value is `True` the POSIX_SPAWN_SETSID or POSIX_SPAWN_SETSID_NP will be activated. setsigmask The sigmask to use with the POSIX_SPAWN_SETSIGMASK flag. setsigdef The sigmask to use with the POSIX_SPAWN_SETSIGDEF flag. scheduler A tuple with the scheduler policy (optional) and parameters.posix_spawn($module, path, argv, env, /, *, file_actions=(), setpgroup=, resetids=False, setsid=False, setsigmask=(), setsigdef=(), scheduler=) -- Execute the program specified by path in a new process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings. file_actions A sequence of file action tuples. setpgroup The pgroup to use with the POSIX_SPAWN_SETPGROUP flag. resetids If the value is `true` the POSIX_SPAWN_RESETIDS will be activated. setsid If the value is `true` the POSIX_SPAWN_SETSID or POSIX_SPAWN_SETSID_NP will be activated. setsigmask The sigmask to use with the POSIX_SPAWN_SETSIGMASK flag. setsigdef The sigmask to use with the POSIX_SPAWN_SETSIGDEF flag. scheduler A tuple with the scheduler policy (optional) and parameters.setpriority($module, /, which, who, priority) -- Set program scheduling priority.getpriority($module, /, which, who) -- Return program scheduling priority.nice($module, increment, /) -- Add increment to the priority of process and return the new priority.mkdir($module, /, path, mode=511, *, dir_fd=None) -- Create a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError. The mode argument is ignored on Windows. Where it is used, the current umask value is first masked out.lstat($module, /, path, *, dir_fd=None) -- Perform a stat system call on the given path, without following symbolic links. Like stat(), but do not follow symbolic links. Equivalent to stat(path, follow_symlinks=False).listdir($module, /, path=None) -- Return a list containing the names of the files in the directory. path can be specified as either str, bytes, or a path-like object. If path is bytes, the filenames returned will also be bytes; in all other circumstances the filenames returned will be str. If path is None, uses the path='.'. On some platforms, path may also be specified as an open file descriptor;\ the file descriptor must refer to a directory. If this functionality is unavailable, using it raises NotImplementedError. The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.link($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None, follow_symlinks=True) -- Create a hard link to a file. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. If follow_symlinks is False, and the last element of src is a symbolic link, link will create a link to the symbolic link itself instead of the file the link points to. src_dir_fd, dst_dir_fd, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.getcwdb($module, /) -- Return a bytes string representing the current working directory.getcwd($module, /) -- Return a unicode string representing the current working directory.ctermid($module, /) -- Return the name of the controlling terminal for this process.chroot($module, /, path) -- Change root directory to path.lchown($module, /, path, uid, gid) -- Change the owner and group id of path to the numeric uid and gid. This function will not follow symbolic links. Equivalent to os.chown(path, uid, gid, follow_symlinks=False).fchown($module, /, fd, uid, gid) -- Change the owner and group id of the file specified by file descriptor. Equivalent to os.chown(fd, uid, gid).chown($module, /, path, uid, gid, *, dir_fd=None, follow_symlinks=True) -- Change the owner and group id of path to the numeric uid and gid.\ path Path to be examined; can be string, bytes, a path-like object, or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, chown will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.fchmod($module, /, fd, mode) -- Change the access permissions of the file given by file descriptor fd. Equivalent to os.chmod(fd, mode).chmod($module, /, path, mode, *, dir_fd=None, follow_symlinks=True) -- Change the access permissions of a file. path Path to be modified. May always be specified as a str, bytes, or a path-like object. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. mode Operating-system mode bitfield. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, chmod will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.chdir($module, /, path) -- Change the current working directory to the specified path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ttyname($module, fd, /) -- Return the name of the terminal device connected to 'fd'. fd Integer file descriptor handle.access($module, /, path, mode, *, dir_fd=None, effective_ids=False, follow_symlinks=True) -- Use the real uid/gid to test for access to a path. path Path to be tested; can be string, bytes, or a path-like object. mode Operating-system mode bitfield. Can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. effective_ids If True, access will use the effective uid/gid instead of the real uid/gid. follow_symlinks If False, and the last element of the path is a symbolic link, access will examine the symbolic link itself instead of the file the link points to. dir_fd, effective_ids, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path.stat($module, /, path, *, dir_fd=None, follow_symlinks=True) -- Perform a stat system call on the given path. path Path to be examined; can be string, bytes, a path-like object or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be a relative string; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. It's an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor.This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls.PyOS_AfterFork_ChildPyOS_AfterFork_Parentget_freeze_count($module, /) -- Return the number of objects in the permanent generation.unfreeze($module, /) -- Unfreeze all objects in the permanent generation. Put all objects in the permanent generation back into oldest generation.freeze($module, /) -- Freeze all current tracked objects and ignore them for future collections. This can be used before a POSIX fork() call to make the gc copy-on-write friendly. Note: collection before a POSIX fork() call may free pages for future allocation which can cause copy-on-write.get_referents(*objs) -> list Return the list of objects that are directly referred to by objs.get_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.is_finalized($module, obj, /) -- Returns true if the object has been already finalized by the GC.is_tracked($module, obj, /) -- Returns true if the object is tracked by the garbage collector. Simple atomic objects will return false.get_stats($module, /) -- Return a list of dictionaries containing per-generation statistics.get_objects($module, /, generation=None) -- Return a list of objects tracked by the collector (excluding the list returned). generation Generation to extract the objects from. If generation is not None, return only the objects tracked by the collector that are in that generation.collect($module, /, generation=2) -- Run the garbage collector. With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid. The number of unreachable objects is returned.get_threshold($module, /) -- Return the current collection thresholds.set_threshold(threshold0, [threshold1, threshold2]) -> None Sets the collection thresholds. Setting threshold0 to zero disables collection. get_count($module, /) -- Return a three-tuple of the current collection counts.get_debug($module, /) -- Get the garbage collection debugging flags.set_debug($module, flags, /) -- Set the garbage collection debugging flags. flags An integer that can have the following bits turned on: DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). Debugging information is written to sys.stderr.isenabled($module, /) -- Returns true if automatic garbage collection is enabled.disable($module, /) -- Disable automatic garbage collection.enable($module, /) -- Enable automatic garbage collection.This module provides access to the garbage collector for reference cycles. enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. get_stats() -- Return list of dictionaries containing per-generation stats. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. is_tracked() -- Returns true if a given object is tracked. is_finalized() -- Returns true if a given object has been already finalized. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. freeze() -- Freeze all tracked objects and ignore them for future collections. unfreeze() -- Unfreeze all objects in the permanent generation. get_freeze_count() -- Return the number of objects in the permanent generation. PyObject_GC_Track_PyGC_Initcalculate_prefixsearch_for_prefixismodulecalculate_program_implcalculate_whichcalculate_exec_prefixsearch_for_exec_prefix:calculate_module_search_pathcalculate_pybuilddircalculate_open_pyenvcalculate_argv0_pathresolve_symlinksabsolutizecopy_absolutejoinpathcalculate_zip_pathcalculate_initcalculate_set_prefix/calculate_set_exec_prefix   ؗҜ<3#I9=D2[%Cod(h7yACnF?O8M20HwZstr conversions.get_int_max_str_digits($module, /) -- Return the maximum string digits limit for non-binary int<->str conversions._deactivate_opcache($module, /) -- Deactivate the opcode cache permanentlyunraisablehook($module, unraisable, /) -- Handle an unraisable exception. The unraisable argument has the following attributes: * exc_type: Exception type. * exc_value: Exception value, can be None. * exc_traceback: Exception traceback, can be None. * err_msg: Error message, can be None. * object: Object causing the exception, can be None.get_asyncgen_hooks($module, /) -- Return the installed asynchronous generators hooks. This returns a namedtuple of the form (firstiter, finalizer).set_asyncgen_hooks(* [, firstiter] [, finalizer]) Set a finalizer for async generators objects.get_coroutine_origin_tracking_depth($module, /) -- Check status of origin tracking for coroutine objects in this thread.set_coroutine_origin_tracking_depth($module, /, depth) -- Enable or disable origin tracking for coroutine objects in this thread. Coroutine objects will track 'depth' frames of traceback information about where they came from, available in their cr_origin attribute. Set a depth of 0 to disable._debugmallocstats($module, /) -- Print summary info to stderr about the state of pymalloc's structures. In Py_DEBUG mode, also perform some expensive internal consistency checks.call_tracing($module, func, args, /) -- Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code.gettrace($module, /) -- Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual.settrace(function) Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual.setrecursionlimit($module, limit, /) -- Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.getprofile($module, /) -- Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual.setprofile(function) Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual.setdlopenflags($module, flags, /) -- Set the flags used by the interpreter for dlopen calls. This is used, for example, when the interpreter loads extension modules. Among other things, this will enable a lazy resolving of symbols when importing a module, if called as sys.setdlopenflags(0). To share symbols across extension modules, call as sys.setdlopenflags(os.RTLD_GLOBAL). Symbolic names for the flag modules can be found in the os module (RTLD_xxx constants, e.g. os.RTLD_LAZY).getswitchinterval($module, /) -- Return the current thread switch interval; see sys.setswitchinterval().setswitchinterval($module, interval, /) -- Set the ideal thread switching delay inside the Python interpreter. The actual frequency of switching threads can be lower if the interpreter executes long sequences of uninterruptible code (this is implementation-specific and workload-dependent). The parameter must represent the desired switching delay in seconds A typical value is 0.005 (5 milliseconds).is_finalizing($module, /) -- Return True if Python is exiting.intern($module, string, /) -- ``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value._getframe($module, depth=0, /) -- Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack. This function should be used for internal and specialized purposes only.getsizeof(object [, default]) -> int Return the size of object in bytes.getrecursionlimit($module, /) -- Return the current value of the recursion limit. The recursion limit is the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.getrefcount($module, object, /) -- Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().getfilesystemencodeerrors($module, /) -- Return the error mode used Unicode to OS filename conversion.getfilesystemencoding($module, /) -- Return the encoding used to convert Unicode filenames to OS filenames.getallocatedblocks($module, /) -- Return the number of memory blocks currently allocated.getdlopenflags($module, /) -- Return the current value of the flags that are used for dlopen calls. The flag constants are defined in the os module.getdefaultencoding($module, /) -- Return the current default encoding used by the Unicode implementation.exit($module, status=None, /) -- Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is an integer, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).excepthook($module, exctype, value, traceback, /) -- Handle an exception by displaying it with a traceback on sys.stderr.exc_info($module, /) -- Return current exception information: (type, value, traceback). Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame.displayhook($module, object, /) -- Print an object to sys.stdout and also save it in builtins.__current_exceptions($module, /) -- Return a dict mapping each thread's identifier to its current raised exception. This function should be used for specialized purposes only._current_frames($module, /) -- Return a dict mapping each thread's thread id to its current stack frame. This function should be used for specialized purposes only._clear_type_cache($module, /) -- Clear the internal type lookup cache.breakpointhook(*args, **kws) This hook function is called by built-in breakpoint(). audit(event, *args) Passes the event to any audit hooks that are attached.addaudithook($module, /, hook) -- Adds a new audit hook callback.sys.flags Flags provided through command line arguments or environment vars.sys.version_info Version information as a named tuple.This module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter. Dynamic objects: argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these. stdin -- standard input file object; used by input() stdout -- standard output file object; used by print() stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O. last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are only available in an interactive session after a traceback has been printed. Static objects: builtin_module_names -- tuple of module names built into this interpreter copyright -- copyright notice pertaining to this interpreter exec_prefix -- prefix used to find the machine-specific Python library executable -- absolute path of the executable binary of the Python interpreter float_info -- a named tuple with information about the float implementation. float_repr_style -- string indicating the style of repr() output for floats hash_info -- a named tuple with information about the hash algorithm. hexversion -- version information encoded as a single integer implementation -- Python implementation information. int_info -- a named tuple with information about the int implementation. maxsize -- the largest supported length of containers. maxunicode -- the value of the largest Unicode code point platform -- platform identifier prefix -- prefix used to find the Python library thread_info -- a named tuple with information about the thread implementation. version -- the version of this interpreter as a string version_info -- version information as a named tuple __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch! Functions: displayhook() -- print an object to the screen, and save it in builtins._ excepthook() -- print an exception and its traceback to sys.stderr exc_info() -- return thread-safe information about the current exception exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function PySys_SetArgvExPySys_SetPath_PySys_Createsys_audit_PySys_InitCore_PySys_SetPreliminaryStderr_Py_HashRandomization_Init During handling of the above exception, another exception occurred: The above exception was the direct cause of the following exception: PyGILState_ReleasePyGILState_Ensure_PyGILState_Reinit_PyThread_CurrentExceptionsPyInterpreterState_Delete_PyInterpreterState_DeleteExceptMainPyThreadState_Get_PyThreadState_DeleteCurrentPyState_RemoveModulePyState_AddModule_PyRuntimeState_ReInitThreads_PyGILState_InitPyInterpreterState_Get_PyInterpreterState_Enable_PyThreadState_Delete_PyGILState_NoteThreadState_register_builtins_for_crossinterpreter_datatstate_delete_common_PyRuntimeState_Init_implPy_EndInterpreterPy_InitializeFromConfig_Py_PreInitializeFromPyArgvPython detected LC_CTYPE=C: LC_CTYPE coerced to %.20s (set another locale or PYTHONCOERCECLOCALE=0 to disable this locale coercion behavior). pyinit_mainnew_interpreterinit_interp_mainadd_main_moduleinit_set_builtins_openinit_sys_streamsinit_importlib_externalinit_import_sitepycore_interp_initpycore_init_builtinspycore_init_typespycore_init_singletonspycore_create_interpreterpycore_init_runtimepyinit_core_reconfigurepyinit_main_reconfigure  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~_PyPreConfig_Write_PyPreConfig_Readpreconfig_init_utf8_modepreconfig_init_allocator_PyArgv_AsWstrList_Py_FindEnvConfigValue_Py_SetProgramFullPathPy_SetProgramNamePy_SetPythonHomePy_SetPath_PyConfig_InitPathConfigconfig_init_pathconfigpathconfig_copypathconfig_set_from_configconfig_init_module_search_pathsUUUUUUUU?33333333*$I$I$qqqE]tEUUUUUUU;;I$I$I8885P^Cy 0 0 0 袋. ,d! p= ףp= ؉؉ %^B{ $I$I$ =B!B|PuPuPqq@(  loads($module, bytes, /) -- Convert the bytes-like object to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra bytes in the input are ignored.dumps($module, value, version=version, /) -- Return the bytes object that would be written to a file by dump(value, file). value Must be a supported type. version Indicates the data format that dumps should use. Raise a ValueError exception if value has (or contains an object that has) an unsupported type.load($module, file, /) -- Read one value from the open file and return it. file Must be readable binary file. If no valid value is read (e.g. because the data has a different Python version's incompatible marshal format), raise EOFError, ValueError or TypeError. Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type.dump($module, value, file, version=version, /) -- Write the value on the open file. value Must be a supported type. file Must be a writeable binary file. version Indicates the data format that dump should use. If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised - but garbage data will also be written to the file. The object will not be properly read back by load().This module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues. Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, floating point numbers, strings, bytes, bytearrays, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops). Variables: version -- indicates the format that the module uses. Version 0 is the historical format, version 1 shares interned strings and version 2 uses a binary format for floating point numbers. Version 3 shares common object references (New in version 3.4). Functions: dump() -- write value to a file load() -- read value from a file dumps() -- marshal value as a bytes object loads() -- read value from a bytes-like object_PyConfig_ReadPyConfig_SetWideStringList_PyConfig_Write_PyConfig_Copyconfig_init_stdio_encodingconfig_init_program_nameconfig_parse_cmdlinePyConfig_SetStringconfig_update_argvPyWideStringList_Insertcore_read_precmdline_PyErr_SetFromPyStatusconfig_get_locale_encodingconfig_init_pycache_prefixconfig_run_filename_abspathconfig_init_tracemallocconfig_init_int_max_str_digitsconfig_init_hash_seedPYTHONHASHSEED: if this variable is set to 'random', a random value is used to seed the hashes of str and bytes objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. PYTHONINTMAXSTRDIGITS: limits the maximum digit characters in an int value when converting from a string and when converting an int back to a str. A value of 0 disables the limit. Conversions to or from bases 2, 4, 8, 16, and 32 are never limited. PYTHONMALLOC: set the Python memory allocators and/or install debug hooks on Python memory allocators. Use PYTHONMALLOC=debug to install debug hooks. PYTHONCOERCECLOCALE: if this variable is set to 0, it disables the locale coercion behavior. Use PYTHONCOERCECLOCALE=warn to request display of locale coercion and locale compatibility warnings on stderr. PYTHONBREAKPOINT: if this variable is set to 0, it disables the default debugger. It can be set to the callable of your debugger of choice. PYTHONDEVMODE: enable the development mode. PYTHONPYCACHEPREFIX: root directory for bytecode cache (pyc) files. PYTHONWARNDEFAULTENCODING: enable opt-in EncodingWarning for 'encoding=None'. PYTHONHOME : alternate directory (or %lc). The default module search path uses %s. PYTHONPLATLIBDIR : override sys.platlibdir. PYTHONCASEOK : ignore case in 'import' statements (Windows). PYTHONUTF8: if set to 1, enable the UTF-8 mode. PYTHONIOENCODING: Encoding[:errors] used for stdin/stdout/stderr. PYTHONFAULTHANDLER: dump the Python traceback on fatal errors. file : program read from script file - : program read from stdin (default; interactive mode if a tty) arg ...: arguments passed to program in sys.argv[1:] Other environment variables: PYTHONSTARTUP: file executed on interactive startup (no default) PYTHONPATH : '%lc'-separated list of directories prefixed to the default module search path. The result is sys.path. -u : force the stdout and stderr streams to be unbuffered; this option has no effect on stdin; also PYTHONUNBUFFERED=x -v : verbose (trace import statements); also PYTHONVERBOSE=x can be supplied multiple times to increase verbosity -V : print the Python version number and exit (also --version) when given twice, print more information about the build -W arg : warning control; arg is action:message:category:module:lineno also PYTHONWARNINGS=arg -x : skip first line of source, allowing use of non-Unix forms of #!cmd -X opt : set implementation-specific option. The following options are available: -X faulthandler: enable faulthandler -X showrefcount: output the total reference count and number of used memory blocks when the program finishes or after each statement in the interactive interpreter. This only works on debug builds -X tracemalloc: start tracing Python memory allocations using the tracemalloc module. By default, only the most recent frame is stored in a traceback of a trace. Use -X tracemalloc=NFRAME to start tracing with a traceback limit of NFRAME frames -X importtime: show how long each import takes. It shows module name, cumulative time (including nested imports) and self time (excluding nested imports). Note that its output may be broken in multi-threaded application. Typical usage is python3 -X importtime -c 'import asyncio' -X dev: enable CPython's "development mode", introducing additional runtime checks which are too expensive to be enabled by default. Effect of the developer mode: * Add default warning filter, as -W default * Install debug hooks on memory allocators: see the PyMem_SetupDebugHooks() C function * Enable the faulthandler module to dump the Python traceback on a crash * Enable asyncio debug mode * Set the dev_mode attribute of sys.flags to True * io.IOBase destructor logs close() exceptions -X utf8: enable UTF-8 mode for operating system interfaces, overriding the default locale-aware mode. -X utf8=0 explicitly disables UTF-8 mode (even when it would otherwise activate automatically) -X pycache_prefix=PATH: enable writing .pyc files to a parallel tree rooted at the given directory instead of to the code tree -X warn_default_encoding: enable opt-in EncodingWarning for 'encoding=None' -X int_max_str_digits=number: limit the size of int<->str conversions. This helps avoid denial of service attacks when parsing untrusted data. The default is sys.int_info.default_max_str_digits. 0 disables. --check-hash-based-pycs always|default|never: control how Python invalidates hash-based .pyc files -i : inspect interactively after running script; forces a prompt even if stdin does not appear to be a terminal; also PYTHONINSPECT=x -I : isolate Python from the user's environment (implies -E and -s) -m mod : run library module as a script (terminates option list) -O : remove assert and __debug__-dependent statements; add .opt-1 before .pyc extension; also PYTHONOPTIMIZE=x -OO : do -O changes and also discard docstrings; add .opt-2 before .pyc extension -q : don't print version and copyright messages on interactive startup -s : don't add user site directory to sys.path; also PYTHONNOUSERSITE -S : don't imply 'import site' on initialization Options and arguments (and corresponding environment variables): -b : issue warnings about str(bytes_instance), str(bytearray_instance) and comparing bytes/bytearray with str. (-bb: issue errors) -B : don't write .pyc files on import; also PYTHONDONTWRITEBYTECODE=x -c cmd : program passed in as string (terminates option list) -d : turn on parser debugging output (for experts only, only works on debug builds); also PYTHONDEBUG=x -E : ignore PYTHON* environment variables (such as PYTHONPATH) -h : print this help message and exit (also -? or --help) usage: %ls [option] ... [-c cmd | -m mod | file | -] [arg] ... config_set_bytes_stringsource_hash($module, /, key, source) -- _fix_co_filename($module, code, path, /) -- Changes code.co_filename to specify the passed-in file path. code Code object to change. path File path to use.exec_builtin($module, mod, /) -- Initialize a built-in module.exec_dynamic($module, mod, /) -- Initialize an extension module.create_dynamic($module, spec, file=, /) -- Create an extension module.is_frozen($module, name, /) -- Returns True if the module name corresponds to a frozen module.is_builtin($module, name, /) -- Returns True if the module name corresponds to a built-in module.init_frozen($module, name, /) -- Initializes a frozen module.create_builtin($module, spec, /) -- Create an extension module.is_frozen_package($module, name, /) -- Returns True if the module name is of a frozen package.get_frozen_object($module, name, /) -- Create a code object for a frozen module.release_lock($module, /) -- Release the interpreter's import lock. On platforms without threads, this function does nothing.acquire_lock($module, /) -- Acquires the interpreter's import lock for the current thread. This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.lock_held($module, /) -- Return True if the import lock is currently held, else False. On platforms without threads, return False.extension_suffixes($module, /) -- Returns the list of file suffixes used to identify extension modules.(Extremely) low-level import machinery bits as used by importlib and imp._PyImportZip_InitPyImport_ExecCodeModuleWithPathnames_PyImport_ReInitLockPyImport_GetModuleDictCopyright (c) 2001-2023 Python Software Foundation. All Rights Reserved. Copyright (c) 2000 BeOpen.com. All Rights Reserved. Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved. Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved.vgetargs1_implPy_FrozenMainUnraisableHookArgs Type used to pass arguments to sys.unraisablehook._PyErr_WriteUnraisableMsg_PyErr_NormalizeException_PyErr_InitTypes_PyErr_NoMemorycopy($self, /) -- Return a shallow copy of the context object.values($self, /) -- Return a list of all variables' values in the context object.keys($self, /) -- Return a list of all variables in the context object.items($self, /) -- Return all variables and their values in the context object. The result is returned as a list of 2-tuples (variable, value).get($self, key, default=None, /) -- Return the value for `key` if `key` has the value in the context object. If `key` does not exist, return `default`. If `default` is not given, return None.reset($self, token, /) -- Reset the context variable. The variable is reset to the value it had before the `ContextVar.set()` that created the token was used.set($self, value, /) -- Call to set a new value for the context variable in the current context. The required value argument is the new value for the context variable. Returns a Token object that can be used to restore the variable to its previous value via the `ContextVar.reset()` method.get($self, default=, /) -- Return a value for the context variable for the current context. If there is no value for the variable in the current context, the method will: * return the value of the default argument of the method, if provided; or * return the default value for the context variable, if it was created with one; or * raise a LookupError.<= >?BA@789;CKLONM_PyEval_EvalFrameDefault_Py_CheckRecursiveCall_PyEval_ReInitThreadsPyEval_ReleaseThreadPyEval_AcquireLockPyEval_RestoreThreadPyEval_SaveThreadPyEval_AcquireThreadeval_frame_handle_pendingdestroy_giltake_gildrop_gilcreate_gilfilter(function or None, iterable) --> filter object Return an iterator yielding those items of iterable for which function(item) is true. If function is None, return the items that are true.map(func, *iterables) --> map object Make an iterator that computes the function using arguments from each of the iterables. Stops when the shortest iterable is exhausted.Set state information for unpickling.Return state information for pickling.zip(*iterables, strict=False) --> Yield tuples until an input is exhausted. >>> list(zip('abcdefg', range(3), range(4))) [('a', 0, 0), ('b', 1, 1), ('c', 2, 2)] The zip object yields n-length tuples, where n is the number of iterables passed as positional arguments to zip(). The i-th element in every tuple comes from the i-th iterable argument to zip(). This continues until the shortest argument is exhausted. If strict is true and one of the arguments is exhausted before the others, raise a ValueError.vars([object]) -> dictionary Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.sum($module, iterable, /, start=0) -- Return the sum of a 'start' value (default: 0) plus an iterable of numbers When the iterable is empty, return the start value. This function is intended specifically for use with numeric values and may reject non-numeric types.sorted($module, iterable, /, *, key=None, reverse=False) -- Return a new list containing all items from the iterable in ascending order. A custom key function can be supplied to customize the sort order, and the reverse flag can be set to request the result in descending order.setattr($module, obj, name, value, /) -- Sets the named attribute on the given object to the specified value. setattr(x, 'y', v) is equivalent to ``x.y = v''round($module, /, number, ndigits=None) -- Round a number to a given precision in decimal digits. The return value is an integer if ndigits is omitted or None. Otherwise the return value has the same type as the number. ndigits may be negative.repr($module, obj, /) -- Return the canonical string representation of the object. For many object types, including most builtins, eval(repr(obj)) == obj.print(value, ..., sep=' ', end='\n', file=sys.stdout, flush=False) Prints the values to a stream, or to sys.stdout by default. Optional keyword arguments: file: a file-like object (stream); defaults to the current sys.stdout. sep: string inserted between values, default a space. end: string appended after the last value, default a newline. flush: whether to forcibly flush the stream.pow($module, /, base, exp, mod=None) -- Equivalent to base**exp with 2 arguments or base**exp % mod with 3 arguments Some types, such as ints, are able to use a more efficient algorithm when invoked using the three argument form.ord($module, c, /) -- Return the Unicode code point for a one-character string.oct($module, number, /) -- Return the octal representation of an integer. >>> oct(342391) '0o1234567'anext($module, aiterator, default=, /) -- Return the next item from the async iterator.next(iterator[, default]) Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.min(iterable, *[, default=obj, key=func]) -> value min(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its smallest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the smallest argument.max(iterable, *[, default=obj, key=func]) -> value max(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its biggest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the largest argument.locals($module, /) -- Return a dictionary containing the current scope's local variables. NOTE: Whether or not updates to this dictionary will affect name lookups in the local scope and vice-versa is *implementation dependent* and not covered by any backwards compatibility guarantees.len($module, obj, /) -- Return the number of items in a container.aiter($module, async_iterable, /) -- Return an AsyncIterator for an AsyncIterable object.iter(iterable) -> iterator iter(callable, sentinel) -> iterator Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.issubclass($module, cls, class_or_tuple, /) -- Return whether 'cls' is derived from another class or is the same class. A tuple, as in ``issubclass(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``issubclass(x, A) or issubclass(x, B) or ...``.isinstance($module, obj, class_or_tuple, /) -- Return whether an object is an instance of a class or of a subclass thereof. A tuple, as in ``isinstance(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``isinstance(x, A) or isinstance(x, B) or ...`` etc.input($module, prompt='', /) -- Read a string from standard input. The trailing newline is stripped. The prompt string, if given, is printed to standard output without a trailing newline before reading input. If the user hits EOF (*nix: Ctrl-D, Windows: Ctrl-Z+Return), raise EOFError. On *nix systems, readline is used if available.id($module, obj, /) -- Return the identity of an object. This is guaranteed to be unique among simultaneously existing objects. (CPython uses the object's memory address.)hex($module, number, /) -- Return the hexadecimal representation of an integer. >>> hex(12648430) '0xc0ffee'hash($module, obj, /) -- Return the hash value for the given object. Two objects that compare equal must also have the same hash value, but the reverse is not necessarily true.hasattr($module, obj, name, /) -- Return whether the object has an attribute with the given name. This is done by calling getattr(obj, name) and catching AttributeError.globals($module, /) -- Return the dictionary containing the current scope's global variables. NOTE: Updates to this dictionary *will* affect name lookups in the current global scope and vice-versa.getattr(object, name[, default]) -> value Get a named attribute from an object; getattr(x, 'y') is equivalent to x.y. When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.format($module, value, format_spec='', /) -- Return value.__format__(format_spec) format_spec defaults to the empty string. See the Format Specification Mini-Language section of help('FORMATTING') for details.exec($module, source, globals=None, locals=None, /) -- Execute the given source in the context of globals and locals. The source may be a string representing one or more Python statements or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.eval($module, source, globals=None, locals=None, /) -- Evaluate the given source in the context of globals and locals. The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.divmod($module, x, y, /) -- Return the tuple (x//y, x%y). Invariant: div*y + mod == x.dir([object]) -> list of strings If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.delattr($module, obj, name, /) -- Deletes the named attribute from the given object. delattr(x, 'y') is equivalent to ``del x.y''compile($module, /, source, filename, mode, flags=0, dont_inherit=False, optimize=-1, *, _feature_version=-1) -- Compile source into a code object that can be executed by exec() or eval(). The source code may represent a Python module, statement or expression. The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if true, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or false these statements do influence the compilation, in addition to any features explicitly specified.chr($module, i, /) -- Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.callable($module, obj, /) -- Return whether the object is callable (i.e., some kind of function). Note that classes are callable, as are instances of classes with a __call__() method.breakpoint(*args, **kws) Call sys.breakpointhook(*args, **kws). sys.breakpointhook() must accept whatever arguments are passed. By default, this drops you into the pdb debugger.bin($module, number, /) -- Return the binary representation of an integer. >>> bin(2796202) '0b1010101010101010101010'ascii($module, obj, /) -- Return an ASCII-only representation of an object. As repr(), return a string containing a printable representation of an object, but escape the non-ASCII characters in the string returned by repr() using \\x, \\u or \\U escapes. This generates a string similar to that returned by repr() in Python 2.any($module, iterable, /) -- Return True if bool(x) is True for any x in the iterable. If the iterable is empty, return False.all($module, iterable, /) -- Return True if bool(x) is True for all values x in the iterable. If the iterable is empty, return True.abs($module, x, /) -- Return the absolute value of the argument.__import__(name, globals=None, locals=None, fromlist=(), level=0) -> module Import a module. Because this function is meant for use by the Python interpreter and not for general use, it is better to use importlib.import_module() to programmatically import a module. The globals argument is only used to determine the context; they are not modified. The locals argument is unused. The fromlist should be a list of names to emulate ``from name import ...'', or an empty list to emulate ``import name''. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. The level argument is used to determine whether to perform absolute or relative imports: 0 is absolute, while a positive number is the number of parent directories to search relative to the current module.__build_class__(func, name, /, *bases, [metaclass], **kwds) -> class Internal helper function used by the class statement.Built-in functions, exceptions, and other objects. Noteworthy: None is the `nil' object; Ellipsis represents `...' in slices.Low-level interface to warnings functionality.warn($module, /, message, category=None, stacklevel=1, source=None) -- Issue a warning, or maybe ignore it or raise an exception._warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up.ssSSSsi0InNsSj J Ee5R5pqrstuvwxyz{|}~24>A!B"B"J*cbKJh1H1tTw W y Y aAa`ssPRTVBB           (!)"*#+$,%-&.'/ (!)"*#+$,%-&.'/`haibjckdlemfngo`haibjckdlemfngopEEBBBBBEtEEBBBBBEBBBBBBBB|EEBBBBBEpqrstuvwxyz{|}~ffFFFffiFIFiflFLFlffiFFIFfifflFFLFflstSTStstSTSttvDFDvteD5DetkD;Dk~vNFNvtmD=Dm 0   ' ' '   g   gyy '' '   g '  g' g ''''O''''aa ''' '' '''''88 ''A' ' '  g''~'+*']'(*'?*?* '='E'G'** '** '** '.. '22 '33 '66 '55 'OO 'KK '11 '(( 'DD '// '-- ')) 'AA ')) '++ '** ')) '&& 'CC '** ' ''' ' '%% ' ' ' 7v 4t'&'%'@'?'!0! g ' '($0( g-+- g ' ''0.0 g313 g'646 g979 g '<:< g?=? g ' ''B@B g'P' '' '0' 'FC H g`' ' LJLgOMOgRPRgUSUgXVXg[Y[g^\^ga_agdbdggeggjhjgmkmgpnpgsqsgvtvgywyg|z|g}gggggggggggggggggggggggggggggggggggggggggggggg  g   g gggggg!!g$"$g'%'g*(*g-+-g0.0g313g646g979g<:<g?=?gB@BgECEgHFHgKIKgNLN gQOQ gTRT gWUW gZXZ g][] g`^` gcac gfdf gigi gljl gomo grpr gusu gxvx g@' ' '88 '|y | g~  g  g  g  g g g ''  g0 g0 g0 gJJ 'VV 'dd ' 'pp '~~ '  g  g  g  g  g  g  g  g Ag Ag Ag Ag Ag Ag   Ag  Ag  g  g" $ g(% * g.+ 0 g41 6 g:7 < g@= B gFC HAgLI NAgRO TAgXU ZAg^[ `Agda fAgjg lAgpm rAgvs x g|y ~ g  g  g  g  g  g  g Ag Ag Ag Ag Ag Ag Ag Ag  g  g  g  g0 g' Ag g  g    g   g  g0 g'%" 'Ag,(0, g3/03 g96 9 g?;0? g'FB0F gMI0M gSP S gXU X g^Z0^ g'da f gkh m gqn s gxu x g~z0 g'' Ag       'A''' '//$$ ''' ' '''''' 'u'Z'00 'Z'Z'Z'Z'Z'Z'Z'''Z'u'`` ' g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g   g    g g g g g g g" " g%#% g(&( g+)+ g.,. g1/1 g424 g757 g:8: g=;= g@>@ gCAC gFDF gIGI gLJL gOMO gRPR gUSU gXVX g[Y[ g^\^ ga_a gdbd ggeg gjhj gmkm gpnp gsqs gvtv gywy g}z  g  g  g0 g0 g  g  g  g  g  g  g  g(' '"' '$  !"#$%&'(()*+(,-./0.1234445567877779:;9:;9:;<=9:;>?@ABCDDEFGHIJKLMMNOPMQRSTUVTWXVYZ[\]^]_]`aabc7defffffffffgggggggffggggggggggggfffffgghgi222jklllmnnopqqqrstuuvwxyyyz{|}~@@@g777777777777777777777777777777777777777777777777777777777777777g7777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gg77 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777ggg7777777777777777777777ggg777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 g777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777g 77777777777777777777777777777777777777777777777777g 77777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777 g77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777g7  77777777777777777777777777777777777g77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777  g777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777 777 777777777777777777777777777777gggggg7777777777777fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff                                                                                                    !"#$%&'()*+,-./0123456789:;<=>?@ABCD  EFGHI  JJKLMNOPQRRRRS  TUVW  XX  YZ[\]  ^^_`abcddeefgfhijklmfghijklmfffffffffffffyyyyyyyyynyyyyyyoypqyynyyry7777yyysttttttttttttttttuuuuuuuuuuuuuuuuhijklmhijklmhijklmvvvvvvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwwwwwwghijklmghijklmhijklmhijklmxyz{|}~ff77777777777777777777777777777777777777777777777777777777g7777777777777777777777777777777777777777777777777777777777777777777777777777777g7gggggg777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gg7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777ggg777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777g777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gggggg777777777777g7777777777777777 777gff7777777777777777777777777777777777777777777777777777777777777777777777gggggggggfg77ff7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777g 77777g777777777 777777777777777777777777777777777777777777777777777777777 7777777777777777g777777777777777777777777777777777777777777777777777777777777777777777g777777777777gg77777777777777777777777777777777ffffg77777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777g777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777h7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmttttttttttttttttttttttttttttttttttttttttttttttttttt777777777777777777777777777777777777 hijklm7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777hijklm 7777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777 777777777777777777777777777 77777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777gggg 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gggggggggggggggg7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy     777777777777777777777777777777777777777777777ggggggg 777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777g 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gghijklm 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777  !""#$%&'"""()*+,-./0123456789:;<=>?@@@@AB@@@@CD@@@@@@EFGHIJKL@MNOPQRS@@TU""""""V"""""W""""""""""""""""""""""""""""""""""""XYZ["""\"""]^"""""_"""`""""""""""abc""""""de""""""""f""""""""""""""g""""""""h""""d""""""""""""""""""""g""""""i""""""""""""""""jk"""""""""""""""""lm"""""""""""""""""no""""""""p""qrstuvwxyz{|"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""@@@@@"@@@@@@@"""""""""""""""V""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" " """""""""""""""""""""""""""""""""""""""""""" """"""""""""""""""""""""""""""""""""""""""""""""""""""""" """ """"""""""""""""""""""""""""""""""""""~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~__sizeof__($self, /) -- Return the size of the string in memory, in bytes.maketrans(x, y=, z=, /) -- Return a translation table usable for str.translate(). If there is only one argument, it must be a dictionary mapping Unicode ordinals (integers) or characters to Unicode ordinals, strings or None. Character keys will be then converted to ordinals. If there are two arguments, they must be strings of equal length, and in the resulting dictionary, each character in x will be mapped to the character at the same position in y. If there is a third argument, it must be a string, whose characters will be mapped to None in the result.__format__($self, format_spec, /) -- Return a formatted version of the string as described by format_spec.S.format_map(mapping) -> str Return a formatted version of S, using substitutions from mapping. The substitutions are identified by braces ('{' and '}').S.format(*args, **kwargs) -> str Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The string is never truncated.isprintable($self, /) -- Return True if the string is printable, False otherwise. A string is printable if all of its characters are considered printable in repr() or if it is empty.isidentifier($self, /) -- Return True if the string is a valid Python identifier, False otherwise. Call keyword.iskeyword(s) to test whether string s is a reserved identifier, such as "def" or "class".isalnum($self, /) -- Return True if the string is an alpha-numeric string, False otherwise. A string is alpha-numeric if all characters in the string are alpha-numeric and there is at least one character in the string.isalpha($self, /) -- Return True if the string is an alphabetic string, False otherwise. A string is alphabetic if all characters in the string are alphabetic and there is at least one character in the string.isnumeric($self, /) -- Return True if the string is a numeric string, False otherwise. A string is numeric if all characters in the string are numeric and there is at least one character in the string.isdigit($self, /) -- Return True if the string is a digit string, False otherwise. A string is a digit string if all characters in the string are digits and there is at least one character in the string.isdecimal($self, /) -- Return True if the string is a decimal string, False otherwise. A string is a decimal string if all characters in the string are decimal and there is at least one character in the string.isspace($self, /) -- Return True if the string is a whitespace string, False otherwise. A string is whitespace if all characters in the string are whitespace and there is at least one character in the string.istitle($self, /) -- Return True if the string is a title-cased string, False otherwise. In a title-cased string, upper- and title-case characters may only follow uncased characters and lowercase characters only cased ones.isupper($self, /) -- Return True if the string is an uppercase string, False otherwise. A string is uppercase if all cased characters in the string are uppercase and there is at least one cased character in the string.islower($self, /) -- Return True if the string is a lowercase string, False otherwise. A string is lowercase if all cased characters in the string are lowercase and there is at least one cased character in the string.isascii($self, /) -- Return True if all characters in the string are ASCII, False otherwise. ASCII characters have code points in the range U+0000-U+007F. Empty string is ASCII too.removesuffix($self, suffix, /) -- Return a str with the given suffix string removed if present. If the string ends with the suffix string and that suffix is not empty, return string[:-len(suffix)]. Otherwise, return a copy of the original string.removeprefix($self, prefix, /) -- Return a str with the given prefix string removed if present. If the string starts with the prefix string, return string[len(prefix):]. Otherwise, return a copy of the original string.S.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.upper($self, /) -- Return a copy of the string converted to uppercase.translate($self, table, /) -- Replace each character in the string using the given translation table. table Translation table, which must be a mapping of Unicode ordinals to Unicode ordinals, strings, or None. The table must implement lookup/indexing via __getitem__, for instance a dictionary or list. If this operation raises LookupError, the character is left untouched. Characters mapped to None are deleted.swapcase($self, /) -- Convert uppercase characters to lowercase and lowercase characters to uppercase.strip($self, chars=None, /) -- Return a copy of the string with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead.splitlines($self, /, keepends=False) -- Return a list of the lines in the string, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.rpartition($self, sep, /) -- Partition the string into three parts using the given separator. This will search for the separator in the string, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing two empty strings and the original string.rstrip($self, chars=None, /) -- Return a copy of the string with trailing whitespace removed. If chars is given and not None, remove characters in chars instead.rjust($self, width, fillchar=' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character (default is a space).S.rindex(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.S.rfind(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.lstrip($self, chars=None, /) -- Return a copy of the string with leading whitespace removed. If chars is given and not None, remove characters in chars instead.lower($self, /) -- Return a copy of the string converted to lowercase.ljust($self, width, fillchar=' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character (default is a space).S.index(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.partition($self, sep, /) -- Partition the string into three parts using the given separator. This will search for the separator in the string. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing the original string and two empty strings.S.find(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.center($self, width, fillchar=' ', /) -- Return a centered string of length width. Padding is done using the specified fill character (default is a space).title($self, /) -- Return a version of the string where each word is titlecased. More specifically, words start with uppercased characters and all remaining cased characters have lower case.casefold($self, /) -- Return a version of the string suitable for caseless comparisons.capitalize($self, /) -- Return a capitalized version of the string. More specifically, make the first character have upper case and the rest lower case.join($self, iterable, /) -- Concatenate any number of strings. The string whose method is called is inserted in between each given string. The result is returned as a new string. Example: '.'.join(['ab', 'pq', 'rs']) -> 'ab.pq.rs'rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the substrings in the string, using sep as the separator string. sep The separator used to split the string. When set to None (the default value), will split on any whitespace character (including \\n \\r \\t \\f and spaces) and will discard empty strings from the result. maxsplit Maximum number of splits (starting from the left). -1 (the default value) means no limit. Splitting starts at the end of the string and works to the front.split($self, /, sep=None, maxsplit=-1) -- Return a list of the substrings in the string, using sep as the separator string. sep The separator used to split the string. When set to None (the default value), will split on any whitespace character (including \\n \\r \\t \\f and spaces) and will discard empty strings from the result. maxsplit Maximum number of splits (starting from the left). -1 (the default value) means no limit. Note, str.split() is mainly useful for data that has been intentionally delimited. With natural text that includes punctuation, consider using the regular expression module.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.encode($self, /, encoding='utf-8', errors='strict') -- Encode the string using the codec registered for encoding. encoding The encoding in which to encode the string. errors The error handling scheme to use for encoding errors. The default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.str(object='') -> str str(bytes_or_buffer[, encoding[, errors]]) -> str Create a new string object from the given object. If encoding or errors is specified, then the object must expose a data buffer that will be decoded using the given encoding and error handler. Otherwise, returns the result of object.__str__() (if defined) or repr(object). encoding defaults to sys.getdefaultencoding(). errors defaults to 'strict'.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it))._PyUnicode_InitTypes_PyUnicode_Initinit_stdio_encodinginit_fs_encoding_PyUnicode_CheckConsistencyunicode_dealloc__sizeof__($self, /) -- Return memory consumption of the type object.__dir__($self, /) -- Specialized __dir__ implementation for types.__subclasscheck__($self, subclass, /) -- Check if a class is a subclass.__instancecheck__($self, instance, /) -- Check if an object is an instance.__subclasses__($self, /) -- Return a list of immediate subclasses.mro($self, /) -- Return a type's method resolution order.type(object) -> the object's type type(name, bases, dict, **kwds) -> a new type__dir__($self, /) -- Default dir() implementation.__sizeof__($self, /) -- Size of object in memory, in bytes.__format__($self, format_spec, /) -- Default object formatter.This method is called when a class is subclassed. The default implementation does nothing. It may be overridden to extend subclasses. Abstract classes can override this to customize issubclass(). This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). __reduce__($self, /) -- Helper for pickle.__reduce_ex__($self, protocol, /) -- Helper for pickle.object() -- The base class of the class hierarchy. When called, it accepts no arguments and returns a new featureless instance that has no instance attributes and cannot be given any. super() -> same as super(__class__, ) super(type) -> unbound super object super(type, obj) -> bound super object; requires isinstance(obj, type) super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super().meth(arg) This works for class methods too: class C(B): @classmethod def cmeth(cls, arg): super().cmeth(arg) _PyTypes_InitSlotDefsppp@``h`H` `````````````````P`X``0`x`8`(``````p`(hh8h@hHhhhh0P0x@x(H8XH@``PPPP_PyType_CheckConsistencytype_traversecount($self, value, /) -- Return number of occurrences of value.index($self, value, start=0, stop=sys.maxsize, /) -- Return first index of value. Raises ValueError if the value is not present.__getnewargs__($self, /) -- tuple(iterable=(), /) -- Built-in immutable sequence. If no argument is given, the constructor returns an empty tuple. If iterable is specified the tuple is initialized from iterable's items. If the argument is a tuple, the return value is the same object.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it))._PyTuple_Init__match_args__n_unnamed_fieldsn_fieldsn_sequence_fieldsReturn state information for pickling.S.indices(len) -> (start, stop, stride) Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.slice(stop) slice(start, stop[, step]) Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).Private method returning an estimate of len(list(it)).Update a set with the union of itself and others.Update a set with the symmetric difference of itself and another.Remove an element from a set; it must be a member. If the element is not a member, raise a KeyError.Remove and return an arbitrary set element. Raises KeyError if the set is empty.Update a set with the intersection of itself and another.Remove all elements of another set from this set.Remove an element from a set if it is a member. If the element is not a member, do nothing.Remove all elements from this set.Add an element to a set. This has no effect if the element is already present.set() -> new empty set object set(iterable) -> new set object Build an unordered collection of unique elements.Return the union of sets as a new set. (i.e. all elements that are in either set.)Return the symmetric difference of two sets as a new set. (i.e. all elements that are in exactly one of the sets.)S.__sizeof__() -> size of S in memory, in bytesReturn state information for pickling.Report whether this set contains another set.Report whether another set contains this set.Return True if two sets have a null intersection.Return the intersection of two sets as a new set. (i.e. all elements that are in both sets.)Return the difference of two or more sets as a new set. (i.e. all elements that are in this set but not the others.)Return a shallow copy of a set.x.__contains__(y) <==> y in x.frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object Build an immutable unordered collection of unique elements.dummy_deallocrangeobject.index(value) -> integer -- return index of value. Raise ValueError if the value is not present.rangeobject.count(value) -> integer -- return number of occurrences of valueReturn a reverse iterator.range(stop) -> range object range(start, stop[, step]) -> range object Return an object that produces a sequence of integers from start (inclusive) to stop (exclusive) by step. range(i, j) produces i, i+1, i+2, ..., j-1. start defaults to 0, and stop is omitted! range(4) produces 0, 1, 2, 3. These are exactly the valid indices for a list of 4 elements. When step is given, it specifies the increment (or decrement).Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).release($self, /) -- Release the underlying buffer exposed by the PickleBuffer object.raw($self, /) -- Return a memoryview of the raw memory underlying this buffer. Will raise BufferError is the buffer isn't contiguous._PyMem_DebugFree_PyMem_DebugRawFree_PyMem_DebugRealloc_PyMem_DebugRawRealloc_PyMem_DebugMalloc_PyMem_DebugCallocPyObject_CallFinalizerFromDealloc_PyObject_CheckConsistency_PyObject_AssertFailed_PyTypes_Initnone_deallocnotimplemented_deallocReturn state information for picklingA simple attribute-based namespace. SimpleNamespace(**kwargs)module(name, doc=None) -- Create a module object. The name must be a string; the optional doc argument can have any type.A bool indicating whether the memory is contiguous.A bool indicating whether the memory is Fortran contiguous.A bool indicating whether the memory is C contiguous.A tuple of integers used internally for PIL-style arrays.A tuple of ndim integers giving the size in bytes to access each element for each dimension of the array.A tuple of ndim integers giving the shape of the memory as an N-dimensional array.An integer indicating how many dimensions of a multi-dimensional array the memory represents.A string containing the format (in struct module style) for each element in the view.The size in bytes of each element of the memoryview.A bool indicating whether the memory is read only.The amount of space in bytes that the array would use in a contiguous representation.The underlying object of the memoryview.toreadonly($self, /) -- Return a readonly version of the memoryview.cast($self, /, format, shape=) -- Cast a memoryview to a new format or shape.tolist($self, /) -- Return the data in the buffer as a list of elements.hex($self, /, sep=, bytes_per_sep=1) -- Return the data in the buffer as a str of hexadecimal numbers. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = memoryview(b'\xb9\x01\xef') >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'tobytes($self, /, order='C') -- Return the data in the buffer as a byte string. Order can be {'C', 'F', 'A'}. When order is 'C' or 'F', the data of the original array is converted to C or Fortran order. For contiguous views, 'A' returns an exact copy of the physical memory. In particular, in-memory Fortran order is preserved. For non-contiguous views, the data is converted to C first. order=None is the same as order='C'.release($self, /) -- Release the underlying buffer exposed by the memoryview object.memoryview(object) -- Create a new memoryview object which references the given object.move_to_end($self, /, key, last=True) -- Move an existing element to the end (or beginning if last is false). Raise KeyError if the element does not exist.od.__reversed__() <==> reversed(od)od.copy() -> a shallow copy of odod.clear() -> None. Remove all items from od.popitem($self, /, last=True) -- Remove and return a (key, value) pair from the dictionary. Pairs are returned in LIFO order if last is true or FIFO order if false.pop($self, /, key, default=) -- od.pop(key[,default]) -> v, remove specified key and return the corresponding value. If the key is not found, return the default if given; otherwise, raise a KeyError.setdefault($self, /, key, default=None) -- Insert key with a value of default if key is not in the dictionary. Return the value for key if key is in the dictionary, else default.Return state information for picklingfromkeys($type, /, iterable, value=None) -- Create a new ordered dictionary with keys from iterable and values set to value.Dictionary that remembers insertion orderReturn state information for pickling__reversed__($self, /) -- Return a reverse iterator over the dict keys.D.copy() -> a shallow copy of DD.clear() -> None. Remove all items from D.fromkeys($type, iterable, value=None, /) -- Create a new dictionary with keys from iterable and values set to value.D.update([E, ]**F) -> None. Update D from dict/iterable E and F. If E is present and has a .keys() method, then does: for k in E: D[k] = E[k] If E is present and lacks a .keys() method, then does: for k, v in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]D.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.keys() -> a set-like object providing a view on D's keyspopitem($self, /) -- Remove and return a (key, value) pair as a 2-tuple. Pairs are returned in LIFO (last-in, first-out) order. Raises KeyError if the dict is empty.pop($self, key, default=, /) -- D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If the key is not found, return the default if given; otherwise, raise a KeyError.setdefault($self, key, default=None, /) -- Insert key with a value of default if key is not in the dictionary. Return the value for key if key is in the dictionary, else default.get($self, key, default=None, /) -- Return the value for key if key is in the dictionary, else default.D.__sizeof__() -> size of D in memory, in bytesx.__getitem__(y) <==> x[y]__contains__($self, key, /) -- True if the dictionary has the specified key, else False.dict() -> new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)Return state information for pickling.Private method returning an estimate of len(list(it)).Return a reverse iterator over the dict keys.Return a reverse iterator over the dict items.Return True if the view and the given iterable have a null intersection.Return a reverse iterator over the dict values._PyDict_CheckConsistency__sizeof__($self, /) -- Returns size in memory, in bytes.__format__($self, format_spec, /) -- __getnewargs__($self, /) -- __round__($self, ndigits=, /) -- Rounding an Integral returns itself. Rounding with an ndigits argument also returns an integer.as_integer_ratio($self, /) -- Return integer ratio. Return a pair of integers, whose ratio is exactly equal to the original int and with a positive denominator. >>> (10).as_integer_ratio() (10, 1) >>> (-10).as_integer_ratio() (-10, 1) >>> (0).as_integer_ratio() (0, 1)from_bytes($type, /, bytes, byteorder, *, signed=False) -- Return the integer represented by the given array of bytes. bytes Holds the array of bytes to convert. The argument must either support the buffer protocol or be an iterable object producing bytes. Bytes and bytearray are examples of built-in objects that support the buffer protocol. byteorder The byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. signed Indicates whether two's complement is used to represent the integer.to_bytes($self, /, length, byteorder, *, signed=False) -- Return an array of bytes representing an integer. length Length of bytes object to use. An OverflowError is raised if the integer is not representable with the given number of bytes. byteorder The byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. signed Determines whether two's complement is used to represent the integer. If signed is False and a negative integer is given, an OverflowError is raised.bit_count($self, /) -- Number of ones in the binary representation of the absolute value of self. Also known as the population count. >>> bin(13) '0b1101' >>> (13).bit_count() 3bit_length($self, /) -- Number of bits necessary to represent self in binary. >>> bin(37) '0b100101' >>> (37).bit_length() 6int([x]) -> integer int(x, base=10) -> integer Convert a number or string to an integer, or return 0 if no arguments are given. If x is a number, return x.__int__(). For floating point numbers, this truncates towards zero. If x is not a number or if base is given, then x must be a string, bytes, or bytearray instance representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4sys.int_info A named tuple that holds information about Python's internal representation of integers. The attributes are read only.sort($self, /, *, key=None, reverse=False) -- Sort the list in ascending order and return None. The sort is in-place (i.e. the list itself is modified) and stable (i.e. the order of two equal elements is maintained). If a key function is given, apply it once to each list item and sort them, ascending or descending, according to their function values. The reverse flag can be set to sort in descending order.reverse($self, /) -- Reverse *IN PLACE*.count($self, value, /) -- Return number of occurrences of value.index($self, value, start=0, stop=sys.maxsize, /) -- Return first index of value. Raises ValueError if the value is not present.remove($self, value, /) -- Remove first occurrence of value. Raises ValueError if the value is not present.pop($self, index=-1, /) -- Remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.extend($self, iterable, /) -- Extend list by appending elements from the iterable.insert($self, index, object, /) -- Insert object before index.append($self, object, /) -- Append object to the end of the list.copy($self, /) -- Return a shallow copy of the list.clear($self, /) -- Remove all items from list.__sizeof__($self, /) -- Return the size of the list in memory, in bytes.__reversed__($self, /) -- Return a reverse iterator over the list.list(iterable=(), /) -- Built-in mutable sequence. If no argument is given, the constructor creates a new empty list. The argument must be an iterable if specified.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Set state information for unpickling.Private method returning an estimate of len(list(it)).Return state information for pickling.close() -> raise GeneratorExit inside generator.throw(typ[,val[,tb]]) -> raise exception in the wrapped iterator, return next yielded value or raise StopIteration.send(arg) -> send 'arg' into the wrapped iterator, return next yielded value or raise StopIteration.A interpreter ID identifies a interpreter and may be used as an int.function(code, globals, name=None, argdefs=None, closure=None) -- Create a function object. code a code object globals the globals dictionary name a string that overrides the name from the code object argdefs a tuple that specifies the default argument values closure a tuple that supplies the bindings for free variablesclassmethod(function) -> method Convert a function to be a class method. A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom: class C: @classmethod def f(cls, arg1, arg2, ...): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument. Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.staticmethod(function) -> method Convert a function to be a static method. A static method does not receive an implicit first argument. To declare a static method, use this idiom: class C: @staticmethod def f(arg1, arg2, ...): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). Both the class and the instance are ignored, and neither is passed implicitly as the first argument to the method. Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.F.__sizeof__() -> size of F in memory, in bytesF.clear(): clear most references held by the framePyFrame_BlockPopPyFrame_BlockSetupsys.float_info A named tuple holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.__format__($self, format_spec, /) -- Formats the float according to format_spec.__setformat__($type, typestr, fmt, /) -- You probably don't want to use this function. typestr Must be 'double' or 'float'. fmt Must be one of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian', and in addition can only be one of the latter two if it appears to match the underlying C reality. It exists mainly to be used in Python's test suite. Override the automatic determination of C-level floating point type. This affects how floats are converted to and from binary strings.__getformat__($type, typestr, /) -- You probably don't want to use this function. typestr Must be 'double' or 'float'. It exists mainly to be used in Python's test suite. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating point numbers used by the C type named by typestr.__getnewargs__($self, /) -- is_integer($self, /) -- Return True if the float is an integer.hex($self, /) -- Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'fromhex($type, string, /) -- Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -5e-324as_integer_ratio($self, /) -- Return integer ratio. Return a pair of integers, whose ratio is exactly equal to the original float and with a positive denominator. Raise OverflowError on infinities and a ValueError on NaNs. >>> (10.0).as_integer_ratio() (10, 1) >>> (0.0).as_integer_ratio() (0, 1) >>> (-.25).as_integer_ratio() (-1, 4)__round__($self, ndigits=None, /) -- Return the Integral closest to x, rounding half toward even. When an argument is passed, work like built-in round(x, ndigits).__ceil__($self, /) -- Return the ceiling as an Integral.__floor__($self, /) -- Return the floor as an Integral.__trunc__($self, /) -- Return the Integral closest to x between 0 and x.conjugate($self, /) -- Return self, the complex conjugate of any float.float(x=0, /) -- Convert a string or number to a floating point number, if possible.  close() -> raise GeneratorExit inside coroutine.throw(value) throw(type[,value[,traceback]]) Raise exception in coroutine, return next iterated value or raise StopIteration.send(arg) -> send 'arg' into coroutine, return next iterated value or raise StopIteration.aclose() -> raise GeneratorExit inside generator.athrow(typ[,val[,tb]]) -> raise exception in generator.asend(v) -> send 'v' in generator.close() -> raise GeneratorExit inside generator.throw(value) throw(type[,value[,tb]]) Raise exception in generator, return next yielded value or raise StopIteration.send(arg) -> send 'arg' into generator, return next yielded value or raise StopIteration.Represent a PEP 585 generic type E.g. for t = list[int], t.__origin__ is list and t.__args__ is (int,).Exception.with_traceback(tb) -- set self.__traceback__ to tb and return self._PyBuiltins_AddExceptions_PyExc_Initenumerate(iterable, start=0) -- Return an enumerate object. iterable an object supporting iteration The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).reversed(sequence, /) -- Return a reverse iterator over the values of the given sequence.Method to set name of a property.Descriptor to obtain a copy of the property with a different deleter.Descriptor to obtain a copy of the property with a different setter.Descriptor to obtain a copy of the property with a different getter.property(fget=None, fset=None, fdel=None, doc=None) -- Property attribute. fget function to be used for getting an attribute value fset function to be used for setting an attribute value fdel function to be used for del'ing an attribute doc docstring Typical use is to define a managed attribute x: class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.") Decorators make defining new properties or modifying existing ones easy: class C(object): @property def x(self): "I am the 'x' property." return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._x__format__($self, format_spec, /) -- Convert to a string according to format_spec.__getnewargs__($self, /) -- conjugate($self, /) -- Return the complex conjugate of its argument. (3-4j).conjugate() == 3+4j.complex(real=0, imag=0) -- Create a complex number from a real part and an optional imaginary part. This is equivalent to (real + imag*1j) where imag defaults to 0.?replace($self, /, *, co_argcount=-1, co_posonlyargcount=-1, co_kwonlyargcount=-1, co_nlocals=-1, co_stacksize=-1, co_flags=-1, co_firstlineno=-1, co_code=None, co_consts=None, co_names=None, co_varnames=None, co_freevars=None, co_cellvars=None, co_filename=None, co_name=None, co_linetable=None) -- Return a copy of the code object with new values for the specified fields.code(argcount, posonlyargcount, kwonlyargcount, nlocals, stacksize, flags, codestring, constants, names, varnames, filename, name, firstlineno, linetable, freevars=(), cellvars=(), /) -- Create a code object. Not for the faint of heart.method(function, instance) Create a bound instance method object.instancemethod(function) Bind a function to a class.cell([contents]) -- Create a new cell object. contents the contents of the cell. If not specified, the cell will be empty, and further attempts to access its cell_contents attribute will raise a ValueError.Capsule objects let you wrap a C "void *" pointer in a Python object. They're a way of passing data through the Python interpreter without creating your own custom type. Capsules are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another. zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The original string is never truncated.translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytes, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytes and working to the front.rpartition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing two empty bytes objects and the original bytes object.rjust($self, width, fillchar=b' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character.removesuffix($self, suffix, /) -- Return a bytes object with the given suffix string removed if present. If the bytes ends with the suffix string and that suffix is not empty, return bytes[:-len(prefix)]. Otherwise, return a copy of the original bytes.removeprefix($self, prefix, /) -- Return a bytes object with the given prefix string removed if present. If the bytes starts with the prefix string, return bytes[len(prefix):]. Otherwise, return a copy of the original bytes.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.partition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing the original bytes object and two empty bytes objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.ljust($self, width, fillchar=b' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes objects. The bytes whose method is called is inserted in between each pair. The result is returned as a new bytes object. Example: b'.'.join([b'ab', b'pq', b'rs']) -> b'ab.pq.rs'.hex($self, /, sep=, bytes_per_sep=1) -- Create a string of hexadecimal numbers from a bytes object. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = b'\xb9\x01\xef' >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'fromhex($type, string, /) -- Create a bytes object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytes.fromhex('B9 01EF') -> b'\\xb9\\x01\\xef'.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytes using the codec registered for encoding. encoding The encoding with which to decode the bytes. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.center($self, width, fillchar=b' ', /) -- Return a centered string of length width. Padding is done using the specified fill character.bytes(iterable_of_ints) -> bytes bytes(string, encoding[, errors]) -> bytes bytes(bytes_or_buffer) -> immutable copy of bytes_or_buffer bytes(int) -> bytes object of size given by the parameter initialized with null bytes bytes() -> empty bytes object Construct an immutable array of bytes from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - any object implementing the buffer API. - an integerSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it))._PyBytes_Initzfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The original string is never truncated.translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytearray, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytearray and working to the front.rpartition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing two empty bytearray objects and the copy of the original bytearray object.rjust($self, width, fillchar=b' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character.reverse($self, /) -- Reverse the order of the values in B in place.removesuffix($self, suffix, /) -- Return a bytearray with the given suffix string removed if present. If the bytearray ends with the suffix string and that suffix is not empty, return bytearray[:-len(suffix)]. Otherwise, return a copy of the original bytearray.removeprefix($self, prefix, /) -- Return a bytearray with the given prefix string removed if present. If the bytearray starts with the prefix string, return bytearray[len(prefix):]. Otherwise, return a copy of the original bytearray.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.remove($self, value, /) -- Remove the first occurrence of a value in the bytearray. value The value to remove.pop($self, index=-1, /) -- Remove and return a single item from B. index The index from where to remove the item. -1 (the default value) means remove the last item. If no index argument is given, will pop the last item.partition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing the copy of the original bytearray object and two empty bytearray objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.ljust($self, width, fillchar=b' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes/bytearray objects. The bytearray whose method is called is inserted in between each pair. The result is returned as a new bytearray object.insert($self, index, item, /) -- Insert a single item into the bytearray before the given index. index The index where the value is to be inserted. item The item to be inserted.hex($self, /, sep=, bytes_per_sep=1) -- Create a string of hexadecimal numbers from a bytearray object. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = bytearray([0xb9, 0x01, 0xef]) >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'fromhex($type, string, /) -- Create a bytearray object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\\xb9\\x01\\xef')extend($self, iterable_of_ints, /) -- Append all the items from the iterator or sequence to the end of the bytearray. iterable_of_ints The iterable of items to append.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytearray using the codec registered for encoding. encoding The encoding with which to decode the bytearray. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.copy($self, /) -- Return a copy of B.clear($self, /) -- Remove all items from the bytearray.center($self, width, fillchar=b' ', /) -- Return a centered string of length width. Padding is done using the specified fill character.append($self, item, /) -- Append a single item to the end of the bytearray. item The item to be appended.__sizeof__($self, /) -- Returns the size of the bytearray object in memory, in bytes.__reduce_ex__($self, proto=0, /) -- Return state information for pickling.B.__alloc__() -> int Return the number of bytes actually allocated.bytearray(iterable_of_ints) -> bytearray bytearray(string, encoding[, errors]) -> bytearray bytearray(bytes_or_buffer) -> mutable copy of bytes_or_buffer bytearray(int) -> bytes array of size given by the parameter initialized with null bytes bytearray() -> empty bytes array Construct a mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a buffer object - any object implementing the buffer API. - an integerSet state information for unpickling.__reduce__($self, /) -- Return state information for pickling.Private method returning an estimate of len(list(it)).B.isspace() -> bool Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.B.isalpha() -> bool Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.B.isalnum() -> bool Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.B.isascii() -> bool Return True if B is empty or all characters in B are ASCII, False otherwise.B.isdigit() -> bool Return True if all characters in B are digits and there is at least one character in B, False otherwise.B.islower() -> bool Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.B.isupper() -> bool Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B.istitle() -> bool Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.B.lower() -> copy of B Return a copy of B with all ASCII characters converted to lowercase.B.upper() -> copy of B Return a copy of B with all ASCII characters converted to uppercase.B.title() -> copy of B Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.B.capitalize() -> copy of B Return a copy of B with only its first character capitalized (ASCII) and the rest lower-cased.B.swapcase() -> copy of B Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.B.find(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.index(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the subsection is not found.B.rfind(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.rindex(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raise ValueError when the subsection is not found.B.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.startswith(prefix[, start[, end]]) -> bool Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of bytes to try.B.endswith(suffix[, start[, end]]) -> bool Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of bytes to try.bool(x) -> bool Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed.tok_backup!6 6666666666 6166666666666666666666666666 6 6666666666666666666666666666 ( ) startswith????Y @?  ?> <& .BeAc & .>@C\t\n\r\x 00000000?333333? ?A5?55?5?P9Ap>0>P ^4@CpA?aCoc?`(?yPD?A<<0@ư>.ApP?@࿚?UUUUUU??y??UUUUUU??i????UUUUUU??$I$I???qq??@@@j@cAחA _BmB&@UUUUUU?@(@*@@,@.@@1@!@2@3@UUUUUU??4@i@@@@jAsA5@^ A6@7@8@9@:@;@<@=@@?333333????333333?>@r@p@L@OA?@@@@@A@A@B@B@C@C@@?D@y@@@@jAD@E@E@^AF@F@G@G@H@H@?@?I@@@@j@A@N@@p@L@O"A? @?Q@@X@@\%A @T@@@@@j(A"@@V@ @@@@w+A?;(lD<i ɯPPgp4عklru$5nhWr`Ӿ[$d u }D  $ B0 d l `  ? 4 |  '02h(g t;0JW|jxQ,,jqL9H0xD$[e JDx $( '\ , P W@!!!"<##:\$ $$(%m%&&E'R't(P(((<))) H*"*2*R++,[L--.0..=/`//c0N `2j 2 \3 h4 4C 5L 5M L6p 6u 6 6 7 7 (8 8G 8O 9 x9 9 : P: ::6 ;lh;;kH<<===2H>:>R>Y>^L??d@@/ ALhB78CxCC0DxDWDoE0EhEEFPFF; GZGi HFH|I) IX J 8K K\!HLh!Lx!L!`|bN`b`@caca dbdTbdWbXebebfbfQcfe8g fgMg8hghsLiMtititjtljtjuju\kvk)vzY`zRzjz{L{ч{H4|UT|}\}}~ˌXrǍ0ύ`!<Ă<|؃&4=MTCHt̆ے8Kx“ܓ܈@c\DukЌ `4>$_%1yߞȒ<\ؓ h4p\ܠĕ0|ơ ҡ|ȗИJ(ˣętʦ|ߦț$Fp](ݧ/XШ`ɩҩکB<IԢ8d4Ф H}LѶЦo<ιب*@#$7xEتHzCL,F6Mԭ4Ю;u P|$Xlp̱P@t~$6\/t&<pз ≮8̻ dؼp x`( $-d? pLE8#El+0xW(TTW,|H d<Zx\+S\Y|`hX PHF]\P\ T`,+q8l#$1XL8Olr XT<,|$(xDEd4pTD`KtW0CYD(IazDYL<(t(X|t0`9]LT  0  ?0`8<cpd2<\h  $7 hB  4!!,!! ;"T "# O# $< g%x % %8 % X&$ ' A' O' 'x ()d *(*-* _**+H224|4I$IhJJ"MH5MxhMM4:U|'V[[aab|Occ4c e Ne|ZeepffHzz,z{0{i{|(~~0  . 9,!AT!t"x"<#$$%&H&&'̗'j(ɘL((ϙ)D))cP**-D+6++ѡl,",P--t..|//P001 2`2ϽX3 44556l6667(77S8a8i88099:T:\:R;P;;;;@t<<Xh= =>>L>?X???|@@@kAXAAAB8BB"BCkD0DKxDD ETEEDFGeGUHtHI IdtIII PJJ*TKK(LLLLM&8p&p&\q&q&Tr)r)@s*s_*s*8t*t*t+Hu<+uP+u+Pv+v,v,pw,w.wE.`xj.x.y0 >??L?@0@ЈAXoBBBHBB؋C0D8D8?DDDEtFЎ$F,FG#HWHTcHJP\^VZ"[ t[xo\ĕv\\\]]{_`___D_x_`F`LN``a\d>eqeeeLexeeedIfdffxggggi̟i4joll n)oP3ooooHopLssX't0t v` wȦ]whwħ~xxpxĨxHeyyy{P{h^l`X'4ՃDܰ$X*=j<~t4ۇ4s2 |׉H<% p;(`Q?lԼ :,09S`%Ɩ֗l" }|\eӚLޛ0$h,PHQ<¡ D`Ϣޢ@L 2X8x`:(ԧ6|s}TH׮R$P$H$p<p 0lD\Hc}4ͻڻ x.>0pd|8ͼ<-48X ,ql\M0 sH=`tvPXU8]d n` p$6Lt=%`T l s  P XXpH30sJS<   T!!!8""#o##D$$%8%%*"%1"&L"X&"$'"'"'#<(`$(%(M+h)U-)_-(*-* /*Z/@+s/+A3,Z3`,3,5 -6-`6-6P.n7.9/:/:,0:0V;0;41;1<2\<<2<2<3T=L3W=3=3=84=4_>4z>5>5>6$@H7,@7@,8@8AT94A9OA9wA :ZBX:lB;B;>C<C<C<CD=C=CP>C>C>Eh?I?JL@J@K@/K8A6KA=K@BHKBaKBK0CKXCKCLhDUMEOEOPtFVPFT@GFUGUGUHUTIVIWPJMWJAX0KXtKYK/Y(LYLZMZMZMZ NZN{cNc8OcOcOc,Pc`PcPd$QdQeRipR;jRBj SRjS2kSbkXT~kTkUkUkWlWlXl0XmXmYmtY nZ,nPZonZxnZnh[n[o<\o\p ]p8]p]p^%q^qX_Cr_t_1u\`su`u`uauxa)va6vaHvPbvbv$ccPdťpd8de`ee f(lffLgggThYhhhk i`ii׫jhj/kkjLllGHpx{~ @8| P}ȢylXH9ؤ@|&=$MxЦ'X7RqH h̪`2_o8hЬX0 ]X"L>Fذ,'Jl,| \0<d,з$k|8 l9 v  @ c ܺ    L% 0  H' u Q@ 3ܿz8Xi6vhV@X "xhw~H!0?hIT   t!"0#\#e#hn##4%%%<%%%<&+&0&(L&x`&&'$'((T)-)tb)j)4** *P***X++, ,,Z,X^,, -0-D8-O-^-$&/p3/^/)0,?01b1D111(92|2$3Dh333`Q444,4l56~6`6677@77^8888::#:,:4Q:hv:: ::;;;X<<>d> '?@j?@P4AHAoAATABQBBXBC\,EuFfG0eH}HHH lJXJL8L9MH[MxgMsMM8MtMMM(MdMN8NJ>c0???P@@dAATBBBdCCDDD?\EgEHFnFF4GxGGHlI)II`JJGJy K@KK0L,LtAеTAKܶ<t `<d\t\$]8н(Nht4/TgĿ`G.Hfh/7c8jxtd L|`iDD@hh'V,tb,  ,O@%XG(p@,Uv@dfmPL& R d H+ 2 `E k r x   t K   l<l)@3MQVbXH LX!Fxp+A@h},|0l"k0l,L]d ,' @  :!!D!" "X"!"r"0~"H#$`$|%%%(%%%4&DQ&ph&&&$Y'\`'t''''' O(l(())0)~)P)l**T**+X]+++U,,\,,q-8-l-- -@.J..D.h/#/B///0`0l00002111D1X1l]2i2}222T3|3h3|33 3 4D 4 5 5  5 5 7$ 7H 8 9 9 : 3;P < < <( = &= b= j= =< =t > > ? ?  ? v??8?L?`?t@B:BZBbB,hB@BT5CCCCD*DZDD<DPDdDxDD#EJEvEE E<7FTiFlFFFFF!G OGPGdGGGHJHkH,HDHtHHI;I\III$ J<JPJ+JiJJ1KYK,K@KTL%L;LILSLLLL(L<LPLdLxL/M~MMMMM,M@MTMhM|M NNBNNNN,N@NTNhN|ORRR  S SpNUUUUU U$V<VPdBSfgv,@՜Th|Uȝ<hPd  nDXàx'f &L2`  ܣ4H\$p/  X 5l ^   ڦ \ !۫H!d!x!(!4!?!K!x!"("<"P"2d""""""˭"׭"ۭ # #4#H#\#p###Z#u##$:$$w<$|P$d$|$$$$ϯ$ԯ$$%B<%ٰt%%E%W%% & &߱8&9p&&̲&'t''8'$(h((۹((("(;(])8)T)p))ּ)F *t@*\*Ǿp*s****I +X$+d8+pL+|`+t+++++h+j,l,n0,H,d,,|,,,\-w-D-\-3t-l----,-G. .?<.lX.t.... .J$/L/?x/////h$0[001M1_01X1t111&2f,2H2|2223 $383p3 363}344,44d444~ 585L555"5.5:5(6*@6eX6966F67$787L7`7Z77v778888$L86`8_|8s888889%9.(97<9P9d9x999994:\:.t:::#:` ;$;l;;;(<8d<<d<L=%`=8t===><>d>1x>D>Z>p>v>|>>? ?[>\>(\?`\A\-A\ B\)B\2B]fB8]BL]Bd]Cx]1C]YC]C]eD]GE]OE ^qE,^EL^Fp^G^wH(_H<_HP_Hd_H_I_^I_I_I_vJ(`J@`Jl`K`xK`L`gL(aMta8NaOa&T(b!U`bUbWbXbfYlcYcYc1Zc@ZcZcZ0dH[hd\d\d]e_He`|e`e`eafaDfLbdfRcf[cfcfcgcgd0gdTg'e|gjegegeggfhpf0hgXh8gph?ghHghkghgh[hhh8ihLih`ihtihihihiii jjldjljljljljznJ? @X@AAAԦAA(A<BdFCCÇCD D,DDEd F|FGGGH I@K LyLةM?ObOOЪObPPLPd*RST!TIT8XXY\P0ai?mDn>$݂DIp̯-?Qdw0DXlÄ]ͅ0HԱ#\H"JܲZ4jd׏W9 yXc8ԴȖxc|К=ĵܵ|ɜDRȶğHKȷ΢Jƣ0h|Bé4(TXlܹ0h|]Ժ m4T3ػWr  l ,xJ,}\pfh0(L1`  8MXx.Gfo(4`g>(sT ,t p0qH@H Q9H>\CpN_,de74\M[Da  tD \HCHPZ !@`'( (4+,,,- w.<0/lM/%233n343`%4455~6< 7<7f88 @l@oA{AAAA0BdCuJJ$NKLELlMNyO4OlDPPhQQH{RtRRST$UXWWW&WW07Xl>XXAZHZZ<[[t[[Z\k\\$.]^^^^4h__'``8cT[cpccde$e8getmeqeeeee+ipiiiijT!jh'j|.j\jdjl5m,nxXpprtplu*wx|z@^|l}:`P|܀<l\|ṕ \Xll$| D̎h,l <0T?x? @|!<@!@L"@" A#8A)B*XC+C<+D+D<,D,-E-El.E.E,/dFFFF$GLG@GIGIG,D EE@El?0A|pA CCL@EEEl>l>> ?L?\?|@@CCCLDLEE8FH\XKhLL,Ln>\n,?np?,o?o?o,@o@@Lp@ q@qAqAslBsBuXCvDwPDwDwDlxDxhE|yGyGz(H|H~DIlII\JسLBTEشlFF\FtH J@lJJLKOhO|PзLPPQXlRLSиYT]\]Թ,^(l^D^L_|_H_`L`Ļ\b0bdeH iȽ jLjH,k,m {@||$,}l~~pL\4`x|4L̅,Ḣ,L\ lLt|x̑L`Ll̙ ܜ,X|8ܞx,>l??@h@ APAA A\BBCDC8el>e>e>eH@fLIfLKflMlgl*>*>*,? +s(>s>w>yP?\{? @@@lDA|ĀA܅BtBܒB<Cܓ,CLCCܕCD 0D |D|DE|EEE,El F\dFF\GPGG<>> \?X?<@@\BClD,E|EFGHP,I,>X\?AKr <$0%D `İ  LT-%BBB B(A0A8G% 8A0A(B BBBA Xj x3'$03-BAD bAB83AW@3 D<3BLI J(K0A8Dp8D0A(B BBB(pH35BR [Eh 303BEA GD  AABA @X5BAD D@f  DABE r  DABE ((e?@  DABA T5HhD6BBB B(D0D8G 8A0A(B BBBA k6LAJG (68ACD ^ AAA 4H@\6BBB D(A0G` 0D(A BBBA 6`H 8)BBE E(A0D8A@ 8D0A(B BBBA  j2@,8BSHH8BBE B(A0C8D@L 8D0A(B BBBA D9BIL B(K0R8RP8D0A(B BBB̵P9 HP A F$9DBAD yABD \}?pҵh9FA} A F|,p9BCA  ABA Wx  9cAaH4 H:'BEH B(D0D8Gp 8A0A(B BBBA  K:p, <BOG  EBD  59  > >5BG0fE ?O A C@ ,T ?>BDD G@e DAB @ ?+4 @PBED A(Gs(D ABB V, @BBD DP} DBB8 RPHT ABIE B(D0A8G[8A0A(B BBB 8 ,CBHA D(GP(D ABB /RP FA,4 HaBDD I@F DABd T@8 HBBD A(D@r (A ABBA  @ I L IiBBB E(A0A8G 8A0A(B BBBA < \,\ \LAA v DBA   , xKED zIB@ $\aBEB D(C0GPX 0D(A BBBA 1P(<0\8BDD0\ DBA h0,,\;BAA DPn AABDP8 \LBED A(B0[ (D ABBA  "0`$\BEB E(A0A8Gu 8D0A(B BBBA z8F0A(B BBB(]AGD0 AAhM0`^ 4\^:BBD C(Gp^(D ABB8QVpTH^AJ RAtk0 40^pBED D(I`N(D ABBKU`(L^SBOD yBB X ((d^!BDG@ DBA T!T@,lP_$BAC G0R AAB-.0L4_ BLB E(A0A8J 8A0A(B BBBA  $(dhAAIP}AAPh!A_Llh-BBB B(F0D8G 8A0A(B BBBA FajsAR4jcBEE D(DPD(D BBB@79P\jeY t< R$j3AHD cAA 0jBDD G`  DABA `HlBBB E(A0A8G| 8A0A(B BBBA h94$m:BBD A(D`c(D ABBwh`m(Af8 mBMA A(D~(D ABBLb]hToGLpBBB B(A0D8D 8A0A(B BBBD 7Xo6po!0t @DtLBB A(A0DPu 0D(A BBBA vPuANZ Hn8nBEA A(C0b (D ABBA ((Dp@HEG hAAAT l@pt 48pBBD A(A0(A ABBn0pt|pAI$(tpqACH bAAPL Lh$tBBB B(D0A8DB 8A0A(B BBBA ii(Dp4BAD iAB0 L l  %AcvH$BBI B(D0G8NPT 8A0A(B BBBA $PD8{>XsD ZpL{fD Z$@{'BDK FIB(H{^\DD vAAA  d{RZg G CAd,{KBA A(G@ (A ABBI 8^@T (A ABBE 0`@a (A ABBE }(}AAD0] AAA p/0, }IKA Y ABA PW% ZDB8t~mBAA  ABD  ABB $H R ABE [AG v AA  D@(gBBB A(D0D@} 0D(A BBBA l @h BBB B(A0A8J 8D0A(B BBBD nLGGGGX=4m4,AAD j AAF T AAJ dP* N AAE A^0x AH 2<0 BP0p BA 2R0` :BBB B(A0A8DP 8A0A(B BBBD  8A0A(B BBBI d P$ Ȗ"ADD UAA4 : K DAE V DAB AEA4 wBAD N DBE y DBA !1 4!ȖXIvDP! d!<x!BJT  Nr 7 EBJ @!ě\BJI D(D0L@ 0A(A BBBA !@8"WPEH D(J0 (D ABBK X" G0t"Ƞ "Ġ"TFC"X4"""p#xlBBE A(A0DL 0D(A BBBJ J 0A(A BBBN  0G(A BBBB x#:d#T+BEB E(A0D8D 8D0A(B BBBE a 8A0A(B BBBE $= $,84$H$ԥ^\$$p$ BAG xA$ $$AV$Ȇ-<$JBBB A(A0 (A BBBH %x08%<L%P H t D m A HA| I E%  %|Aj A C A %#(%`-BED YBB&Ԭ&80&ܬBAG Y DBG ; DBC l&b> d&+RHH B(D0A8DP 8A0A(B BBBA CP& WP0 'BAD | DBG bDB@'L$T'H%BDK FGBH|'PBBB B(A0D8G` 8A0A(B BBBA '`H'6BBB B(A0A8D@ 8D0A(B BBBA 4(@4T(XQADP AB Z AE v DB (PP(hJ(+4(AGKpz DAF k DAH )H@)DgBBB A(A0DPI 0D(A BBBA \)EP|)P$)AT()TJGG AAH)(D a A a)_? z\ *BBA D(D0 (A ABBI  (D ABBE F(A ABB,l*&0v (A ABBB *д0*+***) A+'XN+#(,+1BDK XABHX+BBB B(D0D8DP{ 8A0A(B BBBA +~"P+~+l8+LBA A(G@e (A ABBA (,/@D,(A[`,D0x,BDD D0_  DABD ,I0H,TBBE B(A0D8DpN 8D0A(B BBBA -p@4-ط BBE D(A0G@ 0A(A BBBC x-{@$-4.BDH OJB- ADB<-<BAD0 GBI l GBE DDB .08.ĝ9I o(P.NBAD CAB|.v 8.$RBEA D(H0 (D ABBE (.. 0U(A ABB/ X/BEB D(D0G@ 0A(A BBBF ] 0C(A BBBI p/o@(/AGH m AAA / /h!A_/|!A_ 0$Ba((0VBDA  ABA ,T0؝]HHD y AAA J,0AJ AH  AE 0{0!A_80ԝBBD A(G0R (D ABBA $130@1(T1BAA q ABH 1 81BBA A(D@ (D ABBA 1g@1XD2(2RBAK z ABA H2O\2#A p2qKHUH2BEE B(A0A8G 8D0A(B BBBB 2-S3!A_3;Au83( P3 x,d3hBIK G0B DBB3Ht3BRE B(A0K8NHBPQHB@V 8D0A(B BBBE A 8C0A(B BBBE L 4 BBB B(A0A8G> 8D0A(B BBBA p484+BBE A(D0(F BBBH4BEI E(D0A8D@x 8A0A(B BBBH H5BEE I(A0D8DP~ 8A0A(B BBBJ d58yR f|5yR f5 @5BDD u ABN S GBB S ABA H5`%BBB E(D0D8D@ 8A0A(B BBBD 86@X6$ fp6-L6BDD G0s  AABE k  AABD V  GABB $6f-0a GAB460=BDD c GBB AAB473 P7T Z B a G dp7BBB B(A0A8D@ 8A0A(B BBBG  8A0A(B BBBD 7$J7`<8\NBBB B(A03 (B BBBA @8;N0`8LeHt8pBEE E(A0D8DPK8A0A(B BBB8 JP88<4FBB A(A0p (A BBBE 9@,09\ZBEG D0 DBB`9 0<|9BBB A(A0O (A BBBA 9`0D9BPO P(O0U 0D(A BBBA $:#D:(sXX E }d:x:VA@ A ::BED nBB=   >hoAG ` AA (>eB @>,LFX>4TAJ GAx>W >\7D k A >B 4>jBED A(D0S(A ABB>60(?8SBEG @BB$@? A EBB 8h?BBB D(D@g (A BBBD ?@? H?PBBB B(A0A8D` 8D0A(B BBBB  @%`@@@BBB D(H0G@K 0D(A BBBA @@H@|BEB E(A0A8G` 8D0A(B BBBD @m`A8$A)BBA A(D@W (A ABBA `A@|AAA $AHBGA zABA A$A.BDH OJB B ADB@B̩"A`XBlBЩDHv A B(BAKAG jABB]@BBAD0r ABB S DBE Y DBA ($C i0~ ABE UGB0PC|BDD D@a  AABE CG@C<;BxC`$C\HPFQ ZDBCG$D8*ADE ]AApLNBIB B(A0A8G 8A0A(B BBBF OV&0OU(DOAK c AP K AL pO\0AG Y AA O pOPABBB A(D0 (A BBBB Z (A BBBE A (K BBBC W(D BBB P 0$@PL@BED qABhP PL+BhPPH HPBBB B(A0A8D`e 8A0A(B BBBA QD `(4QKAG  AAA `Q` xxQt BBB B(A0D8DP  8A0A(B BBBK  8D0A(B BBBE D8A0A(B BBBQ PLRBBD A(D0 (A ABBD k (D ABBF dRi08R3BBA D(D0  (A ABBA R-0RR$(SLBAN ABA ,SJ0DSءoBDE B ABB UABxS IDBSCAAS4S|BBA A(DPh(D ABB$TP~X[`SXAPD,TBAG  DBE b DBE M DBA tT+F T̡(TAkAD t DA eCTD V F Td! (UlDBEG qBB,UE  HHUtIBBB B(A0A8B@ 8A0A(B BBBA Uq@UX"A`U \UDEKD ~ BBJ A HBE R EBG A BBE \ BBE @VG \V`,pV̡xBAA W ABB V WDBVHD t A V|Q LVBBA A(B0 (D ABBA k (A ABBE ,DWiJ0N (A ABBE HtWXBBB B(A0A8DP 8A0A(B BBBJ W7SP8WG BPN R(KP (D ABBX.]P(8XdBGG0u DBE dXC/0$|X0BAA hABX2  HXBBB B(D0A8A@ 8A0A(B BBBA Y@$(Y<BAA tAB8PY eBBD D(D0h (A ABBA (Y>0m(D DBBYvBDPjEY P YhAD \ AA Z ,ZGxHZ4 BBE B(A0A8D 8D0A(B BBBG SBBBBDDDDD}ZZX'+DfZ2m[88Ho0[H[$'?Dz`[pOt[%[CY,[ 'WBAA E ABD [l 8[mRBBB D(G6(D BBB((\'AAD0y AAA T\W?0D AAE $x\T(@BX B O E F E \J2Y A @\P( BAD \ ABJ  ABA  ABA ]  ]N,]$BaH]H`])BFH B(A0D8Rpd 8A0A(B BBBA ]p8].BDB A(A0 (A BBB^0H(^.BBB B(A0A8D` 8A0A(B BBBF t^^`(^1qIEA ] ABA ^  (^`oAD z DE F AA _pK ( _ 1AJ q AC D DH HL_1oBEE I(D0H8GP 8A0A(B BBBH _2_8_rBBE D(A0Y(D BBB_08` BBE A(A0j (D BBBA X`0t`x((`JBHA zBB`> 4`BBA D(Gpp(A ABBaGAs A $aw0`Ab A Yd dhdĥUAOdM4d4BED D(D0G(G JBB8 eBJD D(D@K (A ABBA \ef)@LxeBBB B(A0A8D' 8D0A(B BBBA e#(eԩRAJA J DAA f $,f0BDJ RJBTf LAB8tfhBAA F ABC O ABN fny HfBBB B(A0A8DP 8D0A(B BBBF gNP8gLgYEIdg[ A g"`g(RBKB E(I0D8D`q 8G0A(B BBBJ 8J0D(E BBB4g+`D 8C0A(B BBBA 0hDDhBAD  ABH  DBE A ABE ha7 hT)hh\h\BBA D(D0: (A ABBC  (A ABBE z(D ABB0i30LiQGh A \li+`iBEB B(A0D8DP~ 8I0A(B BBBL  8C0A(B BBBA i,PLjBEA D(G0 (D ABBD w (D ABBH XjYp0\tj BBB B(K0G8GYFPAy 8D0A(B BBBA jMjGk$k8;BBE B(G0M8UyOLAg 8D0A(B BBBC mEWAEFAKLBk!D4kYAGG0_8B@K8A0Q AAA l ;0P8J@F8A0d4l BBB E(D0A8Dy 8A0A(B BBBI  8A0A(B BBBL 8le   8A0A(B BBBE HlTBEE B(D0C8DPe 8D0A(B BBBA $m `PDmذBT A dm8D G A m B mH!A[m D mJAG [ DB mx  DD8nBBB A(D@\ (A BBBA Dn) !@(`nAGD  CAA n  nhAn dn<BBB E(A0D8D 8D0A(B BBBF  8A0A(B BBBE 4o (8To|BBA D(D0] (D ABBA oO 0do^BEE B(A0A8D 8A0A(B BBBB o 8A0A(B BBBA p A4p HpA A Y C lp 8@p8BAJ R DBK F DBD D GBB p  p|!A[p C4qxBJJ _ IBE D GME Lq3  dq xqd HqBBB B(A0D8G` 8A0A(B BBBF q`4qTgADG0 DAK { DAA 0r 0HrtA[dr^ C,|r`fBAA F ABC r v Hr"BBB E(A0D8D`' 8A0A(B BBBA 4s( F`b 8G0A(B BBBE $Ls0%A F H F P(ts8BGD0X ABA s 90s4 $s0TBAA LABs   tP ( tLBGA Z ABA Lt~ c dt8ixt ATt|^Hst D tAs F H F tLA G u\u*BBB B(A0A8Kp= 8A0A(B BBBA ~xUBBIptu pHuX BBB B(A0A8D`Y 8D0A(B BBBD uJ `0vBDD h DBH AB4v  LvNALLdvB@ F V B G E E E E E E E F E E E E E Dv_ F E F E F E J E y E F E \ J E E Ev 4wBDD0n FBH  DBA Hw~ W00`wBGA G0Z  AABA w $0wܫ <wثBBE D(D0 (D BBBA x= 0$x8x LxGLhxrBBE B(A0A8D- 8D0A(B BBBA 8x L+ 8A0A(B BBBE xdAL I 4yXBAG x GGH L GGE ,Ly > L ABE _ CBA |yp@At A y 0ysBBD G0Y  ABBA y 00(y$AAM AAD (zv z0@zDX A \O fAaR aDtz $z$BDK ABz  (zԬaBKD j BBA z  4{JG z AD D DH H H{h g `{ t{ {,Aj8{|BBA A(A0^ (A ABBA {7 00{sBBD G0Y  ABBA 0|00L|;`|(t|AAI0 AAA |08|TBED D(D@Q (A ABBA |jAG E AA }\Y @0}AHG0~ AAH I AAE D AAE t}YA0}ЫLAi A `(}05BDD cDB }6 TDB8} BBA A(D@Z (D ABBA 8~@4T~XBDD i KBB @DB~  ~<Az~z %~<Az~s % SA^ A k A $` `<BEB B(D0A8GP 8F0A(B BBBH T 8A0A(B BBBJ  wPHBGE B(A0A8D 8A0A(B BBBA  $, JBDA ABTȪ#A] A C(tت}BHR0p ABA 4,BDG0G ABA D FBE ؀ 0@BBB D(D0D@a 0A(A BBBE 4C E@dT(rBBB B(A0A8D@2 8G0D(E DBBH t 8A0A(B BBBA L @v 8A0A(B BBBE X 8M0A(B BBBE d L KEB B(A0D8D` 8A0A(B BBBA ^C`t `H bBBA D(D0 (F ABBI x (C ABBA  500 BEA D@q  DBBK 0 r@8L@ BBA D(A0 (D ABBE  U0 2$/BAA gAB$_BDA TAB   PAN8g $LAU hsAR A N A \@BBB H(A0D8E@| 8D0D(G BBBE m8D0A(B BBB .@H BBB B(A0A8A@P 8D0A(B BBBA X d@xd <`-BEB D(A0 (D BBBA ̅ h0$0JBAH {AB  ADB480Af0PLKBAD r GBB ACBh"A`* (lBAD AB܆  ī#A]F C$,QBDA FABT  l,`BED G0H ABB 0̇$(JBBA @BB  8($BEA A(G(D ABBd Ll'BIE A(A0N (D BBBA  (D EBBE ЈM B08AAF0` AAA  &0ȗ XKIAx0 0 BEJ G0e  DABA @ 0\=&p >^Dz A x <<>QD z A  < `Иl>BBA D(D0  (A ABBA x (D ABBE A (A ABBE 4H 00HP?BBB E(A0D8DP 8D0A(B BBBA  )PH@@BEE B(D0A8K 8A0A(B BBBA  ((BgBAG y ABA T  AKBx %A] E AHBBBB B(D0D8Gy 8A0A(B BBBA  L(CLBB B(A0A8D 8A0A(B BBBA TN (tEwLAD XGB   IABěE(؛EDz B 8hFBBD A(D0 (D ABBE (0jBAD0u ABA \s 00tFXAD@ABAH@ @<G}NBB D(A0u (A BBBE  0 |d4xBBB B(D0A8G`8 8D0A(B BBBA  8I0D(E DBBE  7`H<[`ԝ `$HBBB B(A0G8Dp 8D0A(B BBBA 8J0D(B BBB4L pl 8G0D(E BBBE @8NBBB A(A0J`T 0A(A BBBA Ȟ 1`LtOBBE A(A0m (D BBBF L (D BBBB 8PKY D TF ElP0VY؜=D n E  > c A (PAAK n DAF DQ5 )AY0XQBAD D0  AABA H 00dRBAA D0  AABA  /0HR?BRE B(A0A8G 8A0A(B BBBD \ Q8 |uBBD A(A0L (D ABBE (\Q :0q(C ABB$U UA L H P ' ءU )D dUU\,UBEG D(D@\ (G ABBJ q (D DEDE c (C ABBA ``VBEB B(A0A8DPG 8J0C(B BBBB X8D0A(B BBB8 NP( RBSD tBB<@ P<AUh Q8,fBBA D(A0K (A ABBA 0أD H@oBBB E(A0D8G`1 8D0A(B BBBA 8h`$XD9BGA kAB  $D5BDH VJB ADBT$B[ A  M$\#BAD XAB<8TrBIE A(A0p (A BBBG x2@0(6FDD \ DBB ĥ&( bCB(AG e DB M DA  H,0iBEB B(D0A8DPE 8D0A(B BBBA x7PT  :Ԧ8 $4fADA ]AAL (d"<()D dTh $hdBKA AB0 (UBAG0z ABI ԧ0PBG0AE 0$: BPO U(H0A8UMGDTTFB`HIA 8D0A(B BBBA } ,Ȩ4BBA s BBA $; A EBE @ lBPS R(J0G{0D(A BBBdHrBBB G(I0A8G F8D0A(B BBBЩ 0eBDA JЀL DAB$)TЀ@̪AAU iA`A ,xBLK SPc DBB PLĪ8BBB B(D0D8DI 8A0A(B BBBA +04xwBJD G W DBBhf HTBBA D(DPj (D ABBE D(A ABB,ЫP0 (A ABBA #Aa<BBE D(D0 (D BBBA \B900|BKM N0a  DBBA '#0H̬PpBPN S(N0H8L 8D0A(B BBB ZH<PBBE E(A0A8G` 8A0A(B BBBA `ԯ3Gk,$ԭ8BFA kAB  $(5ADG fAAP DhBIB L(L0O8DPG8D0A(B BBBePLЮ vBBB B(D0I8L= 8D0A(B BBBA (DACF0Y AAA p0LıBBBB B(D0A8D` 8A0A(B BBBA د;(PBAD EAB$ @MDD d A \MJD q K x \NBBB B(A0A8D 8D0A(B BBBA JMA0*U\A8 ̵oIFB B(A0O(E BBB0\SBAA M DABv(qKBEA ~BB0رlBAB H ABE BGI \  $AQ(<tAAA V AAA h 2 $NBIA wDB AAB(ȲdSFBAD m ABA : $lSA F H F h8LFBCh}&8BNA N(DP (D ABBA O:PسԶ?AG uAM ܶAY(<<жQAOT- hAS!YTAM DA (дBOUPy DBA fPط ($RG A DHXBEB B(A0D8GPB 8D0A(B BBBA /Pĵط صԷ8@RBDD q ABA U GBB (G FLB4L_BDG0] GBE T ABA <XREBBB D(D0C (A BBBH Ķ)0HTU(Af0T?A| LI A  E TpT)BFB D(D0G@ 0D(A BBBJ U 0A(D BBBH ȷb@U'D \ A tU,pU(@lUAAD0 AAA lk/0U]LP@V BBB B(A0D8D@# 8A0A(B BBBA & 8D0A(B BBBE B 8D0A(B BBBC J 8A0A(B BBBE 44@Z 8D0A(B BBBE `lZBBB B(A0A8Dpx 8A0A(B BBBA  8A0A(B BBBE LйgpD 8A0A(B BBBE N 8M0A(B BBBE ( WBEA E BBA Lo (d8[AK c AP K AL 8BBB D(H@ (A BBBA (̺@HHYPDXB`I@ԴWB Q oa A 0AZH\4p [BDD y GBE DBm ĻAA0<[BAD G0J  AABA 00 \8D8\%X( AJp<\8\A A [#"AU E 4ؼ\DAAD  AAA  FAA @ X(^BBE D(A0G@Q 0A(A BBBB Z 0G(A BBBH k@Ld4BBA D(G (A ABBD  (G ABBB PgBDD G0p  AABK v  GABB k  AABA $d-0a GABh| f`iiBBE E(K0A8DP 8A0A(B BBBK  8J0D(B BBBI 4ԱPBAD  ABB AAB@LTHmBBD D(G@B (A ABBE V (G ABBB (2@a(J ABBпl@dBFE A(A0GP 0D(A BBBA <PP\`m^BAD D@C  AABA Z  DABD r  DABA @pHN y\ <C@ A \ E X A D A F E I B A8$PܲOAi A ^ A Dx<BNB A(A0U (D BBBA 0%xAY(,ABEG nBBX;  tG<xm($BAA U ABA $< A ABE  4 m}BAD y ABA qAB(Xd$BDD VAB T TABmR,!A[ D((OBAD k DBE  L#JT<ATH hDARL HHBBB E(A0A8DPp 8D0A(B BBBA /TPl"LUHpBJL B(D0A8E@W 8D0D(E BBBE 0h@Q8D0A(B BBB DBBI E(D0Ji 0D(B BBBA  ,OK@HWA(`BBDD h GBB $ C ABA 4BAD  ABB AAB4IIEA R BBA ZBB$) h@FBBB B(A0E8G 8D0A(B BBBA BFJGGS8kplhd`0\DXXTlPLHD@<84 h8 hBED D(G@ (A ABBA \@HxiBEB B(A0A8D` 8A0A(B BBBD 3`j jSAK W AA HkBGB E(A0A8GP 8A0A(B BBBD hPnQDo M P PneBBB A(A0 (K BBBF  (A BBBA N0(0pADD Z AAA \" $tHq<AAA vAA4`qRBA G@b  ABBE (AU@  ABBE @qBBB A(G0DPS 0A(A BBBC D&PdrRTc A Y<8sTBAD G0p  DABB D AAB4u0a  DABE A CABX sBBA A(J0R (A ABBE W (D ABBA A(A ABBX0tHs(DsmBND0u ABA 8sKBA A(D0a (D ABBA  Hs~BBB B(A0A8D` 8D0A(B BBBA P'`pPAN/(yBCG _ DBA , zND A S A m A UV&tz,PAYDHXT"AU E th$zXA| C W$<LztBFG R ABD ` GBB YAB(ADE b DAA ,, A AAE XP(TADD0k AAA  0( AAG@ AAD (q T@X@rBBB D(D0D`M 0D(A BBBF u 0A(A BBBC Q ``BBB E(D0D8GP 8A0A(B BBBB _ 8A0A(B BBBG  Z kP(@LxAAD V AAA ly 1 0TADD p AAE {DA6 AU8BBA A(A0 (A ABBA 4 404P\BIA A(G@(A ABB %@ 4Bq 2$.BDE PJD(  ACB@HtBEB G(A0GP 0A(A BBBA H BBB B(A0A8D` 8D0A(B BBBA  `8IBB A(A0(D BBB4 0@TOBJP A(A0G!0A(A BBB 1(QIDD p DBE $ - N DBA H BBB B(A0A8GP 8D0A(B BBBA Xi PxDP8LaBBB B(A0L(E BBB 8|BIJ A(Z (D ABBA 0,6 @PHBI@`BBB D(A0DP 0A(A BBBA 4 P8XH`KXBP[XM`LXBP )D d0(DnBDA cABp F 8 tBBA A(D0Y (D ABBA ,y j0` (A ABBE 4IKz ;$XXHe E bD H4\BED A(FPq(D ABB$_ PRXG`]XAP<BBB A(A0r (D BBBA  Y0d0 DH8XTBBA D(A0y (D ABBA , 0M (A ABBE HBBB E(D0C8J 8D0A(B BBBA  h0,D #Aa\ p #AaDBIx 8`BBA A(D0o (A ABBA  0*Ah0) HDH\@BEE B(A0A8D@ 8C0A(B BBBA  K@(2BEA _DB,Jt A qIFF A F0$x}BGH DP:  DABA X_ P(tUD X(G0P8F@N I A HBBB E(D0D8GP 8A0A(B BBBA o vP PNAK@@A, @DhXdl \H3Ak E A8 H4BIE I(A0D8Fp 8D0A(B BBBA Z p84vAQb AAE M CAA p mAZHHBEB B(A0A8Gp 8D0A(B BBBA  p,=A` A Z|0BDA D@{  DABC L  DABE I  DABA t  AABE r  HABI U DAB @4BAG  DBE  ABE K  `AU8d\AVT 8l BBB A(D0 (D BBB 0ĥgAq A s4 H$BBE H(A0A8GP 8A0A(B BBBA 4p$ YPG8D0A(B BBBX@BGD D(D0R (A ABBC o (A ABBE s(A ABB4cG0~ AO j AA dAS0LPL BEB B(A0A8G~ 8D0A(B BBBA M <gBAA D0H  CABA D DAB 0P)A] G C<P> HdBEB B(D0A8D@ 8D0A(B BBBE  :@HBDB B(A0D8DP 8A0A(B BBBA  HP$<p%AIE SAAd  XAAH(CBEE D(E0O (A BBBA B(M BBB8,NBED C(E0] (A ABBE ( ( L0C(C ABB8)L H`HBDB E(D0A8DP 8D0A(B BBBL 4 fPL 8C0A(B BBBA $x[\ A PHH8 PBEA D(GP (A ABBA H >PLdBBD D(G@l (D ABBH G (A DBBA p B@|AUOAILQBIA D(A0 (A ABBA X (D ABBE Xflp@lBBD G0  DBBA D  FBBE  f08BBD D(DPU (A ABBE  dP8LLp\BON I(A0A8D 8D0A(B BBBA H ANIBIcSBBI`BBBB D(A0| (A BBBB c (D BBBE A (A BBBE L 00lBDD D0F  AABH  G0`AO G DHrBBB B(A0D8G` 8D0A(B BBBA ((<:BDD W IBE $h & [ CBA \! +AiH`CBBB B(A0D8G` 8J0A(B BBBE 4 T`G8C0A(B BBB@L.Bd A B` xD<G t 4 A(V0D8B@I dZBBB B(A0A8DP7 8A0A(B BBBA \ 8A0A(B BBBE A SP@<&LAK D@w  DABE O  AABA 0 #@`0,BBB B(E0A8GT 8D0A(B BBBJ 3XBBI 8 BBA D(D@ (D ABBA <\ @D (D ABBE f (H ABBE @BAH D0o  AABA N8U@BHBPI09 0PBBA D(D0_ (D ABBE L (D DBBE m (A ABBE m (D ABBA Y (C ABBE  0x|KBA D(DY (D ABBH [ (A DBBD T (I ABBE Y (F ABBE D. eDED (A ABBE d8x6dFA A(DP (D ABBA 4OBDG@c ABE  ABA z@(^AJ QA $ m A(X0B8B@I $HD}BBA sBBp& 2 lBB8|BEA A(G(D ABBp>BBB B(A0G8G 8D0A(B BBBA 7N\AG[BBI\||\Di A H 3CoLBBB F(A0D8G 8D0A(B BBBA 4 h[BBIL $`/BEH \AB  OAE A A w AH0BAD DPc  AABE L5 &P$h45AAA hDA  WCA, 8(BBA A(K@ (A ABBA ( e@HHVPDXB`I@$,YLCG0|DBT 0l AY ]AD G AA  ] 0uLCA G0P  DABA  20$H8 AY`P<BBE B(D0A8E@P 8D0A(B BBBE T 8A0A(B BBBE 0U $@W8C0A(B BBB8dHBEA A(D0k (D ABBA $ w0@\BZ\H (tHcBAD0y DBA )Dd HBBB E(D0A8G` 8D0A(B BBBA , `L<` *BBA A(G  (A ABBA  HBBE E(A0K8DPV 8D0A(B BBBA s:P0(BAA G0  DABA \Y0x+N \0qBAA G@%  DABA @$EBAA }ABI   9X `8 L !D \d0 x$3D0_ A 0HBSA G@F  DBBA {@,xBBA G@ ABB+@(0BAD`X ABA \=`(t?BAA wAB4 A~ I !K A LBBA A(J`P (A ABBJ s (A ABBA H}`<d(BBB D(D0e (A BBBF (0`4'BBB H(A0A8G 8D0A(B BBBA M[BBI</ \Cp<BHB B(D0D8G^ 8A0A(B BBBA hOUBHRAKQA((TG _ A A(V0D8B@I 4@\BAA  ABA Z EEE xl 8iBDA D(G@Y (A ABBA 6 @HBBB E(A0C8D` 8A0A(B BBBA 4b`$Tx5BAD jAB| 8xBEA A(A0 (D ABBA (09Aw8 BBA D(A0 (D ABBA @ o0(\ `,IBA _ BBA  E  A \   , BAA @ ABA @   0\ BBD G0  DBBA  0\ BBB A(A0 (D BBBA { (D BBBE (A BBB, 0(A BBB< D`T A ,X tBAA J@a AAB @\ BEE B(D0A8JPXS`XhGpAxGQPO8D0A(B BBB P$ AAq E D@ <BBE E(D0D8E@W8C0A(B BBB @   @<Bt A  X8 LBEA A(GO (D ABBA , (H BKIDBt ~-H BEE E(A0D8E@^ 8D0A(B BBBA  G]@ $6A A h$(4XBFA KAB P( Z ABE tDj A } E >A|H8BGH E(N0A8NP$ 8D0A(B BBBA VcP@0\BBE A(D0D@ 0D(A BBBA tU_@!!A8"zBBA A(D0_ (A ABBA ,0@"BEE A(A0G@| 0A(A BBBA \z;@|0#KM8#AVa($#BBDD tAB+ ,#($(BAD Z DBA Pp h" |" H"}BBB B(A0D8D`u 8C0A(B BBBA `<%BBB A(A0| (A BBBA <YE0\%Jpj%'`H%OBNK E(A0C8FP8A0A(B BBB02Pc8A0A(B BBB(,&AAA  DAA XC 8p<'BAD Z ABA A(K0T(A $ n FBH Hh(BPG I(A0A8GP 8D0A(B BBBA  BP,@JD E AD D AB p" U+H+BEB B(A0A8DP8 8D0A(B BBBA !_P /   / H4/BBB B(A0A8D` 8A0A(B BBBE 4o"]`R8A0A(B BBBTQBEB B(A0A8D 8D0A(B BBBA *MKAYEHHN BBAAALmKLBBFDIBHGGQ4BBAAAL0!=\PA0.TBG EE6C (X.BEA M BBA @6 Xwt x A tm6 HdtBBB B(A0D8Dp 8A0A(B BBBB ,6pPxBYxDp-;Ay 884GD`BP83`8dXIDD  ABA [ GBB 8' LBBE B(A0D8J 8D0A(B BBBB S8 8A0A(B BBBE a 8F0A(B BBBE \ 8F0A(B BBBE  8M0A(B BBBE G 8M0A(B BBBE ,BBB B(A0A8GG`AV^Ah 8D0A(B BBBF HG`BfMQAT>HtOBBB B(A0A8G`] 8A0A(B BBBH 7?`|+DdBFB B(A0A8D` 8A0A(B BBBE  8F0A(B BBBA p(D`0IeI&,BAA W ABA I! HEBEB B(D0A8JP 8A0A(B BBBD TIGPHt BIB B(A0A8D`Q 8D0A(B BBBA _JS`(l wBDD0h EBA  fJ08$ BEA A(G@V (A ABBA `!JZ@d|0 QBBB B(D0D8DZ 8A0A(B BBBE  8D0A(B BBBA 4JCM 8G0A(B BBBE 4`(hBDE W CBA b DBE TJ  llcBBE D(D0D@i 0A(A BBBJ K 0G(A BBBE | 0C(A BBBA NJV@HaBBB B(A0A8GP 8D0A(B BBBA H8JPh'A\JXBBE B(A0A8D 8D0A(B BBBD JEASGQAcMDDPt TJ}PNADMAHMAOIB4AOD( t&RADA @ AAE ]3 f DAA  &D0s A !]0L!-)BBA A(G@_ (A ABBA  (A ABBA h!:]F@!X.!P]AV!L.JA` A g!0]9!H&5AG kAd"H.*BBB B(A0A8G@ 8D0A(B BBBA cHIPFHA@HMPNHA@l"\@p"/BBB B(A0A8G` 8D0A(B BBBD hApOhA`hEpThB`hJpWhA`,#\`%hJpPhB`X0# 4RBBB D(D0F@d 0C(A BBBF O 0A(A BBBA #^%@X#$2BBB A(A0D@N 0D(A BBBE  0A(A BBBA $^1@@($t4BEB A(D0D@V 0A(A BBBA l$j^(@$ %AJ($4AHH0h AAA $.^ 0DAA$<5>%^%$,%]3D \ L FL% 5BBB B(A0A8Gj 8D0A(B BBBH  FSAeFRBcFUA"FRB ERA%T]NEKB\AMDUCLAHTBKIBvIRBIMBCLA&lDG&jH&DBBB B(A0A8GP 8D0A(B BBBA ';jP4'(HH'" AF`'"t'"L'GLBA A(D@ (A ABBF  (A ABBA '~j@p'8"BBB B(A0A8G 8A0A(B BBBA YIKAjGKDNh(jFL(H\BFD D(GPd (D ABBE  (C ABBA (jP(I=BEB B(D0D8J 8D0A(B BBBA K\AiBUB~BXB}BWA4BZA 8D0A(B BBBE E]ABTA0)jB`A *Y *Mo!A_H8*XBBB B(A0A8Dph 8A0A(B BBBA * opH*8^iBBL E(A0A8G 8A0A(B BBBB *p+<` $+8`>D V A 8@+\`BBA A(G@\ (A ABBA |+ p@@+t#BDD D@U  GABE U  AABA +^p_@(+%EADE h DAE $,up: X CAA HH,$aBBB B(A0A8D` 8A0A(B BBBA ,?p`(,bAO\@D AAA ,pD@ ,$c^AD  AA -pn 4-$NHEXP-,dBEB B(A0A8Dpq 8D0A(B BBBA xJKxAp-ppX-pfFBBB B(A0A8GP 8D0A(B BBBD XJ`NXBP(. qMPH.Dh BBE B(A0A8Dp 8D0A(B BBBF xDJxBpxPLxBpxGQxApxGQxBp.q}p(."YBAIIAB/u 4/" ,H/"BAA  ABA x/u (/H#BNH AB/u d/@pBEB B(A0A8D`~ 8A0A(B BBBA hLpIhA`NhKpOhB`D0]uQ`Hd0(BBB E(I0D8DP) 8D0A(B BBBA 0BwbPT0\uBBB B(A0A8G@ 8D0A(B BBBA {HHPOHA@(1,w@XH1vBBB B(A0D8Dp. 8D0A(B BBBD xANxApX1wpXxIBANpxHMxBpxA\xAptxHMxBpH2zBBB B(A0A8Gp 8D0A(B BBBA L2|pl20((GZ A H2$BBB B(A0A8Gp 8D0A(B BBBA 2}p\2X BBB B(A0D8D, 8D0A(B BBBF FRAT3.2Xt3BBB B(A0A8G`M 8D0A(B BBBE hBpJhB`39`43BGu FE T EE R BA (4Ňb@4& XT4XBBB B(A0A8G`M 8D0A(B BBBE hBpJhB`49`4 &&Ab4pX5lBBB B(A0A8G`M 8D0A(B BBBE hBpJhB`\5,9`|5 d5BBB B(A0A8G`m 8D0A(B BBBE hBpJhB`hBpKhB`5Ɉo`d6ěBBB B(A0A8G`u 8D0A(B BBBE hBpKhB`hBpJhB`6o`6BBB B(A0A8G` 8D0A(B BBBA 7hBpPhB` hBpPhB`hBpbhB`hBpOhA`hBpOhB`07o$`$P7#FAG o AA DD|x7BBB B(A0A8GP 8D0A(B BBBF XJ`FXAP{XF`TXAPuXF`RXBPXH`OXBP7ˋP$8D#<BAA tABH@8̨BBB B(A0A8GP 8D0A(B BBBB 8P(8pVKAF j ABA 88BBB B(A0A8G`` 8D0A(B BBBB uhApQhB`hBpLhB`hJpLhB`hIpNhA`p9 `L9 "~BBB B(A0A8G 8A0A(B BBBA 9'@:BBB A(A0GPy 0D(A BBBE D:SPd:$x: :$;Ay:ߐ:$'Ae:(:$$;D;$LBB E(A0A8GP[8D0A(B BBB\;`gP|;$-N ^0;%aBAE z ABE BGI;D%$;G;$<8%GFK0R AA _,<`% @<\%kIf A \<Տ,t<%qBAA \ ABA <r <p<׏<%YA` vA=  =%4=A]$P=%LBCD ABx=X D=9BBA D(DP_ (D ABBA XC`FXAP8= Pw (A ABBE XA`UXAP>x*De,>AX@> %BEB B(A0A8DPx 8D0A(B BBBA XJ`IXAP,>PXO`NXBP>%Bb>:E$?'tAAD kAA(??1 $@?<(ABKE `HBh?0 ADB?D(<Az?F?X(`BI A R?*J B ?|('BS E L8@(BBD D(A0 (D ABBA L@ēu0Th@) BBB B(A0A8E@HHPIHA@b 8D0A(B BBBA @œ@\@)BEB B(A0A8DJ 8D0A(B BBBA QDFA@A(`ABAD0` ABA AP 0LA+ BBB B(A0D8G 8D0A(B BBBA ATBhBBB D(G0DP 0D(A BBBG P 0D(A BBBE lBJfP$B.kAJU0HAABh:0B /3AQ _ABj, (C(/fAAD N AAA 0CR! (HCT/SBBA  BBA tC/) Cl/gR0TC$#0C/ 0ClADD  AAA ADADx/8Dt/BBA A(I@] (D ABBA TD!@8pD/BBB D(D0 (D BBBA Dd+0$D0tAAD kAADK1 $EYLAG0BAA0E<%0HE\E5pE/'ETE/BBB B(A0A8GP 8D0A(B BBBA zXJ`LXAPEP0F`RBDL W GBE TDBDF81XFj0AT E UHxF$1BEB B(A0A8D`2 8A0A(B BBBA F.`HFBEB B(A0E8G 8C0A(B BBBH T0G\2.BBB B(A0A8E@HHPIHA@b 8D0A(B BBBA G4@,GBDD ` ABA Gc G2"HϔDAX A i$(H2dAJG0OAAPH˔G0hH25|HH 3GHH3BEB E(A0A8A@Y 8D0A(B BBBA H{@IV,I_ @I3{Bd A `I5xI4IhBIG  BBA HBBTIHBEB B(A0C8DPp 8A0A(B BBBA NXG`QXBPLJ PPXD`QXAPoXH`FXAPIXK`GXAPoXH`FXAP4lJ]BEG x BBA HBB8JBBD A(D@ (D ABBA 8Jk@~ (F HBBE D(H ABBLKBBB B(D0A8DZ 8D0A(B BBBH lKɓK1<K1BEB E(D0D@0C(B BBBKEH@HL\2BEB B(A0A8D`_ 8A0A(B BBBA LL!`tlL3BEE B(A0D8DnHAAI/JPINt 8D0A(B BBBA 4L5CAAI,Mp5BAA l ABA LMZ hM5$AbM 0M5BAA G0  DABA MŕH08M@6BEA A(G(D ABB(NDN6 (XN6GADD w AAA (N6mGED B DBA N=  `N7*BBF B(A0A8G 8D0A(B BBBA PBBI,OΔ$LO=DAFD vAA$tO=kAAD bAAOݖ9 HOhfBBB B(A0A8GP 8D0A(B BBBA PP8 P=BEE A(D@^ (D BBBA \PG@xP>6A\ A WP;P> P./Ab A J0P=BAA G0r  AABA Q 30<0QL>BOE A(A0G@0A(A BBBpQ&@HQ>BBB A(A08F@Q8A0h (A BBBA Q0Qp?9X `RH(R?BEB B(A0A8DP 8D0A(B BBBA tRPRA HRYBBB A(A0 (A BBBA 8F@Q8A0R0(S@UBHA x BBA H@SZBBB B(A0A8GP 8D0A(B BBBA DS2PKXC`OXBPXA`PXBPXC`QXAP@S8@/BBB N(D0G@V 0A(A BBBA T@T8TBBB B(A0A8GP 8D0A(B BBBC XK``XAPTZPT@ T@9X `TƘ$T@bAJU0AAU00U@XA] N LUxY8dU@BBA A(D@W (D ABBA U> @0UBOO D@k  AABA U~@ V0A( V#@8]XHBDD  ABB J ABA | ^IBEB B(A0A8D`[hGpJxEGGN`b 8D0A(B BBBA ;hEpGxEEHP`^`H^\MBBB B(A0A8E@i 8A0A(B BBBA , _/K@HDPIHB@$<_'BIE SABd_" BLI_x,_tP H_BBB B(A0A8GPy 8D0A(B BBBA _P0`PFBMA Gp* AABL`p8h`ķKBBA A(G0 (A ABBA `S0,`TwBAF c ABA ` H apBBB B(A0A8G`g 8A0A(B BBBF XaY`xatTNADaaTrA`0OAa#0$axAAG PAA bzP m(M0I(A 0bT;EZ E RPb<{8hbTBBA A(D0 (A ABBA bn0b<P\BEE D(A0 (A BBBA -0(VBDD } ABB ܍ CAB̂*AY A F S 4-D hLAF`dBBB B(D0D8GP 8A0A(B BBBF Y 8A0A(B BBBA Ȏ>P$AF@BAD D0P  FABA A  JABE DAFP\0KBEE D(D0DP 0A(A BBBA WXY`DhBpIP( PeXZ`BhBpIP܏AFQBBB A(D@H (I BBBE [ (G BBBE o (D BBBA c (I BBBE Y (I BBBE k (G BBBE }@DpA `G GȐܐ$%AZ A HD$LOG D  AABK H  CABA l4DBGS D(D`(D BBBڶz`ܑЀjAj A PLBEE D(D0DP 0A(A BBBA [XY`DhBpIP,LȶPFXZ`BhBpIP(|\AAA s AAA 6 @BBD Do  HBBE _  DBBA H \_BBE A(I08O@Q8A0 (D BBBA l0 BEE E(A0G 0A(B BBBH P 0J(B BBBN \ 0G(B BBBE V 0J(E DBBE ` 0J(E DBBE d 0J(E DBBE L<BBB B(D0h (E BBBE h (E BBBA ֶ0@ BGL H(A0J@u 0A(A BBBA 4@Ga _C , @(D _ A d\ BBB B(A0A8D 8A0A(B BBBA f 8A0A(B BBBA ĕohnBBB B(A0A8G@S 8A0A(B BBBA \HFPOHA@{HFPOHB@HDPOHB@hHFPOHB@HJPFHB@HDPSHA@vHDPQHA@HFPOHB@HFPOHB@bHKPGHA@oHJPFHA@Ė @LBBB B(A0A8GJ 8A0A(B BBBK 4ETh33 BBB B(A0D8D@U 8A0A(B BBBH kHGPGHB@| 8F0A(B BBBA HIPSHB@HGPFHB@}HMPPHA@tB@HGPFHA@HQPGHB@~HIPFHA@YHQPGHB@O 8D0D(B BBBE _HGPJHB@d;xD6TBBB B(D0A8E@THGP\HA@A 8D0A(B BBBA R@H;BBB E(A0D8Fp< 8D0A(B BBBA Pp(p WAAD G AAA  =ș~AU*iAY =6`J KH(BBB E(A0D8GP 8A0A(B BBBA (tPGXM`IXAPH,=BBB B(D0A8G@q 8A0A(B BBBA A@( SAAD0_ AAA 80DPBAD f ABA S(I0I(A i(L0F(A  ,Ab̛Q4]BAA ` ABA U(L0I(A Z 8#AaP.1d<Dv A /9@x<BMJ D(A0Q@ 0D(A BBBA ؜.@(=AAA  CAA $ (<p>AJM AAE h]8L@AJD@r AAA HHPPDXB`I@$[@IHTPBXB`N@L@ BBG B(D0A8GJ 8A0A(B BBBA 48T~BIJ A(W (D ABBA ,}SDBIJԞ:3AW E U$~PAG [ DE _D$`JBAX A b A DD~)Ag\p~HJI8JBAD s ABA D ABE ԟ~9X `r JAs A F A $?<~P!AY(h~9BDA nAB   AAB$t~7BAA oAB  @t~BBB A(E0GP 0A(A BBBA (<czPHXY`DhBpIPh~<A\ E YH~]BBH A(D@ (D ABBA eHVPDXB`I@LT@HBEB E(I0A8L` 8A0A(B BBBA P8`pH4$FBAG xAB) آBZH HVBIB B(A0A8GP 8D0A(B BBBA XGIP(xtIBAD0T DBA D0LIBEE E(A0A8D 8A0A(B BBBA  X,MBIB B(A0A8Gpx[TxApZ 8D0A(B BBBA pHDPBBB B(A0A8DpR 8A0A(B BBBA KYpL؀BBB B(A0A8Dj 8A0A(B BBBA d4DL(BBD D(G@+ (D ABBA p (A ABBE (ԥ@(E ABB$PDBKG iDB(  ,@ ,BDA g ABA p< HBNB J(A0A8G 8D0A(B BBBA ئgk$VBAA NAB  H8ą\BBB B(H0C8D@T 8A0A(B BBBA A@hOWBBB B(A0A8G`b 8A0A(B BBBC e 8A0D(B BBBA  8A0A(B BBBA 6hOpRhA`hQpPhB`hOpShA`hNpQhB`hJpUhB`hPpThB`dhOpThB``,BKF Gp DABШLp@bBBB A(A0G@ 0A(A BBBA 08@(P;BAA sAB|{  HBBB B(A0A8Dp 8D0A(B BBBA p0XBAA J DAB8HTbBBB B(A0D8D^ 8D0A(B BBBA =P|d}BBB B(D0A8DpC 8A0A(B BBBB k 8H0A(B BBBE H 8H0A(B BBBE @jp8`BBIH A(G (D ABBA 8fBBB D(G@ (D BBBB Z0@4Lg[BED C(G0(A ABBH604dXgBAA [ ABA m ABA   gGHԬ8hZBBB B(D0D8F` 8C0A(B BBBA  r`@l,Aj\Qth?AS A 6HkBEB E(D0G8JPn 8A0A(B BBBA P(e*<BN E C\0lJ!BBB B(D0A8D 8A0A(B BBBA K 8F0A(B BBBE a 8G0A(B BBBE D 8F0A(B BBBE < 8I0A(B BBBE ] 8I0A(B BBBE D 8F0A(B BBBE @ww 8F0H(B BBBE B 8M0A(B BBBE K 8M0A(B BBBE T 8M0A(B BBBE į8InN#HBEI E(D0D8D@` 8A0A(B BBBA D @d؇;x4nBHE A(E0J(D BBB(İ 0A(C BBBDBEE B(K0A8GPk8D0A(B BBB8<P,X[BDD G ABA  HABBB B(D0C8G` 8D0A(B BBBA C`̊MAP zA0# (H3BDH aABtu x"%BGB B(A0A8J JECGGGGAGf 8A0A(B BBBA  (,@sCD0N ABA X+0pz,MIj AE xFȳ$<ܳbPAC u ABA CF $ ,8DwBAC C ABA ha$ ,ȯBDD @ ABA 9 Hд BBB B(A0A8Gp 8D0A(B BBBA 0$DAAG@AAl@8jBBA D(A0 (D ABBE $܉KAKD xAA%- +&AR,@AD vCLj I DA lKBr A H E ('R PH̉BBE E(D0D8DP_ 8D0A(B BBBA 4 PTXH`WXDPuXC`IXAPHDBEB B(A0A8D`M 8A0A(B BBBA R`XBEB E(A0D8D` 8D0A(B BBBA hPpShA` `H,BEB E(A0D8DpG 8L0A(B BBBE 4xppZ 8C0A(B BBBA $mADD aAAظ @LFGBD C(D0N (A ABBA W4X#FNHLpBBB E(A0D8G`y 8D0A(B BBBA "H`<ԒDBBB A(A0u (A BBBA  08ēSBED C(D0Z (A ABBA T-0p̓9AX ^A(MBG0y BBA 0HԺHoBBE E(D0D8DP 8A0A(B BBBA  P@L4THBBED C(E0h(A ABB+0D$AbĻXEػ$lsAFO!O$0<Kd K X K | A 0XBJA D@O  DABA a@Ht8BBE B(D0A8Dp 8A0A(B BBBA 4_pD8M0A(B BBB8,0BBD D(J0Q (C ABBA hg0h6#(4BBA A(G@(A ABB@6Ap( fAAD V AAA H! `LkA^ E $0ADA `DAT4NBB A(D0GP 0A(A BBBA aAP %P ,&LY@8DBBB A(A0D@Q 0A(A BBBA |@H BBB H(D0A8Dps 8D0A(B BBBA 9p8$BBE D(Gy(D BBBD~H`lBEE E(D0A8GP 8A0A(B BBBA 1P(8FAD ] DBE $L b CBA \ ̧BEE B(D0D8GpxGGFVp( 8A0A(B BBBA p,<BIK M` ABBr`<FrA D BBE B(A0D8GP8D0A(B BBBhPHtLBB B(A0A8D 8D0A(B BBBA O@ BBB A(A0G 0A(A BBBJ 86hXT) BBB E(A0A8G/ 8A0A(B BBBC AFFQI^1+`BBB B(A0D8G 8A0A(B BBBA GGGY\:|0BIH L0z  AABA 0, (@AJ i AA (9BBD hBB Db LBB0hKAA K ABA h$; kIB(AD A[ (UBDG0Y GBE ((BAD b ABA T! 8p7BBD A(A0 (A ABBA 0(gBDA SIB(H5ADD ` AAB  ,4SHH4BEB B(A0A8D` 8A0A(B BBBA `8hBBA A(D0 (A ABBA En0  <I r$# 84Ko[@PlBIB G(A0W 0D(A BBBA 02AVDBI(fAAD V AAA ! 8 UBEJ A(D0t(D BBB(HBAD0O DBD HttBBB B(A0A8GP 8D0A(B BBBA P$UAFK0@AAy@0H ܿBEB B(A0A8D` 8A0A(B BBBA lU`$DADD xAA  AUvABBE B(A0D8GGEBNoWBEQ^ 8C0A(B BBBA X 8H0A(B BBBE  8G0A(B BBBE {`@\BPG I(A0G8GZ 8D0A(B BBBA LVDBI@0`BKC Gp}  DABA mp AZHPBBE E(A0K8DPV 8D0A(B BBBA (PHd8\_BPL H([(D BBB0 RIBIDpBLP L(H0K8E@8A0A(B BBB4 q@Z 8A0A(B BBBE LL'BDE E(A0A8G# 8A0A(B BBBA Q$OSG ^AAA 1 8BD ] EE e FE m EA HE8 (PABDD ^ ABA 8| BIH J(A0W(D BBB0<DBBB D(D0[ (A BBBA 0H8BEB B(A0A8D`U 8D0A(B BBBA 8`|_BBB B(A0A8G`8hPpShB`k 8D0A(B BBBA hGpShB`hFpQhB`hFpQhA`$h+`$DuAAD lAAlK9 (=ADD _ AAA @ dBEE E(A0D8GPIXH`QXAPeXF`FXAP 8A0A(B BBBE 40sP} 8C0A(B BBBA (hD?BAA wAB <H8BEE E(D0D8GP 8A0A(B BBBA mP0A`0_AP4@00hTJ~ E Y A P E A B _($OA\ E Y A N4t;BDD a ABA AGB$|ADA TAA8A <P\HBBE D(A0 (D BBBA ,z`0\ (A BBBE <<BEB D(A0 (A BBBA j:0H EBB B(A0A8A@ 8D0A(B BBBA l8/@`0BEE B(A0C8JPXH`SXAP 8A0A(B BBBA AXI`SXBPPX BEI E(A0A8Dp 8A0A(B BBBA kxKTxAp,lT*pxHSxBpHPBBE H(G0D8GP 8A0A(B BBBA PH}BBE B(D0D8E@B 8A0A(B BBBA T=@tCAy 0BAA D`  AABA q`0BAA D0y  AABA ,s0HTKAAd A A lA A TAAwH>BFB B(A0D8Dp 8A0A(B BBBE  V1pL@\BBB B(A0A8G 8A0A(B BBBA {HYBGL L(A0A8DP 8A0A(B BBBA &NP<BBA A(GЀk (A ABBA \Ѐ0|0CL A I E D A ] A Dl>B{T0xAWTl 0$hBOT C, AABXt $AMA AA   , ZLAA   ABA  H  <(P ^AKD  AAA | ,(BOP gPR AABP|qf gE 0 4LPBAD  ABB AAB$HdAAD VAApl H:(t6ADD c CAA / p AH$h'BAC TCE(p=BDD c GBB H CAB8l`uBDD E ABA G ABB TDmBA A(D0J (A ABBA t (D ABBE tL(DtA` A H D [\`BFB B(A0A8DOUAj 8A0A(B BBBE H-^ 8A0A(B BBBA OYB8 BEA D(D0X (A ABBA H0 dh(AG0 AB (0@\BBB A(A0DP 0A(A BBBA }P<yGBE D(A0](A BBBAD0dAH| BBB B(A0A8DP8D0A(B BBBLP4į\BAG P ABA R GBB    08tnAAN0Y AAA xDAl0QCAUD ~ A % ARChAY A L j'$$=ADD nDA(LvBAD _ DBE x%  IABHt_BHB B(A0D8DP 8A0A(B BBBA PHhBBB B(A0K8DP 8D0A(B BBBA Po?P<pJIB A(D0V(D BBBN048D BBA A(D0p (A ABBA y0TBEE E(A0D8GPSXK`JhDpIPg8D0A(B BBB#P&( MOD@BGH E(K0K8E@8D0A(B BBBX-@$, BFK G0b DAB!T0LdBBI D(A0J (C BBBA Q (G BBBB HXBBB B(A0A8GP 8D0A(B BBBA P$h'BAD UDBHp^BEB B(A0A8D` 8D0A(B BBBA 8g`XdPAa A (tfAAD N AAA !   HBHB B(A0A8DPk 8D0A(B BBBA ,Q3PL``P<tBBB A(A0j (D BBBA [0HBIB B(A0A8G`n 8A0A(B BBBA  `@ l_ y A G `l 5GG0YAALj0p IAG    8D s .   A < P d wR0d|@0Tl8BBE A(E0Dp 0D(A BBBA xXBBIpp t AD0 AA ,\B08D JAH O AAE AAAA\,BBA A(B0a (D ABBA S (A ABBE | (A ABBE I0 +Ai0<HD BEB B(A0D8D`C 8A0A(B BBBA m` , BRD e DBA 0 8$BFK A(D0* (A ABBE ,L0c (A ABBA X| 3BBB E(D0A8DwHWA 8A0A(B BBBA }44,AAD  AAC A AAA 0& THd5EBBB B(A0A8GPt 8A0A(B BBBA XC`FXAP?P,<6BBA v BBA 6  6KA~ A J,{[dD6BBB B(D0A8DP 8D0A(B BBBE  8C0A(B BBBA 4VP8H0A(B BBB8:.BBA A(D0 (A ABBA @ {[0N8A@M8D08A@M8A08B@I8B0(d:1ACD M AAA $:RBAA JAB>2 $:tAAD kAA01 (,;GBED xAB<) X4;>A|t @;GzGNT;OBEE B(A0D8G`hGpWhA`` 8C0A(B BBBA 4`Y 8A0A(B BBBE \@|=BFB B(A0D8GXIA 8A0A(B BBBA @@AU<@BBB A(A0Dp0D(A BBBD04pw 0A(A BBBA K0D(A BBBx@>An A AA#A]8ABBB A(GPn (D BBBA >PA(D c4 / HDLD u E IhF x A HhAD00LABDJ H(A0A8N* 8D0A(B BBBA  8 lJBBD A(A0(D ABB\ K"p K 0 XBEA D0?  AABA  0@ KBBH E(D0Or 0A(B BBBA  ]8 KA`0hAX ]0<p LLLBKD A(Ge (D ABBA  S4 @OBAD o(I0R(A _AB @  O4 GAEXP BEL D(B0o (A BBBE a (D BBBE A(A BBB pOH lO1BQB J(A0A8G 8D0A(B BBBA  K<,  BDA G0  AABE D AABHl PBLE B(A0C8D@^ 8D0A(B BBBA L @}@T 8A0A(B BBBE K8A0A(B BBB8 OBBD A(D0p (A ABBA D 1Q0` ,PAL$| 0P9ADA iDA0 HPIBBB B(D0D8DP  8A0A(B BBBA K 8A0A(B BBBE ,` @S%A_XA I8pSBBA D(D0 (D ABBA b0TFRA TAD z AA  (  UADA  DAE LeN dUxU0Ajk(HUBBA A(A0j (D CBBE K(A ABB/0HUvBBB B(A0A8A@ 8D0A(B BBBA `@V.$VoAAIPaAAx0W'BHB B(D0D8D] 8J0D(B BBBE \ 8A0A(B BBBA H 8G0D(B BBBE 8XWlWAP`WLBB B(A0A8D 8D0A(B BBBA MHBXn8 0[BED A(D0\ (D ABBA H(04d[SDD0Z AAB  AAA E0`8\BSB B(A0A8N 8A0A(B BBBA ,FAB]D288t_BBD A(E0 (D ABBA t00(gS'Tk# '@D e E F A F '|D } O D E |$'(k}BFD0jDB(0084(hkvBBA A(C0V (D ABBA p([0(k"8(LBBB G(D`U (A BBBA ( g`(TkMD H)?c H$)xkBEE B(D0A8Gp 8A0A(B BBBA p)BHp() lbBAA ZAB)> )4l$)AY(*8lPAAA { AAA 0*; H*Dl^A\0`*llBAE j ABE nAB*8+*T <*lBBE A(D0 (A BBBA (*[@0o(F BBB8(+UFD " DBA CB$d+3  AAB+l@AI tA+L L+lLBBB B(A0G8J 8D0A(B BBBA 4,DQXBBI(L,нBDG0L ABA x,0`,S:BBB B(A0D8G 8D0A(B BBBE D8D0A(B BBBH,n:BBB B(A0A8D`g 8A0A(B BBBA @-`$`-t:BAD hDB-  -tNAn A @- BBB A(D0L@ 0A(A BBBA ./E@L .IBEE B(G0D8G 8D0A(B BBBA 4p.|[BBI.sAD |.0: @.tLDE A(I0G@ 0D(A BBBA /@8/Tu$HL/#BBE B(D0D8Dp| 8D0A(B BBBH /p$/ulAAA fAA/1 </4BBB A(A0 (D BBBJ 80[0X0tnAX A x0$u-Ak(0IBDD08DB40LnBAG  ABA \ ABC 0 1lLA{ A 8,1tBBA D(A0h (D ABBA h1C0L1XvBIB A(A0M`FhHpWhA`1 0A(A BBBA 1\p`01xwMBDD G0k  DABE $(2x0z  CABA `P2lwBHB B(A0A8Dp 8D0A(B BBBA 8D0A(B BBBh2^py 8D0A(B BBBE ` 8J0D(B BBBE ( 8J0A(B BBBE  3,yAI0834yXAAF0B AAA DAA l30 H0V AAE 3TBU0>QH>D\>@IAGx>tX>pBBB I(A0A8D`I 8A0A(B BBBA mhVpDxBI`>Ts`H?BBB B(A0A8DpL 8D0A(B BBBA HT?BEB B(A0A8D 8A0A(B BBBA ?_(?DADG0l DAB ?"H0a CAA H@ BBB B(A0A8DP 8A0A(B BBBK \@ PL|@BAA b ABE A ABB M ABA KEB@ 0@TBLA Du  DBBA A\8AĉDAzTAHA~pA, $A(<BID0iABA0`A( BEE E(I0D8GPN 8M0A(B BBBB  8D0A(B BBBA 0(BwPD8A0A(B BBB(\BBGD0_ ABA B*00B,aBAA G@G  AABA B@LBLBBB B(D0A8G' 8D0A(B BBBA 8@Cn 8D0A(B BBBE T|CnBBB B(A0A8GP 8D0A(B BBBA yXL`IXAPC P,CؐBFA U ABA $D6 . H@DlBEB H(D0C8GP 8D0A(B BBBA D fPD yHA A nD" (DTADD w AAA E  8(EĒBBA D(D0H (A ABBA dEH/$xEdKADA BAAEf  E0Be E C<ET3BBB D(D0 (G BBBB (F 0C(A BBB(DF8|BDD } GBB $pF C ABA 0Fԓ]BDD G0y  DABB $FeU0b  CABA Fؓ G~GГ0GnHDGȓBBB B(A0D8D@ 8D0A(B BBBA G@G GdG$?BOB B(A0A8G[ 8D0A(B BBBA  8E0A(B BBBE @H_`HtHAYHHH=BEE B(A0D8GP 8A0A(B BBBA H9vPX I'LBH D(G0GP` 0D(A BBBE D 0A(A BBBA hITH|IBEB B(A0G8DP 8D0A(B BBBA I P8I BGD D(L (A ABBA $$JID K(J0I(A R A LJ  H`JBBB B(A0A8Dp 8A0A(B BBBD Jz ~pHJBBB E(A0A8Dp 8A0A(B BBBD K rp,8KBAA F ABA hK Y HK8KBJR L(G0H8J`l 8D0A(B BBBD K `$KDBAD rDBPLcBHE A(A0I@HNPEXE`I@t 0A(A BBBA lL /@LbBBB B(D0D8FBIBID 8D0A(B BBBA BNGjHQG]HNAo0,M{ rBEBTD`M<BBA D(G@_ (A ABBA bHMPFHA@M L@`MBEB B(D0A8D@f 8A0A(B BBBA l 8D0F(B BBBE (N 9@XHN:BHB B(D0D8GPGXL`LhHpIPJ 8A0A(B BBBA Ny PN,NDBAA D0 DABO {0$$Oȝ$BAA [AB LO@ E Y ABA pO)AcO]Af A tO% .<OBAA Gp  AABA R AAB$P pK  AABE (PTHBDD j ABB S CABSFH}S1TAUT;Bx8Tn&PT< DdT8BAD0| DBG I AMA A CBE T 0 CBE (TOBDD b ABE T% _CBH U|4BBB E(D0D8GPH 8A0A(B BBBD lUHPLUPBIB B(D0A8G! 8D0A(B BBBG UHUBBB M(A0A8G 8A0A(B BBBA HVB(hVTVBDD } ABB Vw CAB(VdRBJA @BBV. WAX A q@ W\QBAA G0  DABA Z  AABE dW0LW\BBA A(D@E (A DBBE t (A ABBA W20@Wе_A]$X4'BIE SAB0X BLIPX̵PdXSDD0k DBB D CBE \ ABA ML0X0X\0AfxXBEE B(A0A8DP 8D0A(B BBBH k 8D0A(B BBBA b8C0A(B BBBhYHP$YԴ=BAD kDBY  YԴ(YAAD  CAA Z$,Z$D _4ZHZA\`ZtZdZ>BBB B(A0D8G`2 8D0A(B BBBA  8I0D(E DBBE Z`8[LBAD s ABA D ABE 0L[BDE ] GBE NAB$[lABKE `HB[ ADB[t8Me[~R[\3AW E UL(\tBBB E(D0A8D 8D0A(B BBBA x\k\!A_(\>BDD j ABB \ CAB] 0]AAD ~ AAA HAAL]k% d]Hxx]BBB B(A0A8DP 8A0A(B BBBA Y 8A0A(B BBBJ H 8A0A(B BBBF ] P^& (^CD c E F A KL^`^>t^8D s^  (^<7BDD W FBE $^|& [ CBA H^xBBB E(D0D8B@s 8D0A(B BBBA @_.@H`_BBB B(A0A8K`Y 8D0A(B BBBA ,_&`HhVpDxBI`4_ ADB  AAE I DAA ` A AAE 48`BED A(G@e(D ABBp`T@`$`>BAD lDB`ԾBZ`p`aL\$aBBB A(D0e (D BBBE T (D BBBA M (D BBBE a08aXABBA A(M@$(D ABB8a@HHPPDXB`I@eHTPBXB`I@HbkBEH F(D0D8GP 8A0A(B BBBA hbsPbľ?P c E F0bBDA Dz  AABA bH<bLBBB A(A0 (D BBBB ,0c80S (C BEBE 8`c|BBD D(G`f (A ABBA cw`c(cUADD { AAA 8cBED D(D@e (A ABBA 4dB@(Pd<\BDD g ABE ,|dK x EBE ACBd@9d Ad,AbdQHe;BFB E(D0D8NP 8A0A(B BBBA Pe]LPpeeea Ae,AbeBQHeBBB B(J0G8D`\ 8A0A(B BBBA ,(fU`WhUpBxBI`Xf(lfBS G BA Q EB fD Hf BEB B(D0C8Dp 8D0A(B BBBA f<pHgpBBE E(A0D8Dp 8D0A(B BBBA hg'3pLgqBEB B(A0D8GN 8D0A(B BBBA gHAug 8 hBBA A(D@l (A ABBA HhMAs@8dhXBBA A(D@[ (A ABBA hhBc@4hBBB A(A0(D BBBhwC0$i'AIE NGA8i;C ACA$XiUBAD JABiB  iHi BBB E(A0A8Gp] 8A0A(B BBBA iBsp(jtFAD s ABA DjCp P`jBBB A(A0c (D BBBA c (A BBBE jC0LjHBBB A(A0 (D BBBA  (A BBBE $k_C-0DkXkXClk$k 8D0A(B BBBA 0$pEeUBBI<XpDBBB A(A0S (D BBBA (p'E 0A(A BBBp8pBBD D(G0G (D ABBA qD00qtD W A LqE" $`qL,BDE SGB,qDH f DBB J CBA q$&(q@EBDD wAB qD  AGBr@+AG0aA0|;^BKC I@ AAB4-PBGD0V8U@BHBPI0ABL `\; t,D;BBG D0 DBB$PR0A8X@BHBPI0;AD0|P0 ;]G0U $P0A8U@BHBPI00HlBNM K  DABA }OIBIP8?BAA W ABA L AEE 8P HTH@BBB B(A0A8Dp3 8D0A(B BBBA RPp<BBA F0e8J@N8A0Y  DBBA Q40 pAGwBQ\@A}BBB B(A0A8GtJdA~ 8A0A(B BBBA T_QJHKBGdBJJA4C\IAA cABAO 0U dLtBBE E(A0A8D`" 8A0A(B BBBA  8G0A(B BBBE T `8Ԟ8CBBA A(D@ (A ABBA iT@<,CBIB J(W6 (D BBBA DlTPPEBIERDBI(EHȟ$EOBBB B(A0A8D` 8D0A(B BBBA Us`04GmBBD D`O  ABBA $h!U)`\ DBB(GbBAD I DBE T  4ԠHGGBAA s DBE AAB `GAQ$$hG6BAD dDBLpT AABl`GIAG0{A5TM0xG8VT P̡GBOI A(A0G\IPA0A(A BBB, S)yJNAPT dIxIT8HmBHA D(G@ (D ABBA ܢrT1@T$AR E K(ITAIG0W AAA D(JD0o A 0`JYLAD s ABA IABT J#AaģSأJD0x A S0$-BAD bAB0K{Ml8HKBEA A(G(A ABBGSE$KAAA RCADȤKBEB E(A0D8D`8A0A(B BBBSj` 0LL[ADTAT&S[$lpLSADI BAA(LEBBG uBBS HܥLOBB B(A0G8JPd 8A0A(B BBBA (RpP(HLgAAA u AAA (t(MqBAA | ABA S `MAJ A0ܦS I(P0D8B@I U(T0B8B@I 0M'ANKHOPRHA@AADT@\N$pNBAD nDBT2 NħN4ArzT&N  N( `TAY(8NQBDA FABdTz NOcHVT4Y A RШT}T%ATlO#OMbTAU0OBBD G0\  ABBA BAA cNDT WCBȪP/AiT8ZBHD A(D0 (D ABBA 0S0@L@PBJI A(A0D@w 0A(A BBBA wS@ PBPB,ԫ(QBDC \ DBA $H` A J A PH,OBBB B(A0D8D@ 8D0A(B BBBA xR@,dEBAD  DBD Ȭ?ܬ@Q),\QeBCA Q0I AAB !RL0\<PBBA A(G0U (D ABBE b (D ABBA ^(D ABBX QkBEE E(A0D8GGbA_8D0A(B BBBQ$R'BAA [AB @(RE Y ABA <dQKED G(GP(A ABBA R PlR_ԮQAVRG,SBDA G@ AAB8Q3@(ThS?BIA nBBQ- 8`SBEA A(G(D ABBدWQSD0T A /Q0$T,Af@Q $XT7ADA gDA$TTAAA GDAP  TEA{ܰP 8ULBE A(A0(C BBB0IPS0(P\UBDD U ABA 4|UMBDD s GBB AABUȱP(ܱUGBLA sBB O  ABB,pGHHUBBE B(A0A8D@ 8D0A(B BBBA 4IOP@a 8A0A(B BBBE `̲ VUBBB B(A0A8D 8A0A(B BBBA D 8H0A(B BBBE 40NDO 8H0A(B BBBE hVxD l A N 04WBAA G0a  AABA ̳Ng08TIFL L(A0F(A i BBA $$O J BBE $L WLADF {DAtO  0WAD ~ AA fOf 8ȴ$BDA A(F@ (D ABBA xOJ@H BBE B(A0A8GpX 8D0A(B BBBG lZO(pTDBBB B(A0D8 0A(B BBBA O 8HtVXBBE K(H0\ (M BBBB A(C BBB8TVBEB G(B0f (D BBBA gN#0VKAIĶVN"(ضWsBAG0d DBA 8N0@PWBHA G@L  MABE Q  CABA `M@`|WBDB B(A0A8D 8A0A(B BBBA yFHB] N]h]aBHE B(A0A8G 8A0A(B BBBA  AGGGG`6N@eBHA G@N  MABE Q  CABA N@0LfBHA G@P  MABE $44O@a  CABA `\fBBB B(A0A8D 8A0A(B BBBA  FIEX@O0 mBHA G@R  MABE $O@w  CABA <PhP&BHE B(A0A8JO 8A0A(B BBBA AFGFIXO1$ܺ'BIE SABO BLI$hg YX KDlXl)Ag4plBAG@lHVPRHA@d ABA O!@8lBBA A(M@ (D ABBA 8Nr@AHTPBXB`I@sHPPDXB`I@8DmAUTO%dHl0mzBLD D(B0O (A ABBA m (D DBBE 8O=0_ (A ABBE B(D DBB(m,Ae A O6($m(Aa A DO60\ mBKA D0s  DABA yO=08m*BBD D(D0  (D ABBA ^O0nOAK E C88nBBB A(D0(D BBBtmOR0oHAg A ^O"(ȾtxBDA kCBaO= 0gBAG t GGE AGIDDnxBEE E(A0A8D@O8D0A(B BBB0O@J8C0A(B BBBnKAd A dN6(nbBDD ~ GBB $$N C ABA Ln9Am E AlN Jn*AY I 4 oLBD D(K@d(A ABB(N@(Ho_RG U DE dC N(H 8do ,L`oBHD G0k AAB|{NN0oA\o+BKB B(A0A8GSDBIMIBBBXLUGDDDDDDDIG 8A0A(B BBBA `M( qgAKV0{ AAA $PqAAA AARZ (@BDD@" ABA  S@^ DBE (<PqYAAA F AAA htS' 09ADD c AAE ACAOSG @ qBBE A(A0GQ 0A(A BBBA :Si(0SBAA ~AB\SA(tq'ACD P CAA LT  $:T@AID lDAHHqBBB B(A0G8D 8D0A(B BBBA @T`x'(tx5BAD jABxAV(xBAA ABrV 0(yiBEB g BBE URD(8$AD z DE ` CA dVZ f DE y yh@[BBB B(A0D8G 8A0A(B BBBK VBFGFJShV 8xYAJ0C AA \V@0D8V@DHBPI0x$D _HxDBLP B(A0D8Gpl 8A0A(B BBBA VpHyABLP B(A0D8Gpk 8A0A(B BBBA PVpp|z-(zeAGA J AAA V zhAX MAVD <zIBB A(D0 (A BBBA @Vw0`\{JD ExV @{BBB A(A0D@ 0D(A BBBA ~Vi@,,|BID x BBA  V:  <|dBD K EA `V x|0VY$|%AAG0YAAV804|BBA D(D0(D ABBV90$} AZ@V X&AR E MLx|BII G(H0G8G@ 8D0A(B BBBA 4QV@RIBI}}!A_,W@}AQX{WA4p}GAAD V AAA [ AAE 8BLA A(G@ (A ABBA V@H}-BBB B(D0D8Dp 8D0A(B BBBA L{Wp8lP~\BPL H([(D BBB0W RIBI(@EBA BBXC $XB A @,MBw A \XKtHAQ`ZLBB B(A0A8Np 8A0A(B BBBA r 8C0A(B BBBE BAD0pDBDwU0\AAxVMXBKB B(A0A8D`QhPpDxBI`  8D0A(B BBBA ,Un`thTpBxBI``'D \ B 8V( ^ A D@TX'BBB A(A0G@/ 0D(A BBBA U>@H$"BEE E(A0C8D` 8D0A(B BBBA L7BFA G(FPM (D ABBE  (F ABBA hLU4Ph0BHA Gp  DABA Ump,TwBAA J0d AAB=U00(4]BEG JBB`%U! 0|BDA J0c  AABA 4T0Z8S@DHBPI0O8W@BHBPI0Ġd BBB B(A0A8Dp 8A0A(B BBBE  8D0A(B BBBA dT<p$8qA[8X@R8A0hAT0HxBBB E(A0D8Dp 8A0A(B BBBA aTpp 0AG ` KA $TPADA GAA|eU  $Ab>U D$AbU  AZ T%d$ AZ@T%dX AZtT%dhKBA G0  DBBA l  DBBE v  ABBE D  ABBE 4sT(0PE0I ABB0ܣ$D _(HBDA  ABA tT `P[BBE B(A0A8G 8A0A(B BBBA O8H0A(B BBB4S[E8H0A(B BBB(1H<@IBLP B(A0D8Gp 8A0A(B BBBA SpH$BBLP B(A0D8Gph 8A0A(B BBBA SpHTBLP B(A0D8Gps 8A0A(B BBBA `Sp<BBB A(D0 (D BBBA S00\DXxUFA A(D0r(H AEBP0,<T0 (D ABBA (l8BAG jABH4 BBB B(A0D8JP- 8D0A(B BBBA TmP& TCD c E F A K<TPABEE E(A0A8D`hHpXhA`D 8D0A(B BBBE PTu`D 8D0A(B BBBE  8A0A(B BBBA (P~ADG0v AAA (UU0 @AGP| AA dUP(|tAHD v AAA pU' (Eg E L<$ U 84DBc E Y`XdFEE D(A0[ (A BBBE v (D BBBE ^ (C BBBA T90XeBBB B(A0J8DPXP`DhBpIPS 8D0A(B BBBA ,8=T~PLXT`BhBpIPHh+BBB B(D0D8G 8A0A(B BBBA ?TEHBBB B(D0D8G 8A0A(B BBBA  TG$@?TSBAD HABhjTH$|IBAD ~ABvT l8lBGA u DBE B ABA  &T& <(BBB A(D0s (D BBBA (hS0M(A BBB(>BDD g DBB $S< _ CBA (AJG0O AAA SQ00,`BAG D0x  DABA `S 08|BIA D(G (A ABBA fSoLBHB B(A0A8G 8D0A(B BBBA 88USV 8E0A(B BBBE txt p$D _,xBLI DpT DBBmSOpHBBB B(A0A8E@ 8D0A(B BBBA 4LTS@O 8A0A(B BBBE 0BNA W  DABA ,S}SDBItA[+TLXe BBB B(A0K8D 8D0A(B BBBA dS?$ (+D&THLBBD D(E0| (E ABBE N(C ABB\pTx0x$T (BAA ABpT[ 0PBDA J0l  AABA 40{T0Z8S@DHBPI0X8W@BHBPI0<hBBB D(A0JPr0A(A BBB8T;PHXS`DhBpIPXW`BhBpIP=At B AbU L,UBBB B(A0A8G 8A0A(B BBBA @| UM EESA9BOB|$aAY;D va$ A(P0F(A 8$BED A(D@ (A ABBA `au@(| BDA AB a5 mAB`>Ai E JDAB a$L CBBG A(Dp (A ABBA [xXBBIpp pap4 ;BEF ] BBE ADB &Ad@ BHA G@M  MABE r  CABA $ May@@ <#T ah DRAD0HD iad0k AB < aBDD G0]  KCBE R AAB $'AeD <BBB B(A0G8A@8D0A(B BBBH a@(h pBFDpX DBA  apH BBB B(A0A8JP 8D0A(B BBBA  aGP8 BBA G(D@ (A ABBA T a)@p R za  3YY( ,2BDD `DB .a ACB$ 3BAD hAB`( 4.FEE A(D0t (A EBBE A (D BBBE U (C BBBA  `?0D BBB B(A0D8Q@l8D0A(B BBB0 \`@A8A0A(B BBB(X<BBB B(A0J8D`}hPpDxBI`R 8D0A(B BBBA ,_s`AhTpBxBI`2Bg E C40 , $( 8$ L ` t  `FEE D(A0[ (A BBBE A (D BBBE U (C BBBA ^?0$ 3BAD hAB@HBKB E(D0D} 0D(B BBBA ^%@@BKB E(D0D 0D(B BBBA G^%`$FEE D(A0[ (A BBBE A (D BBBE U (C BBBA ]?0(T:BDD W IBE $]& [ CBA (@7BDD W FBE $(]& [ CBA $P]3BAD hAB$x3BAD hAB4BGA u DBE p ABA B] (XLBEA BB |4,AjP\U(hBAJ0n DBA \ 0(D b\> c A LBBB B(A0A8GL 8D0A(B BBBA 0|\@PBFB A(D0G@ 0M(A BBBE 0]@a 0C(A BBBA LTBBB B(A0A8J? 8A0A(B BBBA 4E]@FIASHPBIB B(A0D8E@} 8A0A(B BBBA c@`pc0AnRc"$GL@BKB B(D0A8Gp 8D0A(B BBBA mbSHP%BKB B(D0A8G 8D0A(B BBBA HTbz\hbBBB B(A0G8IzUEBI 8D0A(B BBB-AkdD(dBDA A ABA   d (8GBAH a ABA dc 8BBA D(A0 (A ABBA c+0dKAAcR A |AQ(ocC @lTLF o EA d`xQBBB E(A0A8G~EGGfO 8D0A(B BBBA 4b<KAGGv8xwBBD D(A0I (A ABBA Pc0l6icSDc.LKBHB A(G0 (A BBBA J (D EBBE  c#0,AYDc,Xt/BDD  ABA c Xd P8Av_d\XAY,"d@LAAI0uA`c0xd!clASpXA A HXBBE K(H0\ (M BBBB A(C BBB8(BEH A(B0c (D BBBA dcI08,OBIH A(G (D ABBA b0$BKE G  DABA  `c(AGPAHc;P`<#0tXsBEA D@w  DBBA c!@Ay F XBb_ac |`$ -BBB B(A0A8K 8D0A(B BBBA MUBBI bz( 4BHA Q ABA  c9  6D m!c \!D i A 8!$9P  A $T!H6BDA kAB|!b  !H!D !@,!\68!BBA A(D@h (A ABBA  "bA@@<"0BBB A(A0D@ 0D(A BBBA "a>@"0HT A R"0Bm"a"IJ A #X \BV A 0#aH# 4Bq$d# \BAA TAB#Naj # AF(# BIDD ^DD #\a ACB4 $ tBBD A(D0`(A ABBD$a00`$ BDD J@i  AABA $`2@$, $Ab$`$0 <$, 1BBB D(D0D`U0A(A BBB00%g`` 0D(A BBBA Hd% jBGH B(D0D8D 8D0A(B BBBA %b % AU% JAH&4 &0 0&Ge4D&( :BED D(A0c(A ABB|&0 /AM ^A&d& ` AA 8&0BAD s ABA D ABE &  ' d 'lBBE B(A0D8D 8D0A(B BBBE  8D0A(B BBBA 'dy'T AF'L GA A E'9d'd EAC( d(,( eBEG r BBA 8X( BEA D(A0D (A ABBA H(8 gBBB E(A0D8D`q 8A0A(B BBBA (Pc;`H)< TBBB B(A0A8JP 8A0A(B BBBA L)cDPl)0 (), 3BEG \EB )c  AEB@) BBE D(D0DP~ 0D(A BBBA *brPH4*h BBB E(D0D8B@U 8D0G(B BBBE 4*b@I 8E0A(B BBBA * =AD m DA 8* nBED D(B0B (A ABBB (+1b0A(A ABBD+ 0X+ BBD D0   DBBA +a0$+GADD {AA+zc +)Bf,[cK$,HADD |AAD,fc \, p,,,,,,,-Ak-bH-.BBB B(A0D8E@ 8D0A(B BBBA h-Ybj@H-dBEE E(D0D8DP 8A0A(B BBBA -WbP0-BBA G@   DBBA (.b@$D.PADK }AAl."c .)Bf.cC$.QADK ~AA.c . /TBG EE,/bC @D/(BIB A(D0K 0D(A BBBA /b0/BKA K  DABA /bi8/BLA A(K (D ABBA 40 c<P0BLA A(K (D ABBA 0Tc<00@BID A(K (D ABBA 0c81OBIH A(G (D ABBA D1d8`1 >BIH A(G (D ABBA 1~dL1BFA D(G@ (M ABBE H (C ABBA 2d@0$2hBHA G0K  MABE $X2!e0w  CABA 02BHA G0K  MABE $2\e0w  CABA 820BFD A(GP (M ABBE ,3ePa (C ABBA 0H3BHA G@Q  MABE $|3 f@w  CABA L3(BFA D(G@ (M ABBE D (C ABBA 3)f@42BBE E(A0A8G 8A0A(B BBBA DGFGFX" 8A0A(B BBBE AGGFFV4f$4$vBFA iAB4|f X5X$BBB A(A0DPD 0G(A BBBE  0A(A BBBA 0p5fEPc 0A(A BBBE d5UBBB B(A0A8D` 8A0A(B BBBA ] 8E0A(B BBBE 0 6@fG`x8A0A(B BBB @6L%VBD ` EA d6/f D|6p%pBIE A(A0K= 0D(A BBBA 6ed6(&BBB E(A0D8D` 8A0A(B BBBA  8E0A(B BBBE 4L73f1`Y 8A0A(B BBBE 7HBBB B(A0A8G| 8A0A(B BBBI IGGGJ^BGGGJ^8eZ(08,%<BAD qAB(\8@%<BAD qABH8T%FBE E(A0A8E@ 8A0A(B BBBE 486e@s 8C0A(B BBBA H 9%BBA A(K@UHVPDXB`I@ (A ABBA X9ke7@8t9&BIA A(GP (M ABBE ,9JePi (C ABBA 9|';A'D9(pBII D(A0D= 0D(A BBBA D:e8d:)SBIH A(G (D ABBA : f8:*SBIH A(G (D ABBA :rf;+<(;+BAD D0O  MABE | GHD4h;f0b  CABA  MAB;L, ;H,BG W QE ;g+ fD;,A\ < g8 <,mBBA A(E0G (D GDBE (\<f 0A(C ABBH<,nBBB B(A0D8DP 8A0A(B BBBA <TfgPL<.@BBG A(Dp (A ABBA XxXBBIpD=Kfp(`=|/:BEI aBB =f ADB$=l/wBJ EA =Sf(8=1]BEA G(A0Z (D ABBA ,>1-N ^D>1 X>1l>e8>1BEE D(C0p (D ABBA >e08>T2BBA A(G@ (D ABBA ?Te@$0?3IAAA CAAX?e @p?3BBB B(A0DP 0A(B BBBA ?QeP(?H4>IDE _ DBB @e XCB @<4+AI _A@@d (X@4AAG e AAA @d @3:Ab I @4HAi E @H4 @D4 @@48Ae E LAd$0AL4=ADD nDAXAd4lAp4AkdAh4(Ad4BAD q ABA Ad A4HB4mBBE E(A0A8D@` 8D0A(B BBBA LBc@<lB4BBB A(A0& (D BBBA Bnc08B8BBB A(A0(D BBBC+t)08(C4:BBA A(A0 (D ABBA dCs$08C;BBB A(A0R (D BBBA Cs 0HCBBBB E(A0A8G` 8A0A(B BBBA (D@?`HHD$BBB B(A0A8DP 8D0A(B BBBA DPDBDAzHDBoBBA D(B0X (D ABBA w(A ABBE C1Ak A CBDD j ABB Q CAB(Q\bbBDD ~ GBB $Q C ABA $Rxb{ADD0oAA,Rjb0DRb$XRbAKV@\AARxH@$RZAKV0uAARb/A_ A (R@BDD rABSbSb'A_88Sb=BEA C(D0 (D ABBA tSf00ScAT0ScBDD G0g  DABE $S*0b  CABA 0TdBDD D0  DABA BDD j ABB Xl CAB@|lBFB A(D0G@ 0D(A BBBA lL@4l܈BBA A(A0v(D ABBmt!0$4mCBAK qAB0\m@eBDK n ABE EOE$m|IBAK wAB0mħPBAD D0Y  AABH m 0 nTPAN`{ AA ,nfAI I AA 0Pn̉BDC G0  DABA n#D ^n' $nBAK ABn  @nܧBEB A(A0DPe 0D(A BBBA 4oP To(At F H F ,xoNBAD 5 CBA o oxAQo|/D jo H pCBLP B(A0D8Gpl 8A0A(B BBBA Xpcp xpdEAN`p AA (p*BAA R ABA p}+ p|BG qEqp (qċEADE h DAE DqK: X CAA (hqċADG0 AAA q5=0q0PANPAq:/P qHEAN`p AA rtOAfO X8(rBBA A(B0{ (D ABBA drњ0Hr1BBB B(A0A8M 8D0A(B BBBDrHPDBIrTBBI@sBGB A(A0DP 0A(A BBBA XsXPxsBAI vAs s,YQl D sp$D _sAUt%dttAU4t%dHLt`KBLP B(A0D8Gpp 8A0A(B BBBA tmptDAUt%dt0 @u,BHE A(D0GPx 0D(A BBBA DuXu\@luBBB A(A0D@ 0A(A BBBA uP@u >AF0uAu0v.AG dA(v @v (TvAAA { AAA vI ,vtBAA  DBA v @vBBE D(D0G@ 0A(A BBBA (w j@HwWLD G0`wL~BDD G@E  AABA wWR@(w|AIT0~ AAA wak0wx;Aq$x (A|(x,VBDD } ABB yߙ CAB0y<DyXy4lyy,<y(BBB A(A0 (D BBBA y(?0y?At E z+ F E T(0zBAD AB\z Hxzԕ$BLP B(A0A8G 8A0A(B BBBA 8zV  8A0A(B BBBE @{|BBB A(A0D@ 0D(A BBBA D{ߚ@d{AX{h H{BBB A(A0g (D BBBA A(C BBB{0<|BEE A(A0 (A BBBA D|x04d|YBED m BBE SBB|  |]A[|Y|+Ai}H }.BEB B(D0D8B@ 8A0A(B BBBA l}L@}}L{}}ģwG o }r A(U0B8B@I ~(~BIG ABD~: $`~YALS0vAA~d6Ae A ~D O E g A ~ A ~@&Ad~lH$h BBB B(A0G8Dp  8D0A(B BBBA p_p8zBBA A(G@ (A ABBA @AKAK?AX E `8LD B A hܚ( |2R^XLPADD`H AAA p HAE D HAE IAA !`(${BAG0h ABA P}[0(hVAGpI ABA _pwHp$'́ ,L$oBBB B(A0A8G 8D0A(B BBBA XȚ]DJJ}zH|BJHJxDJJJHxLDJHHJx<KHHm;MrAJHJx0l6Ae A Lt/ldx+ BBB B(A0A8GDpBP 8D0A(B BBBA GhBԃd8BqA>DpBUEqAZEqBeDgAiBqABhAKfBJkADgBGqBEqB(̄@IADD x AAA [.G 8LmBEA D(D0j (D ABBA LN.U08hd{BEA D(D0i (D ABBA HBEB B(D0H8FPV 8A0A(B BBBA -" P<$6#Aa8<0XBEE D(C0Z (A BBBA x6-0,4BAA  ABA Ȇ6  (ظ?BHD mAB]<" ,,иBAA D0s AAB\3< 0(xOACG0V AAA H(BDI F(J0A8D@B 8A0A(B BBBA <0BQB FAS(xbBAA [ ABA @< X@lBBB A(J0Gu0A(A BBB0 BDD j ABB 89 CAB<\BEE A(A0x (D BBBA ,9o0(^BAD SAB$O9- A ABE (SBDA HAB<(9 X2A\ F $t87BDG0eAB8 0\AB8.Adؑ AH  OAr A Z88L OAr A Zl\8(O8 BAC VAB$C8APN0lAAԒ88TAR8 ,@8 T(h8BED dBB p8 ABB@MBBG GWTAr CBB8 ,,PGBD yDBA$\7 MBB8xBBA A(D0 (A ABBA m7\0$ܔ7AAD xAA :Af A H A H(7XD<BBB B(A0A8GP8D0A(B BBB8>P99$̕9HBDD zAB`BED D(D@ (A ABBH t (G ABBB r (A ABBA X91@t9AM8xUBEA A(G0u (D ABBA (=BDD k ABA @AAD0 DAE X ADE O AAA `820xT $PXAn A Y A M ZAn A Y A ؗ8 ZBu E Y$8L `'D bx8 8BBA I(Jr (D ABBA Ș7X ,TkBDD D@U DAB(T9J@0DxBHD G0|  AABA xN9,0(BAD x ABA 29 ؙd8Ag I @BHA D0q  DABA N8V@DHBPI0@8TIBBB A(K0G@ 0D(A BBBA |`AVL$pBIB D(D0D`~hKpUhA` 0A(A BBBA 8[`<ԊBBB A(A0j (A BBBA H*AY I 0dmADE g AAE pCAH4BBB B(A0A8D@p 8D0A(B BBBA y7@0hjADE g AAB pCA,8fBAG G0M DABh708BBA A(D0J (D ABBA 6Al0ܜ@mADE g AAE pCAH|BBB B(A0A8D@e 8D0A(B BBBA \HpBBA A(K` (A ABBA chXpBxBI`5`,؝BAA j ABA TAC I (TAUDP5%dL\@RBBA A(E0C (C ABBE ~ (D DGKE ( 5 0A(C ABB8؞$BBB A(A0(A BBB,4?0I (C BBBA DhXt;Ayt4!z4AT6̟d43AmB4JDAB04$ HAD  AA l4 $gAN Y JE aJ3 QCȠDAB3$4BAA ` ABE XHB,H~3( E KDE ICB4xBBA A(A0(A ABB>3<0X̡PBBB B(A0H8D` 8A0A(B BBBA AhXpBxBI`(3Z`HHd2BBB B(A0A8DP 8D0A(B BBBA 2 P48;BDD a GBB AAB@,Aj24 <BBA A(A0(A ABBXQ2@0(tCBAD xAB$A^(У>BDD j ABB 1 CAB@ BAA K@d  AABA AHXPBXB`I@d1@H BBB B(A0A8DPX 8D0A(B BBBA ̤`\X(dEBAH pCB,40> X CBA IDNdXDAB0$8tLAA Z DKE _ CBE ԥ0;(BAE k CBE <80 I CBA `lAD  AA  0 2AG hAЦ'Ae/,@@9BBB A(A0DP^ 0A(A BBBA //JPMyH K?aTاAD0A/B0LRAB E 0/ZZ A @LpBAA r(R0H(A A ABA wDM / *AhȨ.$cAAD TCA. ACA(<AKG0I AAA hc.00LBAA G0Y  DABA ..0ЩHBBA A(D0V (H ABBE (H CBB<D-B0S (A ABBE I (C ABBA 88SBBA A(D@B(A ABBl-q@ܪ@$-8HBBA A(A0 (A ABBA @k-f0\\BBA A(E0Y (H ABBE H (H ABBE n (H ABBE (U-0I(C ABB'-AY$>BBB `HK<- BEK\#p,,FAc E ܬ,"a`AZ$t,C,<@BAD  ABA l0, AD zA,A  AG N JE , LCL3RT<tBED G0k  AABE H CABX@,=0,ta,BID G0 DBBD,BBB E(A0A8D@8D0A(B BBB,@aBDD B GBB $>- N ABA (DX>BDD j ABB p- CAB(H>BDD j ABB , CAB(8>BDD j ABB n, CAB4(4H$sBDD N ABA LGBlhd`-Ab A ذ+,\Xd,p@|T]+/D _ E FHthBDE E(D0C8Fp 8D0A(B BBBA  8ԱBBB D(A0s(D BBB<*S0g (A BBBA U(D BBBP,)ADA p*  ADA'Ae*,$IJXBAK FABPUj*;Ya AZ4&AdLY*$`9AAD pAA5* ,{BAA n ABA г * HBBA A(MP (A ABBA oXU`BhBpIP8)BPTPh4LAJ)cXd)AY$ԴXt>BAA vABH0BBB B(A0K8D@S 8D0A(B BBBA Hs)T@ht |P)'H D ̵@ V)L8BBB D(D0 (D BBBA F (D BBBE D(00d ) HxBBB B(D0D8GP 8D0A(B BBBA Ķ(P<')BCJ D0d8S@DHBPI0F AAB$D { A @o) T!h)| )4GY@TGBD A(F0T (D ABBA ])07GY4$HQ)\pAY)HBBA A(B0l (A ABBE A(C ABB(Q0WBp A c$(8DHL(`lA0tBAA D0I  DABA i(q0(Ĺ8BHA yAB(]  K\ E S,(2@AY\( <tBBB D(A0y (A BBBA g(L0<ԺxBBB A(A0` (D BBBA S,:044ArLU,0`BKF Gp  DABA *,+p@\BEB A(D0Fa 0D(A BBBA XBBA D(D0F8K@GHFPI0I (D ABBA [8N@GHFPI0tP,BBE E(D0D8GpI 8A0A(B BBBE zxOHA\pY 8A0A(B BBBA ȼT(Ab+C8PxBBA D(D@Z (D ABBA 8*@0TxJADB U AAA dAA0BAD D0t  DABA $P*(0W  AABE LBEB A(A0t (D BBBA E (D BFBB 4*0HTXmBIB A(D0G (A BBBE }(D BBB|)$QBAD FAB ܾh)$ T ABE 0BAA D0  DABA 44)L0@P BAA G0  AABA q  FHBE  )0HBEB B(A0A8Dp 8D0A(B BBBA 4(rpS 8A0A(B BBBE ,4BAD F ABA $dh,BAD ZDBpJAHhAUU(%d|6An A AB(&H(WBBB B(A0A8DP 8D0A(B BBBA t(`Px0( AK<lBBB A(D0 (A BBBA '90 7Ac E M@'&X lAU'%d7Ao A A'& '8AQ E ` '8AQ E `,'8AQ E `L-D hd'8AQ E `x-D h'8AQ E `p-D h-D h'8AQ E `  -D h8'8AQ E `X'?AX E `xd-D h'8AQ E `\-D h'8AQ E `'8AQ E `4-D h '8AQ E `@'5AQ B `$` (PZ B J B [c(-Ab A ;(,(>BDD j ABB #( CAB4AUP'%dh5AQ B `HBLP B(A0D8Gp 8A0A(B BBBA w'p400,AUL(%ddAU|(QHBBA J(D@[ (A ABBA HHUPBXB`I@'@<P8BBB D(D0 (D BBBA <m'%0,\0mIDK B ABA LB' @X#BBA M0R8P@DHBPI0  DBBA $&?0B8T@BHBPI0@BBA M0z  DBBA A8U@BHBPI0T&0pA\(KBHA wBB x&  AEB<BBI A(D0 (D BBBA &%0x<pBBB B(A0D8DP 8D0A(B BBBA V 8H0D(D BBBE x8H0A(B BBB%1P@BIB A(A0G@ 0D(A BBBA s%@8<PAJD0@ AAA H8V@DHBPI0x4%04QBDD a ABA A GBB  $$,@$TALPwDtW$PBV A (zBDD U ABA  $ 00A_ A 4DpBAD S HBE CAB@# \`)AcxtVk#/AF%4BBD D(C0(A ABB"#j04 \rBBA A(D0^(D ABBX8# 0(tUBED EBB" (PBED w BBE " ABB< !BBB A(A0 (A BBBA Lh"~0,lpBAA i ABA "H HcBBB B(A0A8G`. 8D0A(B BBBA v"`H$\BBB B(A0A8G` 8A0A(B BBBA 8p#`rhCpLhA`hDpIhB`HBBE B(A0A8Dp 8A0A(B BBBA $epBEB B(A0A8DU 8D0A(B BBBA {JIA:CGAPPBWMGFSPLBDEIQDGJS LEGN0$z qDLAT8d BBB B(A0A8E@ 8A0A(B BBBA qHFPQHA@.@d BBB B(A0A8E@ 8A0A(B BBBA DHOPIHB@]HRPFHA@/@T8 BBB B(A0A8E@ 8A0A(B BBBA qHFPQHA@e/@4 AAE J AAA u(C0Q(B /" , BAA o ABA 0/G 8Lp BBA A(G@r (D ABBA /@XBBB B(A0A8GpI 8D0A(B BBBA xBKxAp/p$ \jAAD aAAH101 H`BEB B(A0A8DP[ 8D0A(B BBBA /P0PAh eA(`fAAD N AAA ]0! 0pAh0EAP$dtAAD kAA 01 YA` vA0 $@AAD AA/A (0fAAD N AAA \/! HtBEB B(A0A8D`. 8A0A(B BBBA /`X<BBE B(A0A8DP; 8D0A(B BBBA hXG`SXAP8</&PqXG`SXBP\XG`TXAP$xGADD {AA1 YA` vAe1 4AAE a AAA _(C0Q(B (21* H@LBEB B(A0A8D`. 8A0A(B BBBA 0`D@1#@HBEB B(A0A8D`4 8A0A(B BBBA $1`0D8BAA G0  DABA x62H0<LBBB A(A0V (A BBBA "2,0DTBBA A(E0R (A ABBA a8D@S8A0<10XBBE B(A0D8D 8D0A(B BBBA ] 8G0A(B BBBE H 8M0A(B BBBE  8I0H(B BBBE R 8M0A(B BBBE D 8M0A(B BBBE 1=v 8F0H(B BBBE @ 8I0H(B BBBE J 8M0A(B BBBE  8I0H(B BBBE m8M0A(B BBB4.`BEA D(D0I(A ABB 30( .kBAE _AB82 (T8.ADG0j AAA 2&04.BDA v ABA bGKk2 $.%AAD \AA8.BHH D(D0s (D BBBA P1+0,p,/BHA  ABA 1R /AP1/AL0LEE D(D0k(A BBBAC0Lz10(l00lADG0Y AAA >1E0D\0]FBB B(A0\8D@F8A0](E BBB#140<T0BEH D(D0GPf0D(A BBBX0!PHx0BEE E(D0D8GPI 8A0A(B BBBA 0qP\0BEE E(D0D8GP 8D0A(B BBBA W8J0D(B BBBD0PAXO`MXAPQXN`MXDPCXN`FXAPRXN`GXBP^XN`FXAPN 8J0D(G BBBE BXN`GXBPG1AY0B[0oE{10,1+D fDc1H X1.Adt{1 $16BBA VKK$(1:BBA ZRD8@1PBED D(D0g (D ABBE (0 0A(C ABBD(16Ap\0p<1!A[0C<1m041&J0 <<1BBB A(A0G@0D(A BBB00+@P1 $d1OBIB gKK/ ADB1*/1zAD sA/B  1 /AZ81AM0P1BAA G0  DABA P/08\2BBA  BBA k DBE . (3PBDD0} ABA $.0< 3P,3 d(3Dx$3BIB B(A0D8A@8D0A(B BBB.-@L3BBB B(A0A8Gt 8D0A(B BBBA 0t.M$P46AAD0mAAxy.%0T4QBMK H(SJGGGGqR(D BBB,..kAOIBID5BEE E(A0D8E@8D0A(B BBB`!.@4<6eBEE A(C0J(D BBB0t6BDD G0e  DABE $-]0  CABA 6 (6 @<6BJG D0R8P@DHBPI0o  AABA $n-Z0G8T@BHBPI06AJ LD-m Q AA 63JcA@6BBB D(D0Ig0A(A BBBHm-F0h-BAA L CBE qAB-0-xAPD0P DAE DCA0x6BEB B(H0G8DpD-p^ 8D0A(B BBBA pxIZxApH`7zBEE E(A0A8DPL 8D0A(B BBBA . P7t/H8BBB B(A0D8GP 8D0A(B BBBA @n/;PH`/BLA D(B0 (D IBBE A(D ABB(/BDA AB($8YBAA QABI0 0 <8tBAA D0A  AABA T0&0pl8 h80Af|8#/8/|8+Bh{/x8BHB E(A0A8GH 8D0A(B BBBA F 8G0A(B BBBE 8G0A(B BBB8/ 8J0G(B BBBE X:&Ad08T:BBE E(C0c (A BBBA Di0E0,d:BIB D0m EBB^0I0x:VBBB B(D0D8E@V 8A0A(B BBBE W 8A0A(B BBBA w 8D0J(B BBBE ,; (@;IAA ABl/9 8<BBA D(A0a (D ABBA ,/*0C (H ABBE (</$ <=AAB rAAD_/( eAAHd<BIB B(A0A8D` 8D0A(B BBBA 4/`t8J0A(B BBBT=CAx E S/%\ E C$X/A(<P=8ECE bAAAhd= B]h= B]Dl=BBB K(D0D8Dph8A0A(B BBB0E/pXxMBBIpH=BBE B(A0A8DP 8D0A(B BBBA h/(P>$D _>/>2/>>T?,P?@L?TH?8hD?BBD D(D0c (A ABBA .T0l?aBM OB .4 A(V0D8B@I . 4.vBBA A(A0e(D ABBHPL?BBB K(G0A8D` 8A0A(B BBBA ,.\`HhUpBxBI`? $?TBCD GABL?BBA A(D@G (A DBBE T (A ABBA Xq.A@8t(@BBB A(A0(A BBBZ.e0H@BBB B(A0A8GP 8A0A(B BBBA S.=P(<ABDD f ABA hDBAJ AA  .%BlBH A  . CmAK A _pC|CmAL@[D0- @HC>\-(pCUBEA HBBU-Q $C;BAD pAB$C\BAD QAB:-  L .-<BDD G0z  HABE I  DABE  AABpC C 4-UBD A(D0(D ABB0CA] A O E I A M A I0CBHC D0  AABA 82.%0T;.QAG E CtEX.| EsAW`U AA .$`$EAg A t A `.F(,FVBDD } ABB X0. CAB|F',F ((FdBLA PBB- -mD0h8FdD0_-00|FD@zH-@0\F>BNA DP  DBBA -_P0HBAI G@j  AABA -.@-dAP QAH&D ]4- FL-)D Y E Fl-H'D b- -)D d-)D Y E F-hAP0UA<hHBBA DPVXB`KXAPT  DBBA D-ZP0`HBEA DP}  DABA -P,IAU0IdAD ]A-D PhIBIB B(A0DUOKA 0D(B BBBA X-xJ JAU($J@BDD nAB - OCBJH  JBEE E(D0A8F`u 8D0A(B BBBA XJPBX E p@xJBIE A(D0D@ 0A(A BBBA D,N@H0K=BBB E(A0C8DP 8D0A(B BBBA 0(&,EPv8A0A(B BBB\KD ` A x, (PLAN0j AE ZC,0 L}AIqA4MPBIA A(  ABBA ,&,*(HN\ ,/D _ E FH|MBEE E(D0D8F` 8D0A(B BBBA (NAD J DE z AA +A   OD K H z A 0+A DOD  H O A h+: T|0PBIE A(D0DP` 0D(A BBBE D 0L(A BBBE 0+_Pt 0C(A BBBA TtPBIE A(D0DP` 0D(A BBBE D 0L(A BBBE 0`f+_Pt 0C(A BBBA @P1BAA D0  AABE ~  AABA M+20<QBDB A DBE P ABE ^CB4#+ 8LQBBD C(D0^ (A ABBA *H08RBAG B DBE Z ABA * RA1+$RdAD ]AD+: \RA]t#+R DRBBB E(A0D8Fp8D0A(B BBB0**p[8A0A(B BBBL4SJDD Q(A0A8B@AHAPAXA`AhApK Z ABA h`*H 4hSBEG D(Gpb(D ABBS%SAPS'AJ E O S$AJ B O,TASHTAUdT^AG TA)  DA,T (TpAG C AA B)8 (\TVBDG0l GBE  6)n0\ ABA @ )!JSX TT:AJ A mx i) c)AU f)CAA( ,BAF QIB a)8 a)BIB D(A0(D BBBD ) X ) l ).  *: 1*=H Z*vBEH H(A0D8IC8D0A(B BBB * R c*0 R*CD *hX * l p R R *4 *9BED V BBE JBB4 *<BDD _ ABB JAB, *@ QT *h Q| Q  F*b * Q *3 * *A tQ8 *BHD G(D(D ABBX d+l d+ Q+ E+fAZA@ +uBBB F(A0A8]0A(B BBB ,fAUA@ 5-wBBB B(A0E8_0A(B BBBdh.(x.LBAD AAB4 /BGD A(G@(A ABBH/yBEE H(G0A8JE8D0A(B BBB4(/BGD D(D@(A ABBH`x0{BEE H(G0A8JG8D0A(B BBB4NBDD D(G@(A ABBo0@Hm0vBEH H(A0D8IC8D0A(B BBB,LO8BBG J] ABB|g04f0<BDD _ ABB JABj04^09BED D(A0b(A ABB4_0;BED D(C0b(A ABBLb0`S1tS1 N41'1,1jBDD D0W AABR1&Ad\1 $S18\1,L]1BAA D` DAB@|1y]BB B(A0A8J0A(B BBB35Hl.3 :3.3A 3j4,v3cBDD O ABB AABd3\x3 L33]440G h644AI hAJ4 A(A4<04P,4d4LxT4'H^_4'H^(j4,BDD WDBj4AUe4?A}4kAi,42ApD4"X5ClPJ 55 5 $5/ADD aCA 5.AlI I (4;<5%VKTIhI|5AT52cK5$"54ADA kAA.5!JS75!JS@5!JS4H!JSL15!JSd:5+Ai|M5!JSV5!JS_5!JSh5JAH5AA5&UP5(5<H,AfX5p5>Ax5YAN A D5oAd A D56(AbGAU%6=N6?4,y6;BEA D(F0[(D ABBd|6FK|y6ATw6ALm6 AH_6,w6s6 k6g6(f6#<u6Pf6df65x6O6EE6 6 u6|6 q6,a6@R6T?6'hR6#AaY6 N6,f6HH6 y6 q6 f6 ,_6 @X6 $TQ6AAD AA8|6-BPS T(G(A BBB9AW99L9MEE B(A0A8A@8A0A(B BBBAHHT:BBB E(A0D8J@Z8D0A(B BBB;Q;;;;AP;BVk;(;E<&8P\BWBGG C(A0V (D ABBA oj v#x,y@{T}h|AWa:ˁ%AQ E M J[F`fAA ΁V( 0< hBFH H DBE AABp L IAND ABEE B(A0G8A@8D0A(B BBB4 gBJD A(D0K(A ABB!"0!(;Ar F A8P!CRBEE D(A0y(A BBB!Y!W?D z!~?D z$!=BAD rAB(!DBGA vAB$"҃ 48"ʃ_BBA D(C0H(A ABBp"D"BBB B(D0A8Fp8D0A(B BBB"%D0`"" #" #4# H# 4\#BBB A(D`(D BBB#/@#/{BMD D(F0PE0A(A BBB@#fBIB G(A0Ge0A(A BBB0$)D$)X$օ)l$)$*AdX$BPB B(A0D8GIkHm8D0A(B BBB$$4AKQ0_AA %5As<% P% d% x% % %{-Ak,%iBDD D0V AAB%ɊAF& & (&,<&ƊgAeX&l& &&& &ߊ &׊&NJ&Š ' '4'"H'\'7AI kA|''A8'BEA A(Gy(A ABB' A['=D x(3(($<( AFT( h(|( (((AV(FL$(>ADD oAA4)BEF D(G`u(D ABBL)]@BQ0gEl)},BJ0ZE)BO)5BG0fE)BT))5Gm4*ZBED K(D0y(A ABBH*FD0A`*MD0Hlx*$SBE B(A0A8D` 8I0H(B BBBE D8A0A(B BBBA`*BBB E(A0A8GPr 8D0A(B BBBE C8A0A(B BBBHL+LBBB E(A0D8A@-8D0A(B BBB(+UKCC @AAA4+DsBBA A(D0b(A ABB@+BEB A(D0G0D(A BBB$@,.EFA _AAh, #|,/AP,)#,8AP,2,7"AN E M,9(Ab-EAW,-BATH-<>A|H`-bBBB H(A0D8DP8D0A(B BBBH-pBBB B(A0A8A@W8D0A(B BBB-.AIO T.,/DO [4.?$H.OGd.ߔ x.ؔ(.ה[IJE AB(.[IJE AB.5AF., /$ $/ 8/ L/ `/1 t///MAK/7MAK/l/Z/H06 A^ 0>>A|<0`;AyX0uZap0ܕnAl000'F[$0-KBDA @AB0PAY$0SDBAA |AB1o?QY419TYL19TYd1ؖ9TY|16\Y16\Y15AY18AY1;~B{1zBw2-Bj02 A^L2 A^h2 A^$2*AKD WAA$2*AKD WAA$2*AKD WAA$2JAAA DAA($3@BID AB0P3YBBB B(A0A8D3)I30BED 3A(3cOIC AABA\3<BBB B(A0C8B@ 8C0A(B BBBE A8A0A(B BBB`\4Ϝ&BNB B(A0D8DP[ 8F0A(B BBBE  8D0C(B BBBE 4eA_4ޟgNW4-AP$5'PBAA HAB05O;FoL5n3Aq4h5BEA I(A0(A ABB45pBFI D(D0M(D ABB(5@BDD hGB62RIHT 6hBBB A(A0D`P 0D(A BBBE 0A(A BBBx6ԡ"6*(6Ρ<GAD [DA6ޡ"A`6 A6ݡ47ܡtBDD Z DBE AAB4H7zBDD I DBE XAB7) AJ7B,TS7VGA}7A7A7A48{BEA D(D0a(D ABB0<8ȢmGAD DPW AABA0p8oGAD DPY AABA<8hYALS0vAA4>1N_$L>BAA ABt>9$>;0AID _AA0>C=AIE W AAE KCA>L<AzD>pwBHH F(A0D8A@E8A0A(E BHB8D?BBB A(A0(D BBBD?BBE B(D0A8D@8D0A(B BBB4?հBEA D(D0(D ABB8@VBBI E(G0(E BBB4<@̱BIE G(D0z(D BBB4t@4BEA D(E0q(D ABBt@BIH E(D0D8B@\ 8D0A(B BBBB H 8E0A(B BBBB |8D0A(B BBB$A8A4LAhBID \ BBB rBBHAyBIE D(H0Y (A BBBB p(D BBBAfNR$AcWBAK EAB$BHADD yDA(NTBAA vABZ Z Z [% $[$8[BAD ABH`[,BBE E(D0A8J8D0A(B BBB4[KBAD b ABE VAB[[RBF E D\LQ4\LM(P\uBBH dBBD|\)BBB B(A0A8DP8A0A(B BBB\A(\[eBAH VAB ]4 ]dBEE A(E0G(D BBBX]l]] ]]#Aa](STD]BBE B(D0A8A@8D0A(B BBB ^@5Ac E K@^U)AU E M`^^)AU E M^gFD l E P^QD w E P^ ^D |^ _ _(_@D w@_+AT_& h_AF_AF$_ BAK AB_z8_K E C_"AN E M4`BBA A(A0(D ABB88`BBA A(A0}(D ABBt`n4`uBBB D(K@(D BBB``% $`4BEA hABa&b$at*PYAi E Jk HkBBA A(E0s (D DEFE B(A ABBkC $l8BAD AB0l%AcHl\l pl#AalB$lmAAA gAA(l[^BAA VABlmy$mj8m[LmW`mHtm9 4mEBBA A(A0(D ABB,mnBHI L0J AABHmBBB B(A0A8G8D0A(B BBB8VgqAqyAQ$qy1BAD VDKqcAa0 rAAA  DJE AAA@r6*AT G M`r@)AU E M0rIADA  AAE ACA4r[BDA E ABE ACB(rBAA ABsP AA0sy AA,Hs BDA G0 AAB,xs BDA G0 AABHsd BBB B(A0A8D8D0A(B BBB(sBBD BB t_'D W E F8@tf*BEA A(D@(D ABB|tTLAG BADt BEE E(A0C8GP8D0A(B BBB8tDLBA Z BBB oBBD uLBA Z BBB J BBB wBBHhu<LBB B(A0A8GP8A0A(B BBB$uBKG0DBHu BEB B(D0K8DP8A0A(B BBB$(vD4BEA hAB(PvPqBCA gAB(|vBIA xBBv4An$v6BAD kABvBw4wFEA A(D0(D ABB4PwBBE D(D0(D BBB4wBBE D(D0(D BBBwTwwlwBEE E(A0D8GpX 8J0D(B BBBE jxDTxApx8D0A(B BBBlx x4xhAGH0P8V@DHBPI0`AA$x{G Y(U0B8B@I x$xxG Y(U0B8B@I u$yh{G Y(U0B8B@I x$Dy~G Y(U0B8B@I {$lyG Y(U0B8B@I $ykG Y(U0B8B@I ~$yoG Y(U0B8B@I lDy BBB A(HPPX[`BhBpIP(A BBB$,zG Y(U0B8B@I cDTzUBLA JaYDBI DBB(z$ QBEE @BB$zI VBAA NABzw Sak E A${ BHG0DB$8{T! VKG0DB\`{8"BBA D(B0K (D ABBE O (D ABBE A(D ABB{"A\({"BID BBH||#BBD A(B0 (A ABBE v(D ABB(T|$7BAF jAB|$mALP[D|%8| %9BBA D(A0((A ABB|&4}%{BEA A(A0g(D ABB8<}:&BBE A(A0k(D BBB(x}&PBEA CBB4}&BEB A(D0s(D HBB4}'rBEE E(D0R(D BBB~;'AZ0~;'AJ E AP~-'0d~'hADE Q AAE ACA ~R']BDH LAA~'G~'G~p(*D0e (-D0h $(GxBQ(H)BID BB(t)BID BB(*BID BB(*BID BB<*BGA D@}  AABE D CAB(8]+BID BB8d+BEE D(A0(D BBB(q,BID BB(̀,BID BB(m-BID BB($-BID BB(Pi.BID BB(|.BID BBe/<Av(/BID BB(0BID BB(0BID BBD1 X0HBd E T E C0| 1BDE j ABE tAB(1BID BB(܂2BID BB(2BID BB(43BID BB(`3BID BB(4BID BB(4BID BB(5BID BBH5BBA A(E0 (D DEKE A(C ABB0\5;ADE N DAE TCA(6BID BB(6BID BB(7BID BB7H(z77BEB B(D0A8G`8D0A(B BBBHte9XBEE D(D0_ (J BBBE A(H BBB$q9)BDG GIG0r9BAA D@ DAB@";BPS O(A0G\0D(A BBB$`\BBB D(D0F(A BBBHxy?hBBA C(E0~ (A ABBE K(A ABB$ć?tG Y(U0B8B@I q$?tG Y(U0B8B@I q\-@BBB A(G0DrGDDDDbD0A(A BBB4t@BDB A(TPv(A BBB,@BDA T0f ABB$܈QABFQ0nDB@ABBB A(D0D`0D(A BBBHHBUBGB B(A0A8W!8D0A(B BBB@CBEB A(A0G0A(A BBB@؉oDPBBB A(G0Gp20A(A BBB{E 0qE>At E C$PE}AAD tAAxE (EJBED zBBE2ApЊF>At E C0FAD |$YF{AAD rAA0F>At E C8PFBAA JTG AAB8qGBEA A(G(A ABBHȋG]BBB B(A0A8J>8A0A(B BBB0H_BAA v ABE YAB0HIBAA J AAB8|IFEB A(A0(A BBB$JEADdVDA0JBDA Gx AAB$ KQADpVDA@<4KBGB A(A0G0D(A BBBK$KrBBD0eBB$(LrBBD0eBB<rL_AAA u CAA P AAE ADA<$LBAG D0W8X@BHBPI0 AAB<dMBBA J@WHXPBXB`I@ ABB\MBBB B(A0D8Gc[BBI8A0A(B BBB\tO8BEE B(A0D8Dh[BBI8A0A(B BBB dLQ?Ab E M A D$gQG Y(U0B8B@I M$QG Y(U0B8B@I M؏7ROD JnRD00R>AAA f AAE KAAH<RABJI B(A0A8D`8A0A(B BBBHTyBNB B(A0A8DPQ8D0A(B BBBԐ VBK EVHD l E RVHD l E R(4VAG k AE NA`=WHD l E ReWHD l E R(WAG k AE NȂWUD P'X&AT E K,-XBAA D0x AAB4XOD JLX&AT E KlX]D X Y?Ab E M A DY]D XLdYBEB A(D0DPaX[`BhBpIP@0A(A BBBHZBBB A(G@ (D BBBE N(C BBB`\_[UBBB B(A0A8GP! 8D0A(B BBBE D8C0A(B BBB`P\qBBB B(A0D8D`+ 8A0A(B BBBE [8A0A(B BBB`$]]BFB B(D0D8Dps 8D0A(B BBBE D8C0A(B BBB`^XBBB B(A0A8GP$ 8D0A(B BBBE D8C0A(B BBB@_PBIB A(A0G.0D(A BBB`0`BFB B(D0D8Dpp 8D0A(B BBBE D8C0A(B BBBXaBBB B(A0G8DpWxXBBIpJ8A0A(B BBB7c]D XT|cBBB A(A0G@ 0A(A BBBE D0A(A BBB\`dBBB B(A0A8GP 8A0A(B BBBE D8A0A(B BBB(dAG  AE NA(7eAG  AE NADeBBG C(DPbXX`BhBpIP4(D ABB`fuD(e0P(C xDNgBBA D(GPbX[`BhBpIP(A ABB<ȗgBGA D@VHUPBXB`I@d AAB<`hBBA J@WHXPBXB`I@z ABBHh\hkAK E Y(|4i:BAD oAB(Bi:BAD oAB4ԘPiBBEA D(B0j(D ABB@ ZiGBBB A(A0D@20A(A BBB$P]juG Y(U0B8B@I rxjXjBBB D(A0T (K BBBE  (D BBBE S(D BBBBkGc] E A4ikBBG D(A0(D ABBH@'lpBIE B(A0A8D`M8A0A(B BBBKm4KmBJD  DBE ACB$ؚm0DDD aAA$mBAD AB((inxBAA pABHTnuBBB H(A0A8DS8D0A(B BBBo $o?BDD qAB@ܛoBEA A BBE m BBH TBB Kp6AD oA(@apZBAA RAB8lpBBA C(J (A ABBHpBBB B(A0A8G8D0A(B BBB4}qCBED [ BBE MDB4,qBEA A(D0(D ABBdqaBu E d$-rAAA AA8rGBEE A(C0l(D BBB$r/BAA gAB$r/BAA gAB8r#KFPPr+KBB B(A0A8D8A0A(B BBBALtcOLB E(D0A8Dp(8A0A(B BBB8unBBB D(D0X(A BBB40uBBA A(A0(A ABB(hAvyBID fAB(wKBDC ~AB(wOADD CAAx9AW E [8 xNBBA A(A0@(A ABB4H{GBED C(D0n(A ABB$ |5BDK `AB0|BBA D@ DBB@ܠ}BBE A(A0D@|0D(A BBB( ~BBA BBL,`BLA D` ABB,BID D` ABBe5AN dA@zBBA J  DBBE G CBBH$N[BEE D(E0c (M BBBE A(C BBB(p]BGA ABHʃBIB D(D0 (A BBBE A(A BBBHKBBB E(A0A8F8D0A(B BBB@4BBD V BBE j EBE ^BB4xiABAD  HIE ADBLrKBI E(A0D8GP8A0A(B BBBA0>`AHL o DLE ADA$4jYADD MAA0\AAG0 DAE DCA"KiaHUBEE B(D0A8Gp8A0A(B BBB$/BAA gAB0-BAA G0 AAB(PAD  CE DC0|HBAA G08 AAB(3@BDD02ABܥGBG E@BBB A(A0G@{0D(A BBBD@BBB B(A0A8Dp8D0A(B BBB,ΏiBDA G0V AAB$^BAD SAB(=9BEA lBB( JGBED wBB08e]BED D0E DBBDlBBD D(FPhX[`BhBpIP(D ABBD[hBLA ]HRIBI DBBD{ BOP KDOIBIn DBB\D=BBB B(D0D8I{XEBI88D0A(B BBBTߕBBB D(D0FrXEBI0D(A BBBLE BBD D(GrXEBIU(D ABB,LiBAA G0V DABD|:LBB E(A0A8A@8D0A(B BBBĩBG EH6BBB E(A0A8D8D0A(B BBB,0WBEG D0| DBB4`BBEA D(B0j(D ABB AU4ȪBBEA D(B0j(D ABB $AAG0AA$<MADD AAd?AS iAћ'A] E C؛?AS iAī'A] E CtAP aARkD fAP A<>bD ]TxD@s$lBMK0iDB$JBMK0gDBOAM ԬA]AAZ AdRBHA A(DjHMMFGSEAfAQ(D ABBlD0gBoD0j8{BED D(A0d(A ABBأKBHB B(A0D8GNeAI 8J0D(B BBBE c 8D0A(B BBBE D8A0A(B BBBx#Aa3YY#Aa(ȤBID BB4FBBEA D(B0j(D ABB$P#ZH@<[cBLS A(D0G`*0D(A BBB@zcBLS A(D0G`*0D(A BBBįxD sܯAZ(AfX BEB B(A0D8GQBjA[8D0A(B BBB$lkBKG oAB4ʫBBD D(C0t(A ABBX̰BBE B(A0D8GTBjA[8D0A(B BBBX(WBEB B(A0D8GGkA[8D0A(B BBBH|BBB B(D0D8Gw8A0A(B BBBHбɻvBBB B(D0D8GQ8D0A(B BBBHwBBE E(A0D8DpR8D0A(B BBBphBBB B(A0A8G& HjAEGGp8D0A(B BBBܲ2RAH E CdMGrPC(lBAD aAB0HAAJD e CAE AAA$|BFN@tDBGE̳CA@?>0=D<X;VATtuDAB4pBBB A(A0](D BBB(ȴBBK BB` W#Aa8 b;BEB L(A0(E BBB\a8pTBBB F(A0(E BBB$sBKD ^ABHԵ9BEB B(A0A8D8D0A(B BBBH  BBB B(D0A8D`8A0A(B BBBl(Af(cBDA XAB8BBB D(D0(D BBB:(Af, FBDD G0 AAB<mBD aE\KAG vA|kD f8OBIB A(D02(D BBBз(H%@BBB B(D0D8Dp8D0A(B BBB(0BAA wAB$\lkAAD bAA$AAD AA$\BDK {ABԸAZ A\TBEB B(A0J8D^RBBI8A0A(B BBBTmD hl4mD hmD hmD h$3eBAG0TDBܹpMU s$=BAA uABHBEB B(G0A8J8A0A(B BBBhdGG,rBAD D@` CABLкUKI I(H0H8G@m8D0C(B BBBD >BEB H(D0A8DP8J0D(B BBBhGBG-N ^$|BAG0kDB$:|BAG0kDBHBEB B(A0A8G8D0A(B BBB`TBBB E(A0D8B@[ 8D0F(I DBBE 8D0A(B BBB0JBED G0/ DBB&AP0nA eA] E A,0VY<DBDD G0  HABE  DAB,EBLI Dp DBBPVEE A(C0 (D EGIE A(C BBBHhBDB B(J0K8G8A0A(B BBBTTBBB A(J0GVUBBI0A(A BBB<BGJ F0_8R@BHBPI0S AABaBV E C 19IQ E YX,JBBE A(E0L (D BBBB N (A BBBE A(D BBB${~BAN0fDB(BIH BBܿKAHJ BBB B(A0A8A@ 8D0A(B BBB$DAAG0AAl,4>ADE D(D0D8D@DHDPDXB`UH%BIB B(A0A8DP8D0A(B BBBHBEB K(E0n (M BBBE A(D BBBP35Br$lLbBGD QABPBBH E(D0A8DP\XK`bXAPp8D0A(B BBBHQBEB B(D0D8DP,8D0A(B BBB4H  \mAkxRlAj(\BDA LFB$BDD FBPXBBA hA^$ @8AAD@THHPUHA@Y DAE DA|  4BAB B ABE ABGAE +Ai2Aj E A02Aj E A$PUAD ABx H@BBB A(GP (D BBBE D(A BBB4BBA D(D0q(A ABB(83ADA *AAd\D0W|4 2BED V BBE ADB4BBEA D(B0j(D ABB(5BAD jAB(,YBDA NABHXDBEB B(A0A8GP8D0A(B BBBHbBBB B(A0A8DPF8D0A(B BBBDBKB B(A0A8A@8D0A(B BBBLh`Y\tXBPS W(H0A8f 8A0A(B BBBE LDDD!\!BII G(K0D8Iu[EBI8D0A(B BBBXH%BIB B(H0A8GwZNAG8D0A(B BBBx\,ABBE E(A0A8IpXEBIEMBABAXR8D0A(B BBBx !.>BBE E(A0A8IpXEBIEJBABAXR8D0A(B BBB8/BNB A(A0r(D BBBD80BNB B(A0K8DP8D0A(B BBB8 0BBE E(A0(D BBB(\1FBAD {ABH1vBHE E(D0A8G`K8A0A(B BBBH4rBBE D(D0I (D BBBE A(A BBB 444H4 $\4pAKD ]AA8 5BBE D(A0(C BBB@o5BDB D(M0QA0A(A BBB45BFD D(D@(D ABB8<l6BLE A(D0j(D BBB8x6BBA A(A0 (C ABB(7BAD AB('8oBDD aAB$ j8BAD AB$4(9BAD0AB\\9lBIE I(F0K8J\XEBI8D0A(B BBB\;BIB E(H0N8_XEBI8D0A(B BBBl>BLB E(A0K8G[EBIOfA8D0A(B BBB\@BPL I(K0K8IXEBI8D0A(B BBB\dBBIB I(F0N8FQREBI8D0A(B BBBDLDBBA G(D@WHXPBXB`I@(A ABBLSE-BBB A(G0DPWXX`BhBpIP0A(A BBBL0FjBLB A(]EUEBI(D BBB\4JGBIL B(D0K8_XEBI8D0A(B BBBTIBIL K(K0WXEBIu0D(A BBB0KBSF Nn DBBT aMBLB A(G0WHUEBIi0C(A BBB$xOAIK0jAA$sOBIK0kABTOBBB A(A0G@ 0A(A BBBE N0A(A BBBH tPBIA K(K0M (A ABBE K(A ABB0lPvAAG0[ CAE DCA,PAJ W(U0B8B@I NADZQwBJA A(D@kHPPDXB`I@(D ABBRBBB B(A0D8DGGJGEU HDDBABDDAbO8D0A(B BBBDWgBLN PHRIBI DBBXX XBBB B(A0A8FpaxYDBIp8D0A(B BBBh:[ZAX$x[BAG0DB4 \BQA  DBE ACB,\BLI Dp DBB,3]BLI Dp DBBD]HX]BBB E(A0D8G`8D0A(B BBBDQ`BBB B(A0C8F@8D0A(B BBBa;BGPlE( 2a|BAJkAB8a;BGPlEXaaBGPRE<xaBFD G{  DBBE p DBB02bBDA o GBE AAB$bBLQ`DBT:cBEE L(A0C8D@eHMPNXI`L@L8D0A(B BBB$lqc/BAA gABHxc*BEB A(D0r8g@AHDPI0k(C BBBVdmD hHd@BBB B(A0A8G!8D0A(B BBB8DkBEA A(G(D ABB4KltBED A(D0Z(D ABBl lzlul0qlfAG t JE D JE DCH<lBBE B(E0D8G`8D0A(B BBBH(nBFB E(A0D8Gpl8D0A(B BBB$qt^BAD SAB$t{AAD rAA$tAD D<DuBDD G0  GABE D CAB8QvBBA A(A0(A ABBHwBBA A(A0a (J ABBE k(A ABB4 =x{BDG [(D0I(A AABDxPAzB R4dxhBBA R BBE ADBHxBBA A(B0 (D ABBE A(C ABB4PyhBBA R BBE ADB( yBBB BBLyPHGh3z$A\D?zBEH B(D0D8E@8D0A(B BBB0zBGA G AAB0{BAA J AABX0i|7BEH B(A0D8JKZAl8D0A(B BBBD}5}AQ0} 4&}BLA  EBE ADB8}nAAIX DDDE wAAD}X}MBG0~E\x}BBB B(A0A8F DDDE D8D0A(B BBB9$,AAA AA4qBFA [ ABE AABL2Ah4hmBEG A(D0P(D ABB$*`Ab(N0M(A _Ab_0Af E C(oBAA ABD(tBBB B(A0A8GP8D0A(B BBBpP$XAAD xAA$AAD AAzI $ AAD xAA$4؁tAAD kAA\܁1 (tBAA AB(W~BAA vAB\BBB B(A0A8DMFDS8C0A(B BBB,܄#B`(HMBEG zBBtDBBB E(A0D8DP8D0A(B BBB(DžMBEG zBB8؅OBEE H(E0j(E BBBL`݅4tͅgBEE D(E0G(D BBBޅ\хBBBB B(A0A8I^ DDDE 8D0A(B BBBPHfBEE E(A0G8E@NHMP]HA@A8D0A(B BBBňDE IDB IDB L8RBEE A(G0s(D BBB,@Th.D0i@CBBB B(A0GP&0D(B BBB(BAA ABHBEB B(A0A8D`8A0A(B BBB(PseBAA ]AB(|BAA ABH BEB B(A0A8D`8A0A(B BBBP|BBBA A(E0 8E b 8B d8O@N8A0B(A ABB(HjBAA ABHtȑBEB B(A0A8D`8A0A(B BBB(:yAAD pAA(BAA AB(4BAA AB(DnBAA fAB(p,nBAA fAB$nAAD AAԚӚ8֚nIBB B(G0L(E BBB((JOIC cCBAT&#BP E K /*h @\$ui @#Fy l#kB l# l#w l#  : !Ց :g E ! E ! ]V O h L 0P  ' O ?9 P O R R R 2 n y  1,!n E ! y  J R Z b j r z H P X ` h p x         ! " # $ %               1 (' )= * & '  + ,# .- 09 1C /N V ] ld # d F-!5 v d d d . p E !p E ! .| .| .|  .|  .| J  .| J .| .| .| \ u N $ 4 @ N X e o z @  N! N!<!  1,!1,!1,! 1,!)w 1,!)w  1,!)w 1,! 1,! N!N!N!1,!'!1,! t!1,! t!N!D!K!$ J N!Q!!N!N!1,! t! { { U!U! 1,! 1,!" t! 1,!t!1,!t! !!\!t!1,!t!!!p!{!!!p!{!!!J !! !!J !!1,!t! !!!!!!T !!!!!!T !! !!1,! t!1,!t!1,!!!p!{! 1,!1,! N! 1,! t! N! 1,! t! 1,!1,! t!! 1,!t! !!0 !!#!@1!=!PK!X!`g!v! !!!p!!!!!!! !!'!4!@!ЎP!^!m!{!Z Z @"!!!!!  0# !$!  !`!!m!v!~!!!F !!!!!! !!!!!#!(!0!8!F!P!U!^!*h i  k!q!z!Sh !c !!!!!!!!( !!!!! !!!#!*!2!;!A!I!O!, W!e!m!/ v!E {!! !G ( !! !ز !!!!!!!i !!n!! !!! !!w!)!!!%!.!2!8!>!D!u G H! O!X!c!n!{!!K !!$!)!1!!G!Q!V!!!!!! !!y x !!!!!! ʢ ! !!$ !!!'!r!{!,!1!6!;!C!K!Th R! ! \!d!5` n!!v!~!!?!!!!!!!!!! !!!q ! !!!!! !!f ! !!'!1!}!8!` !?!J!Q!W!b!$!j!+! q!0 y! !!! !!!{ !!!!f!!!n!!!!w!F |!.| !!!! T! !!!$!,!6!?!G!P!U! _!! f!{)!$ x V} o!v!s V !!!!!4f !/ !!!!!!!!!Fy !!_ ! !!!!q z z ~e Ff 1,! T!P!;!0!!!y g g # !=?&==Ȼd==B==Yn==============b:;;=FPt=K2*5d*===0=!# #7**H_V "ڶ5Т9Kl=}=O==S=8<=={|1A====@Qt==KSp========================================================================================== F-! !&!V-!n M} !)! !y,! !!! g g ,!Zg \ - ҋ ܋ &'! !   ,!i t e \ 1 ,!i t e  ,!i t e ,p  ,!i t e ,p | J  d ̋ Ë %! ,!i t e # !  !5 ` I ` I I  I  ? I  9 I  o ='! > . F m    \ #  \ \ ` &'!='!!  L! F L!f #  L!='!,!i t e  g g wx g 3 g !,! C   +!: ' 1'! J 1'! J !  !  # !  J # !  J # |  . # L! B  J B  ! M M & J M & J ,!i t e  & W ",!n!w!!J E !Z !c !&! &! E !  = { o y &! ϯ ? S!J ~&!&!&!+g # '!'!# # d  ! 'g (!'!'g (!# p u { W)!_)! N!?!9! d F-!` K0!!P0!S!'!=!0!0!1!1! 1!-1!}1!61!>1!H1!Q1!]1!i1!> u1!1!!E ! <!Z !&! &! &!&!c !E !!E ! <!Z !&! &! &!&!c !E !82!B2! G2!N2!V2!]2!d2!i2!n2!s2!x2!~2!2!2!2!3!3!2!2!2!2!3! 2!2!2!2!2!2!2!2!2!2!3!3!3!%3!3!3!.3!;3!F3!P3!`3!o3!3!3!3!.!3!3!3!3!> Q ~ 3!3!3!3!4! 4!4!4!& ֍  dW p/x/o`4  ,0 "`e(8 oooo~o&*06FVfvƐ֐&6FVfvƑ֑&6FVfvƒ֒&6FVfvƓ֓&6FVfvƔ֔&6FVfvƕ֕&6FVfvƖ֖&6FVfvƗ֗&6FVfvƘ֘&6FVfvƙ֙&6FVfvƚ֚&6FVfvƛ֛&6FVfvƜ֜&6FVfvƝ֝&6FVfvƞ֞&6FVfvƟ֟&6FVfvƠ֠&6FVfvơ֡&6FVfvƢ֢&6FVfvƣ֣&6FVfvƤ֤&6FVfvƥ֥&6FVfvƦ֦ @ %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%  !"#%%%%%%  !"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%/ 4 h" ; `; "  " # 0h" 9; : e  $`D0@D0! 0B0B0< 4 8C0C0<    b $G H0`H0Q 3D @$\  $i U $u D3 $F-!ƶ $  $ 4 $ k4 $ $ `$  $ $`I0 К" A " CD " |@" @" PL"= " :<" O5 @" ;"  "0 B< "9 5 @"A h"x $`K0@K0n Q n Q  n Q | n M} F} ~e ] g {  Z} w +!@$ 0$!i $ C$} A `$* `$ @@$!l$}  @$\ $w  $ B DP/  x`kD$i& pCR0@R0hPd dE PM $Z} S `$!S $  `$!PU $  `$! $  $ W0V0[2Z} g% @$  $ #$} $ y Z} AK! @ h E (   X Y;!` L `$. ,$!-P$!0$ P$M} $+!$F} $} p$\ P$w 0$S} ^$ ;$} 0$* 6$/ !! } } +!M} D /i R /. F} } \ w S} /d Yb  $!$`$h}  $v} +&$& o%@$! @$~ $`0[2   DzR ;!( PP M} +!@} 0\ PF} pS} D @!`$c} $h} $v} $& @$ P$  $} * $ @    DzR ;!(+!@ PP } 0w PF} pS} D @!J$* $M}   $}  @  ܡ!d|c} Q|h} >|v} +|& |!|M} {\ {w {+!>{S} z   DzR ;!(+!@ PP } 0\ Pw PF} pS} D @M}   $} * $!`$h} $v} $& @$ P$c} $!J$ @ c} v} & !M} \ w +!S} / / D / !h}  \   %} @  %w  ` %+!  %M} 0M %S} " `%} p %!% c%h} h %v} `% `%Y @%!%   % c% Q%*  $   y@ @  @/* @  t0@0 !2 %n} @ %v} @"%!`% %} P`%* 2 `%+!%} %\ P@%w %F} %S} @%D  ^ y OD " ;!+!`/W 0 %} &`%* $ %M} P@%+!@%} P %\ @%w % K   0F} Q `%S} K%   '%Y p% p;%!p%%n} ) %%v}  !  %% |0[2n} !  ;!\x `(%B!@&% %% @A%~0 p/\x +! S} / `> 0L% `K% @K% VJ%' ) @J%$ 'I%, %`I%" $H%F #`H%B +H% "G%3   G%c pL%00w g p_ N%| p_ N%t b M% b M% L%J L% p_ N% b M% 4rBt 8O%@ 0G eH0w (| T% R% R% 0 R% Q% T% R% B w 4M8 H`0w (4L: E8 G"3LAH0  . e c%5 c%? \ c%$ \ c%M  `b%  `b%Y ^=a%h P_ _%r ``^%!S\% <X% W% W%1~e M} / ( e%`0 0e@` W%0 @E`0 0 0E@]2 (A`0  & - J R n v " "  # -   |%  @|% 6 {%H  {% 6  {%Y =z% { @z%]  y%j @y% @w% v% 4 u% t%p s%# po% 5  l%w Pi% i%} =  i% @Th% I @h%+ 9 g% r `g% y g% : f% 7 `f% @}%00 H"0  @@% u % @ % @ % % `%  % % %% @%- 3 %5 y3 %<  @%E %00K T b j v " " F|  % Zn %G `% Z %{ y %  % m @% Zm % ?% > % [ %" 2 %L Z% @% 3 % x %( % %4  `%B `%0, %00` X = % @  % C %l %{ [@ % %0 r`% r % `r`% |`% % {`% } % p`% p % q`% q % q`% q % s`% Pt % `{`% z`% 0y % % f`% `g % 0% f`% @k % @% v`% w % `% a`% c % n`% 0n`% o`% z@% 0{`% }`% 0~ %pM % %@0 0 !0/ / /J  / J " /n `/ / 8 %AV4G@ 3N pI% O% |% w|@% }@% \% p>%4 Pa`%! %00v } @ * 0@ 0w ! `"O | H h  R@ % # % 0"   ]% %0`0 L0! 1'! Щ@ 00 P % % @%  `%: P@% `%} % `% ` % `% PI% `% `a % % p% P`%  % % 0%!``%  % P% Ц% @`%# W  %9 % %5 `% s % r % `% `% % % S %  `% : % % % `% 0%  % @`%  % 0% % `%e  % %] д% 0`%2  %ִ @% > % p~%( %00@ж 2 (A2H (A@2\ A2. "  "  P"w 0w (w 8p "4@w w t A  B A A4@2`8%G3@0H 0I`26A3 G %߰ w%0 80 A2 A`0 @M2 f   % 00@p $ <* t= % 0 %: C %5!8% " 00= :% \ %} 6%U % _ % % `%* D`% @) % C%۾ P?% B`% P %g P% <% @%ʾ >%U O%Կ PT@%x 0% % % W % PY% V`% 0B % 0;% pA% 9 %) `% p8% @`%  % 0% P7% `@% % % 8%F @0i3/U / N 6"\ 0" 8Y H"w @4B$ ; 68&C`@2H0I@0G`!30 @& x" `& "  .| " (" 00" 8"4 BP) 8&@`2H0I@0G3` @) \ w * & &4@0H`0G3@@ !`@& ^5 & & j& `& @k & }/ 0`0dP/w /s / `/ @/C !/ /} / / / / /!/G A 0 XA0 `A0   ) 2 @  &y 6 &I u  &> ! & 00pL R &0`y ` & i3`0 d t { " 3  < E _  h "t " H"    ! * 2 : C J T  K b [ c y p"  u   1 A Y "a ")!" @"1,!"4B @2H0  P+!U rF P@& n & @&'  & 0<@& &q `& & &Q [/& O@& O& b & b &  & @&h y& : & & g @& %& &e %4`& M & \ @& ?`&!`& P8& <`&u & & P~& P`}& |& v&" u& d `u& t& es&9  s&!pp&! p&)!c p&|  @o&K n&` B m&k m&U l&@! k&y  k& H `j&L! i&\ @h&T!@h&\!g&d!g&5 'f&k!Q f&u!@f&!w5 f&|!h5  e&!d&!d& u`d& d&!h c&! `c& c&! b&! `b&  b&! a&n O6`&! @`& _&  @_&!^&!T]& \&} p@[&!= Z&  Z&! Y&  Y&!l Y& X&\x V&+!nV& o V&! @U&! T&! T&! |`S& R&!po R& P& `O& e L&!py@L&  `K& k @J& @G&!f F&!5 F&S} eo `E&!lD&! C&^ g2`B&X e0`?&!4 ?& !3 >& n >&3 =&* <& h ;&- U 9&0  9& @8&U,!s 8&!z7&! 7& `7&!= 7&)!n 6&3! 5&@!0p@5&K!a 4&W! @4&a!h 3&m! `3&v!u 2&!% `2&!P @1&!P0&!} 0& /& -.&!: -&!,&d `,&; h +&E  `+&! *&!V `*&z m(& @'& %& 4$& !&!c  &! ` & &! @& E &˵ @&! &! &!,&! & ! &!L &%!`&!&`00p/! 0 0 0q 0 `0 0F 0 /!/i /p /F `/!!&`0 &0!H0!h2!&@0 &0؃ &@0 Ƀ `&0 &0@0 0 0 0h / /!p/ / / / 0e @/ /\x /^ /X /z @/ / / 00' 0 P0Q 0 0 `0 0 0/u / / @/!0/)!! //!!/!//!`/! /!p/* /!/ 0 /+!/˵ `/! /!P/!@/!/!p/!`/ !@/!0/3! /@!/K!/W!/a!/m!/v!0/%!!_!/!0!`+!19!2G!4V!3b!ak!.x!!!!! !W!V!$!%!&!'%!-;!eG!fS!g_!l!w!(!!)!*!!E!F!h!i!<!"!+.!G@!jL!\!lj!u!!!!!!!w!x!y!z!{!|)!S=!TQ!mZ!f!r!!X!U!5!8!>!=!9!@!? !A !7# !6. !:6 ! H ! _ ! s !, ! ! !o !p !; ! ! !! ! !q !r !"0 !n= !K !^ !Ci !M !N"I !J !O !P !Q !R !D, !K@ !LV ! ` !#m !H} ! !B !s !t !< !u !v ! !k !} !~ !, !A !\P !]b !r ! ! !^ ![ !Y !Z !b !c !d ! !7 !G !X !f !y ! ! ! ! ! !L !M !N !O)!PE!Qb!R"S|!T!U!V!W!X!Y!Z "[9! E!Y! i!u!!!!!!! ! ! !!!!-!B!T! / V & ı `&c! &m!Lp &w!6 &!5%  & J?&!%  &!&D &!EP @&!k&!>  & & c`&!=  &!= &!%=  &ʢ & 110!0D 1,!v3# `    $! $ +!i \x 1,!@0v h"ʉ " " !&` 1!"%!"/! "5!P" " "=!"h!8"B!x"L!V!r!"( y! |! |!!!{{ !!!!!!!2 ! !: !!! !+ ! !!!!!!&! !;!P!V!k!"x!!e % @&!& &!vM  &1 `& & p  &!`@& & `&! &!9 @&!= &!@`&!p&! &'!%& p7& PV&& 0&9! &G!@&Y!@`&k!p `& i &z!>  &! & &!& Y &!  &" & "V6 `&!|@&!Q @&Ҧ ' &!x7 &!P&!p&1,!T!@& 1J 0e *!!& 17!& 1A!&1R!& 1 ~e "!)! E !0"!%!p0!q{ {   !T1!(P 0 !D%!@,!X !!0!;!u )! -!,!E!t $ ,! y,!,!P!T!E =f M} ~e X!`!Z!M} g!U!~e i S} R \x @q!@r  'tn W- 'a \'fn '! '@1 1!!v} !&{!p4'!_D `3'g [`2't ^1'| c1'| b 1'!10' ,0'ew 00'[w @0/' 7@/'!N.'!p1.'9 0&-' -'Sh 4'11!! z  !!!!0 !Rn A ó '!0! 2z 6 y  L0!. <! 1'! &'! ='! 6 #   }!!J !-!,!,!y,!E!t $ ,!Ҧ !6'"1~e M} )! L0!T @9'1'!0 8'&'!$ @8'='!G 7'K 7'! >   !5 !x. } #!-!>!Yb P!H"ِ ^!["!!Z" l!`"t !-"!!h"n n pQ Q 3 !!z !F+! p  L0!'!A o qA' tA' p{A' E @A'! o' ik'!`@k'̎ &j' 0j' 5h'!P h'' `g' 0f'!0 f'!b'6 |@b'l _' `_' 0]' @e@\' `['t 0n`Z'{ Y'}t mX' X' W' @yV'Ց  `U'u  T'| @*S'!R'!x Q'z 0-@Q'i)!@ P' uN' M' p[L'U `L'!ЉK' `K' 3J'O!(H' P@H'!@G't @F' E'!`D' ZC')!o'@)1Uj @0! #!/!9!# { i)!!3 0!z !E F} ~e 0 M} I!`0 0! Yb ]9w \!21U!D`2<M в`p' NA p']!Pز q'`31@31!"0M ",!n!y,!,!wx !!w w !z !!~e w x 4f A !ِ !!c @;lG @; 0 2 T .f f Hg + f - I ߨ y G )B* ί ܜ 1 N ץ 3 z ۬ 5 $ ݪ g !c A ?!"N!u BPv aP J N!  8 @"U p ))!Pe')C !`%)g!|@#) 4@")n!`s!)y!@!)!` ) ? )J )!`P )  ) ) 0)S G ) `) O) y)s A )z `H ) 0) ,`)!}) ')!0D @): )!І )J P@);  )Y ` )f pJ  )!=@ )!Q` )!s)!0I )!)!PE )!)!F )!)  )!P<@)! `) !F ) !K ) P@( ! G( 0 (C ( < `( ! ` ko `-) e -) `f,). !P: p"I !; "!k !C1@"07 `"0!"0U p"0!"0C !"0g!! !@ ;1A J$J PJ@ pU@ @I`[ UU S [ !z $^ !  !( !  !!!w  !!X!!@O1)G `g`1)#!0"u P1)v 0y0)!Pu@0) ; /)P 0!! *@5) p 5) Pg3)/!!@ 3) $2) @2)!`2)A!!O!!j!!"s!! @"9! !!!! !!!!!!!!! !!!!!!!!!!!!"!"!"!""!+"!4"!@"!I"!R"!^"!j"!s"!|"!"!"!"!"!It "!"!"!ǒ ) "!"!"!"!"!"!#!#!#!&#!/#!:#!!!F#!O#!Z#!f#!q#!}#!#!#!#!#!#!#!#!#!#!#!!!#!#!$! $!$!$!$!%$!,$!!!3$!<$!D$!N$!X$!b$!z o x"j$!u$!!1'! )! /!!A W J q $! $!$!"!@ It @ H H #!XG5"$!x"ǒ , H""!G5""!0@v"It 0 " P" $!{"$!{0"$!{"$!{@L "%$!{ P",$!{`"3$!5""!"b$! ""!$ x""!~ ") (0j" 8|x"<$!Pj D$!! 5"N$!P! 58"X$! 5""!5""!5""!04@""!04p""!""!"#!"&#!@"/#!px":#!p"!!0X "F#!0` @"!!v5$!!!н5$!!! 5"$! "!!& 5"O#!{H"Z#!{H0"f#!Ih"q#!I"}#! P"#! P"#!( @"#!( p"#!0@"#!0@""!85""!H5(""!P @vP"""!X@v"+"!`@@v"@"!h@v"I"!pX 0"R"!x@vh"^"!@v"j"!P@v"s"!@@v"|"!@vH"#!"#!"#!`"#!`(""!@v`""! @v"!!45"#!PH"#!P"4"!@v"#!"!!@v" P"!!Є"#!""!@v""!p'""!p'"!!@j "  ; i P"!! ; Jj "#!(= ""!0@v#+"!8p'8# Z0Gp#q o # Z0Gp#q o #iiЏ@ p<) `d@<) d<)! #0e $!$!%! F-! 5   %!ڞ =) 4$ @=) y ?) p/ D)Vl`p. , .  0Vl`q1 !`2F-! 5  c `G) cJ 8 @G) F)00PE J) bI) cI) + J) I) ] I)!R ` J) C @J) , %!hP @v1@#, C `u1 w1w1x1x1x1x1 x1 x10x10x1@x1@x1Px1Px1`x1`x1px1px1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1x1y1y1y1y1 y1 y10y10y1@y1@y1Py1Py1`y1`y1py1py1y1y1y1y1y1y1y1y1y1y1y1y1y1y10T`@`0`@`0rxpyy0ym`@`0o`@`0xpyy0y`R ` J%!)! J %!p !!  {* L)z @ } !#It '&!l !z P#0wx '!z 0! A A J j!! !i  3t J p 0 @Q)i&! P)&!0P)p&!`q`P) P)y&!O)~&! @O)&!N)&!N)&! @N)&!Y N)&! M) P`V)Ƹ T) R)&!q@R) lQ)&!Q)  0%q`qp#0Ƹ #0 p#0g #0 " p [) [) PZ)  Z)Ǐ @Y)&!X)&'!rX)='!dqX)1'!pX)nj 'oX) 0@X)K X)c `W)&! W)*` в[)c pc c  $0 &'!!@$0" 1'! $0Ǐ #0&!#0&!g Td) / `d):%! `e)c * d)`:%! `e)c *  e)` @#c * e)&'!n%!1'!x x%!%!!'!%h#=! #'!%#'!%#'!%(#'! o)(!n) k)A Vh)(!`g)(!%X#)(!%#3(!%# f) ! f) `f) ]A  f)$pвB@`004PIM `0@>`<(!K(!c(!#p(!#(!8#(!`r)1`$0t $0 $0A g 1j@3]S,C `z) Pn`z) n z) z) e\ `z)  z)h !$0Uj  {) ] `{) E z) \ `{)F+!>9`|)n+!/9{)+!#9{)!9 9 )!*)!H P6)! hz B)!K)!B)!K)!$0ם A z J A g)!3 p)!>r y)!+ ? )!L)!)! )!()!0)!T)!U @) : )z h#)!#)!# (#)!X#)!#)!#)!P#)!p#*!#*!#'!h#=!#'!`U @)(!4 ))(!)3(!`) )(! @) p) )*!@`) !@ 0)8 P)B 0) 0`)]0p0нp *!)1 @R ^ E S (*! < +! M}  F} @ S} R  !9 F} ! \x A KLK*!J KPL#a*!L8#n*!Ly*!*!F+!)n+!{`)+!  )3A KL*!J KPLh#*! R #*!rD *!*!*!XF+!)n+!{)+! @)$ 3F+! )n+!)+!@)A KL*!J KPL#*! R #*!*!h+!F+! )n+!T`)+!*  )F+!)n+!y`)+!>  )n+!+!?!ք# N!9!%+ u v ż  R$ !-P?! J N! ?!+!8   +!) @,!u @<,!,!@,! H{ 1,!P*,!  |: k y @6,!U,!HK,!y,!Po,!^,!Xh,! 5+  @ H,!p @J ,!@,!y,!Ho,!,!P,!$ X,!,!p,!t `,!E!h,!-!x,!E @-!J H+-!F-!P<-!V-!XL-!d-!`Z-!1En h`Dk-!0Q @2@ 12n h`D|-!0Q @2@1"n h`D-!0Q @2@`1n h`D-!0Q @2@1m h`D8#0Q @2@1m h`D`#0Q @2@@1m h`D-!0Q @2@1m h`D-!0Q @2@1m h`D-!0Q @1@ 1m h`D-!0Q @1@1m h`D .!0Q @1@`1um h`D.!0Q @2@1em h`D2.!0Q @1@Um h`D?.!0Q @2@@1Em h`DZ.!0Q @2@15m @`D#`11(m @`D#`1 1m @`D8#`11 m @`D#`1`1l @`D#`11l @`D8 #`11l @`Dp #`1@1l @`D #`11l @`D #`11l @`D( #`1 1l @`DX #`11=m @`D #`2`1l @`Dl.!`2l @Dz.!`2P1l @`D #`2@1wl @`D #`21el @`D #`11Wl @`D #`1 1Dl @`D #`114l @`D #`2`1%l @`D.!`2l h@3D.!`11m:k h@ <D.!`11`k h@n D.!`11`1k @`D.!`1k @`DH #`2 1k @`D.!``11k @`D/!``1`19n @`D1/!`22k `wDx #@kPx2M2k `wDO/!@kPx@2M@2k `w`De/!@kPx12M+v PP~Du/!@3122k H`;D #R < 2 2˷ H`;P~D/!R <3 12 2qk @`D #` 2` 2bk @`D/!` 2 2Uk @`D/!`22Lk @`D/!`23k h`3 D #0Q 1112@2k X0D/!P2@2 X0D( #P`112@ 2 k @`D0!`132k HP;D` #Q <`113 4`2j @`D #`132j H\D #L\12\2j @`D #`2j @`D!0!`22j @`D#`131311@1@211211,! 1,! p @2 #@) 6) 7)c p%0g `J  ! e J  H J  PJ  !M9>0!A   >0!* A J 8~ ! j!!  pM ` %!K0!!P0!  ( ^ )U0!p)\0!S )!!)%00!%0 h L0!&'!='!1'!K c t J '!h#=!#'! ) !) )Q P%0g 0!0!R 0!0!1!1! 1! -1!$61!0>1!8H1!@Q1!H]1!Pi1!X> hu1!p}1!(1!x : 1![" !@%@)&0! yB)!#j!!#  !B)!#J t A 1! >?  !n!) @ )J ) p ); S)! `) ) ) {) )!@)! )!0)!@`)!P)!`)!p )!) )S )  ) `)C 0@) )!>`)Y `)f `) 0!)s )z ) 0)g!` ) X)C !)!q)J ) @)!c )!`): Z)!pS) !@)U00NWK`  ) @) )&0 &0: &0C !'0g!&0!P'0!!!`'0 0'0 1!) Y& ) `) )9 z)n!`) ) @)K `)J ) Р@); )!) X) 0) p) 0) )  )!@)!p)!)!p`)!)!p)! )!) @)S 0) @ ) P)C )  )Ǐ @ ) )!``)Y `)f `@)p ) 0)s 0)z @) ``)g!@`) Z)C ! )!@)J @) )!cG )!`):  )!W) ! )}~p ) ) P@)'0e '0: '0C !'0g!'0!0(0!! @(0 (0 ( / F+!&'!1'!='! (! u v \x 1!1!2! !2!2! 2!  #2!F!)2!S g h n  /2! ?  g Q0!!42!:!  12! +!  "!' w PB0@B0@M2L2@L2K2@K2 K2J2e D$ Х`\0`[0`Z0y` ($Y0`Y0P 0tD$; A (j0i0 v P D$@ZA g0`g0f0 P D`$@ZA :l0 l0k0R P D$@ZA :`d0c0@c0& @kD % @ 0Q `q0q0(aPaS 0@p D % @ v0x0x0(`  p D@ %Y; @ y0 [24[B> @@0/AH0G Я% d`% d %  ( `@%0`|B ( @%P@ ` 0{Q @Ѐ0@sd @@XD %Pp 0`Wv PzD%i`0 0D %pl@0к @0D%I0 vD%vuu 8`{D%P0y (p[nD% 0 D%@[0@[ nD%S pm0l phD%ip]2h" pD %04 8[D%t0XE (]D%0]@0P\Y (_D%p^0^m 0 WD@%V0U8"8D%`li@0@h} 8pD%j0  0aD%@`@0 _9 `%@  %  `% f  %K f  %J b? % Ђ`%P | % = %  @%Ǐ p%[ % ~ % %c 3 @%p : %P k % +@ `%  x 0 `%K \]  % \]  %  %  "8@E; 08> 8@E; 0> 8PK 0D %Kw 2@0I Pp 0`0 D %F H20 8%42G3a@ @ 0A:B08%40j2КG 3S @`0A :B8%42 G: 3@0A:BP `C C  4hB@E2 a:E8@%G 3h@2H0I 2AYJ4`y2 x:G 3yCxH0 w @&s 0^& p& p@%} ( % J%C !T% % # % P' P% `'  %  J P&F-!&V-!pU &= @& P& `&G ( `& p' 0& ' &  i P7&p `&x &F  &{ b4  & : &  4pP>?@`0!y !/ F  ( ! , E  ( c x G  !Sh !)!T!ʢ ز !$ ( @&p 1 1 1Ӌ !xV)m 1C!(!1!1@0%? z  1Q 1'! 1@6 @  ='! 1@6 @  &'! 1@6 @  H! D @5 \! @W5 l! @P%L0! <'y :'}   :'   ! !0$@5 $`2 %1 !@& "@4 & 2$1 !00 `$1@$1@%  * `#1H ך 0HDA' S(1F ! P[D@'V(1k `Ug 0wD?'Y`(1 v 4:EG03S H 21@11I2<9/AJ  !8< 716161Z 0 :@K0 !8< 7161610 :@K0 @61)!8!8 9DKA@251^]W! 9191P @" @918181`\R !8; ; 3 !0= P< 3 ! @j<C17 PA12A1`0@ +) `;1s (`V* 0TD@6)PN1|] 0O%!x(IK1(pPL2)PpJ1@I1G1P@&J 5)0M1L1X0 !P :) # :)J  9)  $! U@0Ml1 Vk1k1g D@:)`,pL2D3  `m1 ? (pw @>)) @n1m1 B) BA)#!0HF)K E)%!`A)c%!`E)x%!@ A)%!{E)&%!0 @):%!`+ D)E%!D)N%!@@D)Ǐ pz@) D) P@) : C)Y%!@C)n%!и?)%!cB)nj pQ`?)  #!0HF)K P/ E)c%!`E)%!{E):%!`+ D)E%!D)N%!@@D) D) : C)Y%!@C)%!cB)  %!1 $ %!0d@`| n1y  o1 p1D@`B)P@d2Уh  p1 p1D@ F)P@d2 `D%!0p@u1%!0t1 03 # s1@s1 s1& G) 1r1q1? *%!E 0 |1|1 %!Y P{1 &!P%`! DM)S  1~1 ! wx 8 ЄD@M)@(11@1c5&!h?&!@N&!8"0SPgHK(1@1@1&!0@c+ pg 1P1@1 @V)@:^  11 &!p'@ :C '!p11D[),h`1 2`& '!P@1+'!p17'! d1D'!@h@e1#! Hb)!!HPb) 0 b)L0!0a) l`)Ǐ 9`)&!@_)&'!`_)1'!^)='!^)nj `])" \) P\)K \)c +  \)  ˓z 8'!0@1@pj11S'!8@@` 1,'!0 2@1@pjp 11!'!0 21@pjp 11f'!8@@`1w'!8@@`1'!8@@`' 1'!8@@`' 1'!8@@`' 1{ 0_121@D@ b)002j t 1p@p)` 1@1!!1H(!c `y) : x) Й`x)K $  x)9 0w) @w) 0c w)Ǐ Xv) `v) `u)J !u)p t)Uj  s)  (! @P`1 (pV1`1 D@`y)P 30 (! 0@Py`1(! T 3@PR ` 1)! j@i1%! @PP@1)!S 19 |)y S̈́ 'C %`P @&5z  A  J `%!@ %!P h  [ D`)`1`3g @ D~)@13ם PYxyH@})Z`13PX  h$ @`< 1`11e P 1PI@)@11=*! 1@1E+!S )m+! )+! `)  } 3*!X-1 @ (@111+!B @R 5+!(vB `#3@j*  1K+!B @#*  1]+!(A #3@* m@1t+!p-@#3' @1* "3 11*!`-1< @ `111+!0Щp11r [ D@)p (1@11D  +!+!@y +!+!p +!j @`Q P~D@8#`1 103 l$ )  g 0@D`)Zp@33Ph `#D)j`"@!2f L0!v`#&'!`#='!c#1'!PT#K X#  c Ux#d0!8 `@`$2`$2#2w0!0 @``$2@#2j0!0 @`$2`$2"2^n0!8 ` @``$2 "2@0!80 H`$2`$2 "2` h @`D@)|)2(2`(2P,0!V@'2&2&2@@j i630! 0`O ? p@0) &2 &2 %2g `,2@)+2`+2u p 0^)12@.2-21!Hc? 8 G&!0( ZH) , 22 2212\) c PT [ Z@@)Q @3222 y s F4 @)`P 32 1!0@4d )1! @p`;2 !@:29292%@92@)p 42p9` pk1! 0@p@K@F2e 8 E2S3D2pD2@ )T0>2`g pJH2)Z 3stapsdt)[3pythonaudit8@%r12 8@%r146stapsdtl)[3pythongc__start-4@104(%rsp)0stapsdt)[3pythongc__done-8@%r14:stapsdtG)[3pythonline8@%r15 8@%rax -4@%r9dEstapsdt1J)[3pythonfunction__entry8@%r14 8@%r15 -4@%eaxFstapsdtL)[3pythonfunction__return8@%r13 8@%r14 -4@%eaxHstapsdt)[3pythonimport__find__load__done8@%rax -4@%r11d@stapsdt)[3pythonimport__find__load__start8@%raxlibpython3.10.so.1.0-3.10.16-1.el9.x86_64.debug"c7zXZִF!t/B]?Eh=ڊ2N tݓ9LVO+WnXFGF0-bHz%u]@\%{p¨ܚ3h(ѱa[e-}2 THeN쟃-Iz4ܱҷX;]1NQ1FuUmHlP;y.D4A>R/n.B>tgH=yRc挢UZ,ukD,T+ַ_ޟ$MU&_~ZgkNo2|9<ђWos~d^T{50<^ GcGP+uNޫ G4qBJ']&ŪjM)&X5eM?I>`-̌!' Tm}pZ %ˍ2yu goC0,Uķ3Nld'| INڢ$8Z[n#*gyOؓAT qA"̀a@>)a$k伣7IYFw炿J.yғfû:+3v'C/ uOӺBT5qZCjA$F&v j'〸*ԀYםaD>ar, k{@D5.S:LzD%Zɝ7XQn= yOHetB5VCg+ğ!b)gRVpe~qUKR8Th h[o^QA,|ۅOw<)#NBIeZmHcx^[$iZG()'렮 iCL39!os!}>TM5E 1k.|NJw'W^vZ.AtO~0d7_Xx:Ɠ5;m,$*`F V0?.X:Bopj4.gYϱ۳6{:i 9;ꋝJ{8LE>o)֬s3WY<!/Hz`+QcdN\7Jk>x9.DVorڻ1Ղ=qv0{NVzzca*-~2h y:}=3~`w'v9R>\O'w)oGeX+DDfy:#t~⺑ hq<ɐ;Cʦ(bc9 ADh~ ]u]`l6 tV0R[nhM|h0{JfaeJAFgL3Xp銸yOa]3]WDzu(|(IQ[?KW&֓Nk>xk?rY=HG/@ݾH7Yp.45dH (6\oGpcCPF+lL&"\.YzTUAY. vaJ|j,?8̄F$ݞg#&(Q^Ko'P^slnM= ƕ-">QkNRV%lpD˽f.\@Ln{dr4u}ۆNFL({f˲W/ni4^39vµv|)йgٶkLsDWطHb]KoNFR#p19EV el_Fcb11xhlS4x+27p\<+A{.}s "B+ 8 T9;8g?𡂇=Nς5)YxNj[-{WYvX0Vt{ sK4=%9%Rtj 7AVAװﺀoϙ>y),C"L2˚P&V/m)D݄_7SyʼnO4kfOr]"n1~KQxD»d0;czj]J:6=S?J8_˫) *G~>DvVi;lU6 Տo;{jS9'oCEYd>~f<2&t>ޣKn4F{ xd,T-^㲀ZoS !>A N/O2Zah9TKj y̦FhOKH Z$jo#yw{˷&eH/i+-O\NGyGڂ'ާ2RqLz Ez%IO@U& A6KC!XOgYN;ӫ*C8g}ޠeHNQ;6Q1 0fݢ{y5XXX,f1imhH(rs4YFX;'-'"d9n0ƚch-wG[[) xI(^ u:B6\*h*\yEgWI8ny9X'v9z0){ A5Ljz*R\*yL"fuVT+Ui,: l꩹xC؛pRdqGmi%R~I$BOt7\$'NL}Vڋ{)Xjd]ǐ5Y7stâ җ#vY񭜪$.iDdلLZZ0FŮ*7N6WaC(dRzp&/1޷zE"ѫ,RZ dh=n"9 `!@ h}K( A?~46ܭIE+hƕ嫮PȀxdŎ@mWIH/#<$ka>&07`aL "ڠzy Ti}in28b:6oq6ZO9{NQG,~"!Q?0'nz7k3- ɵ%Q4ORv7w%1qс}eS(ȸYru$Ξ(E w̘O80λgc6y Yu꭛?)g8 '˦wRc.4pa-bm[w,rp=Uͽ WISvGz`CX"m1bUr$e#mH.SoO–h4p1b%H֟ҫC*zG(^@,F.2S}v$O |^;uIX 2*$ƻxB7MHG3Ҹүx'e<]i]3^[.p; TđaI;z,q+Pp^A[9>DE9(Ҕp93 A#; DJ ('5oX/r5P2;Zma>Gw֣tڼ!ǞPԛpJG\Y3O'- ) LLyPnAn-gK9266q6+:K F&-_B}YPb^^u~tPֆW'nkamVΈ#Rv†gFθvE-8u[y3 c,lPҽ, zdݼ'~*%PQɚ8oMpwO.y!YQI㒦u3O,iDm6?:g*+f1d/ipr@鲙 `B9QHWG(:9Mբ}2a&ZWw{̱kg; K̂VϓlАD01ZX ?5}URCq$%vڥ(G&$hl^ .R U'x4?HhɿU7X6+dѶcXOT$$HRVTS:(I=PE>g2 &bp-W7 Š<}nz|?3bފ=M^:¶ @c=ϋ~R1XihO-cl%Bqde%LW KАxjCLI%и`?#ex5wSWK%A|.CuiKUh_xu\z{ Cڑ٥"s7`~ =G917 dtg*Nl@>ZcX(O&*Jq6.uOgx.: ܍U}}V"UEm QE>ADhåi^jgN仞 ,XvM =:$谟eb ٖێr^ NnO `4st%Պ}JIW_O_E\ K aB%6E֜o:R" wѫI޵LtUkc馒X"x8nR,Eկ ¨!\q@@:mKD3F)bM a\|n ls_9d\rgNt,PJ ,(Ϧ"a\˻@Cx{J4w :w\_z%h8[TI%1)+F6xm_,]6&8ȴϙ\P^VH[ D~~r7놄 Կ5 Rݤ3;Za`q̮Orj)Lo8z>~;b1*"SuB?j>*]@g`6vaUPΖgܹrQ3,P2s<"ȟcv@<9¯O}=5<4=&N٧)ZP$mO:Mk!QA2gC]˯т'zS x[)`}>>NKO&n#9 ?z/ pGOe Mp{,'|¤8:GR:0N7:f&]Uu ġ BM3w&gJi)뎅V~K=.H+y\`O s90Fko'l +8nWY}PAQ{#I%+FF 4ɵ8r;b/Á+pm(K SD@soj9m@'5%X:\ a_ihR-itV }m `PJ8CNYWju]SvZh*5e ŸM%A]5\q <ߡ3ޔ%gl.¯Uۂj[$Dˀ_Ywʌ-UӇ/9AYrjgNw9aᒆGY.<"j®a_,06&Aaw81bA?sٽoÈ4leT1/ 7$ Lg޻>72vvuVd8\{fՐq-%Ft%XSn ӼJxj>qjIzk苰|{{< R%Df J#u/= + '9 H$ԡ^b E߂>NvU:&4Jb%KR5a,hj>_9Y4zKuJ_[8Ggf9 ~kbAfU_L\>Ty# sfYg鈒W˂` =f~V2n6OGB U{/_MV@ơ!8".Z)#`O Ӌbq*=傀7o ݋X=Žn/ֲp0ġ8~\ֿKjCK2OL)إG{8fW  Qv^Y"8TWPGp W|{G77^ۄͮ!,x9YY%a9dYv4m-D;.MR`F%{ (ϐ lG -k|鲡7Q9Fx^wtbGx`ܞ~Z\<|9`J}Qp0y]{[Mld^W J.?%ȄD?wr]kV WzM[O'~ <RV?YE1"*Ekn߲X'gߥטPFK59#RrskUN:sʚm0ͰZܵȦdX?;d /B+[8R 6s x{wa4r|`5L# ϣ]DվRԆ>zY[֋̝ͩR4M ZOsx.V&OŎrFɛ.ɵh1{B1PLB@2Cu\$$v2Lٗ)J; UZ^18fBc99J՝`m?jy'P$K"]mȱ:ƥL^[և=}Ùᯈkll4T'x2Al9ce2eKlqLb&3Z@#'e93Skxemm_Ypד8γi}s,/ru0VpË`4P̭~.o n.!9!Ibg&Gj~ʂ׉qs$b1/_w>YŢ"ݤ &9l* stZa\sv"nlGk2d#q\1wO oؑE3X \p̃(%k$d*EWAG)e,X Hi ^MTk?r1N){͠>jl]I5Zq6>>µJI5 49,h\+"@[  pHK B5z}r.APaxnjBI)31YF-rnK]DJuiTgRP"pp Db9(KiLtA2)^VqGv|S6~/ONO Hn yTd O4x-+MؾU zv?)BpWP}e[٠Ŀ7WvG +1^B=nAwP㽲h5@2Ke"9B+]/ GԻց'u)%IQy%؁VRSB&Iej{iiS$@fXS;JQU6 Cș, zEu :TЯeF^lRҾvU'+οq=FY"]eH5SB9LXw#.V`Ps=8#zt$Eu$jc[qRW'lX+շyߦ8,^U#D#nҏXz(c'N᪽&6A X ̄+(4R+Z;PXrnzvP4N$ߢ&i97<udG\,9at޳6nXpoA8aƸ Z2ZWo3 ~4^EA$b M+lwU W:Ɛjb a}2P#noVw㣠o_ PxSˎU%;5S?A5A7.ج_֍F!ԆM h`lcglT>v*uDZ:Nx $3ȭ @(ujfkQU!x`a8xv~+hWN^ ~¶S/sMm)Q[1k;΅&r3Ly+9j"ebuL{HhǼ:VJGGsf}z^ŗK}Ѻmmct |;^<Ux3_uB!0)%(Ⳕ>:,-nb8񾐲%sX>&-;,kFM$dS*T7_UTiUs"tH'k^X mݗw6):ړJUd%qJ*|Q&zK/V Р\ 6d%=\o-TD#5K/c4nHLa.VppCG2oNȚ!zI$o\}h`kTZuz_|DT&ee/t/M 'չ?Րh82]sh\3y ECGUP٨dȦÝP-`pFYJ{o /"e鉻~9^E^ ʤX'Uw{3/& nhSӖbӛDgy]tك,J1P-%x]SuW4|)7+,RYby'*B#Xa։.a, oTWDJZw—EFgO&pQ!` c+G IxinӸwΦ^]`"EdjbR4V7@-jz:s'vv97D(I;bP+ 3Bm'pk2[zX]{h )yaugҁv^$}cƵ~>X:ԃy:Sgy}:I3ѥ%EbPNy,rnd,~<)M :18@9ul)Lʅ{Z-E]{Gog|^o(me-S^}5]qK"*ARb)}F0(L 3Pm榮\Ck=h"DJ$4$:n |QhZb珰Qwä< }W;;9PԞxi˶B>Gg`\C=!q\]Nl^8K{Dv`yb w# 1!a4[F־h{I! )NyD#XT;:fgЯɰ!ed*{ 1#oǹ|( M.NՋ(zIUv&NڶŒρViL{՘@*_F2$O-J:#Ϯ du<_}d+]Uֆ !UgVִ=){ ld)_jz4|:Pb"6"}ݻ;`̣ 2X[n- mq4!).(xT 5Jg/ȱ*q l`PK>F q7)l :_x̂o4 ёE)yC@8e($NX{m$E uTY/I6Ggdhr%.n%` G\E!LJ LZBRj$ #VrP|ե@^C@?uxҜrgd4Ґz'$6 oM=!XP[>y Һj"dQ2N.տ ޝ.ނ7SKjm'7&C[Z2px2Vf}ye=`t6*M] zÔlی~;DUL\S*#pnI)!7cN)eewB7!ܕF>pFWhg,lT ;ȣ4NOY+iN1Yoj(?;W(~A3 NQ}gls=)<>]@};ϲe+?Xe_Rڑ C*z"| 8A^ cK+g}r"ڎ]ĿI5-hAԵztfS,](,mdE /6=֛KԬr6LsSm"Il'FWCd֫2i<< jRwC=W   E NNayUR9))6$Y½:cJ/`pl~ݥq+;w'`\pWe/ËU؃L_'9c^LocLMtv1b6[u(ivRaL q8Ql SQ@:3A{MVĺɀ=#Q@RypQHcs#,V<(SBilNfQIќy& U^HH,sO(xqӻTaVp-Eʲ u½H ?R+|Qd Ii^؆ ߒN[vlm c^mG]ˏ?ސ9ï8W╂d΄m{܊l[$!{d6eƴnªtX /h f#?r[%Z3f)x]5@sY'ꥳ[|jQs Ϊ$đ@IVm,1S! 7ӄ`Kzw\8Ѳ~mݳ+'V5;ӬBr2M :L(ɱylؽ,ZA&T?@SY"0vN9Ed*p4Nlf݄RVj~g$!9(*$3z<13/?9@&Tkm׾U#i w1nܺ:Ѵ: Z7ޙ8uu L;G=!Y 5#^-{'(O);b e+JS·na Lḩ bVzqUSX1  QOΞQ]WzAٻ\ hdY8)sQZBgC1Sn#9F~(],ċ|I "; P?BArTr{ci@i-Q*7RUgL )7|FBEBɀ7K[6lv(A0i:(?e&wk:%txRzG! qHG&~s\+H漒̒2` xt{.,䱤xЂ-,hBkg0DD0yP#-Ԙ"t 0jPA6%6 `w=rWAg5^lىG1 bSi z7)5z29v4Sd76×B?z2iʡ1rX8w^ ddG "F V]?W/ cxuڣf.?ftY164Vo U+pAb>㚪aZˀ 3NxA@0[s _(05ЗN*1oJV/I6W7IPWYA>r2Sw=htl3m*TSP%j1T?3-4DB؀[pۥ*z%RhZ ezOjZ Qb@+qoDCk-hET^6N9{H{:h'ӍT oF *:nZ{R{ 9ƍ~h?L9z-fearCur\'L9ޏ/ A!.,XG"1N1 ڂ;t RFN)P~}4@3jb H#LrrƒG? ;7됾?.Z ;=ͣt!)(L[xlc0_C'fr#߷a⇀5&:Oy@m*lli-WŔ$C0^̈,.47yz[ n;ir쐸w:#yk25'5Լ(s"JWnQ#G:)3jbEŝ+o ۇLw h+֌7y%x0FzQ?0iq+j1(`!&֛͆1F{6P,kD 4 aә_ UWZd!>]~ѝۀ@z+r,RՋѮ7g`7o_jf,yOvj6Btvyaհ4+Jg3M෾PklR NzT7c#i', MEG$[HbŬf&S=| v2B%ґC IWL`ACV`7?b 4@Sڼժ O Z(MȽo(x8֚X˿$ζu_(mGXZkщ(;hI:18n~'2>} +P9D𥰫ە DQ`8Xv"'j#}}py\2謩ƠpHonv7{_6_{`y1wƨ4B'GC>3xGw9Q:#h#-ׁEGcT9>iy|鷴6rҌ;NO¨JvH !:ILd/C0&-]˥!ĒS)Ŗ? 5qHwli.W|9U-R*-H&>ű% 1iқk oQrϒMru sQSIB֕G_@v4 `xD~9o*H}å %:q;^Fه׵ZeϞ$6|XBO:/ON:L틦bqaO}yϠQ J{Ӵѵ 8VTH0 ˷C͝Ettq[K\>g~3:l8DVp {=YpL#6yԟEe`|l2efaA%Qb/HщU]a&,.$k/>:)]bt@Y;,>^Ѵw?qGAV%nXQ'ZMůf +V0ao!' D}ssc&zFDŤ؟bTf\/MmOMH֏{ٳs8hHrp-5^M~D'0@ep}ƏSXඈtqzh~ ;2D"ehQ"cao5PVĉN$ARx+?I]D޺]yLY@e0Hp{z{K@~}_~],O\s[% wxK(~=P6sA/y똷esbQ$]х4w Tg) #;?seAϊU1jxWٯS5Oaem2d8f\)COTo( (AʅAk%;MK3ԧLܼ t-2+E,B{hѷD5PJE5_U5~S;H7"nQC &.3x+ *Xt \ݺA'mxYE%>AԘUe20Z6jc1SX to>{oT>{F_*=owmMM-4 Rϲ}L\*6gcf~MvUU:^MLH̟0ihara3]F!H|N1͛k(*@-!ĕ\)w #:Y H]֞XĪaC[5P9ridsmm&}2ƃ~藉v ,2Yos bFI$]%R*<$Sjdk70l GmDG/҇,' t*=j;Bl,xA AJn?<{/ue)0%**iv5+ޚwϢX7Aঘ)OA ۭMzS)f̦}c.!gqmG|sz::%Er#7|0LΘū*K~X'o#Kc=qm&@k"d+я)H%a7&mkqGu8b08 = V>$7C\yI0R~L茟~qBqv:3{pH71kdfmoo0ÿ$),1s : %8.&׀ssz+ւb& d2c0,Փ׽ʼ7Ѣ<j8W{3ZF4u -+)^tOnaӷ*ԛl$͓ {^L*Su}jkaL1$l?um:s 59K 1g% ~Ħ40|Λ&Ud[9  'OFaȔط ?)> 4`œwJ+ $/K1h%8 aiglH3vȑ쌒Eޤew?zG\k6 YYāg|/Aes,\'$^Q!#j&RZsW\-b?b{E|5F}iy)mxǞ?3P_ >$P T)/kӇ*}w7 =99"L#v?e/i,ٷ,'k!x'-o0x[ .'FeV9ES G]yxNb$m!&rW`5S8+f`e_x4R,8ȷOgT/PDBc %Vb&}3;8VmKOJjcZzcF_`HsxBhD,?#-ܴ|e18}_2=V"B\_ktFS|ﰉ4iY[ٲJ/W#6 nRZaHx?q%SumM@3}uۡYd=-ȸo,z̓MeSXlؠ{XaDHxoi~Dr Kvͺ3p\{/5yj,-!G[7Cg \͵+Yqn\{"]/ƈSTyn /aFK>]Kk TKNOTE i6b-dWzOZG;U/|e]$xjm?c.04ߣfϕŗ$Kz:w(wtH@ /yc-'5t؆6O%J kI^m8vso3 6F| "JUC H!AZs~8K|w©X{ij7 w_вckQ jX/m"^7'߾ 3}4?_ zvQ>rG,HP0 ;2Ř DFҧ #(^ꩩ' ٹÖϸSpҝ+Psr@hk\xwCu #P nl CJdH>tXRU-G$P'r83^81/e7B &o3xm6_/[7-h W- Y-8,P X -RU\]!PXB Bb/\C!`5p/fYrFpcFjq"҅-En>+eǏ(/5TRDz;Xa9@_XH1gp.,AIzwͿkTa"I/(/7k6T\8h_+.r)16M=jL5HZCN9Yͭ}k8E`3G{}% Vt0;9Bbuȱ0bs̻ݸC%t)6l^Vsx*=w &*P!݉AIoƒj۲6Ck2K8n:>m 260EBgy(z <]LFWIB~e~:Έz{x% .nvF eN7ؽīxxΊ'KvReGWn7Z=RDa܁JJ}1nS-IDl;1c㕞v5WRVZ]n0O*8^ ",W3Y|򶘽&Sl/0Kv)GV~L*YgېaQ49.pHȒ[Ͻr|/ Mnze( L]6Vtjx%wܜZreu9B@|T:tstAq>(2ց1+FXH~R>w ?0JWJ4M=Qo E e\M2׬\6Rd@GdWvF1YC [R@=9˚>jV_z-|5$ra68=Isԙ]ߚ UOJP=5,F~G 3 ϝx֟VR4ʺq)I+t,"̘Qp04^2UIq֤2ly/{}-_rIPn\wCb"v2EYұ#U~GL(i<תv&_0d#LD>_5\o&+dmzYv q2r&%ۂ1?JaX!:F LʃrmT 07/*G¢NT*vI 9+\}}ҿUϔLgޅPK-XVOEw'0*n@oNdSt>%WZ쑮c? ۀ3懄5c|uBʧTO̐LG_A&U_fB m!tJf)W͙'MD%~^̡7=ؿXZyv^[+l| =S4ˎ;=t83.^eԗ,^b%.mZDsY!E[ki%d ѭ͌|/sk:drwjWm կUEb75Uy_|帚xMAw#3n(v{ZkY!tq-ZUe{ۚ;GL a=ZTkƾPufTd+Hx8F=Ե@^qG'P%šx;WI9c"!1PVw{5'L3ވP;vx֞ /,M(c{TK}x"]F"CFjWҦ& 5f2-`~T 6H<2j>5 M, VjZҪf$PWp d8,z*W'59ՏcWּƟ騡TbuA.=77g 2KK4?eL% [wF{רX.rS$fTp`EyZ#K ,TG?\6֪]UFMh?{2r᯿Yu{녘'"mpdҚ tk6pǃw#,stu+7J7؜W_ťcǧy,N_TAy~8 j[ v tM t6g>,uVOƦHGA/t-tp<=өxxMg]:j}+Wi]a5ҢNS%^Fb~.3 nHreh5-;ws⅕FONa{G. ?C2ټouUr^J'}+?.Qo2`BǠw_8hsɬ#GG uzEѬJrQܧ\lʪ,J6POtjʾң d_<pՓib1OGfvnʁ R=k"dk X3_ӿ!lP&]}(5{S>QЦO~<JD\JxCG_͐;30 K<Ǽ`mV4΀󶟒)Azz)>,uAUWT\3_*|͕XBq[c087p\,^oC4̙F /C_g@Y4d6.OqޡЬR;pyr.jrJo)>}ڜ vH-_Am堽EɋOEu{`78XS{%ah?;r> Y:MMHxUn,mmjeZH̬ʏZc%WdeLω.|YF ~י\ԌoG'Y b>0[C*#i}U;(8Qٴ7ů,ZlTg`YCi3&o$hay37GlļP&0eu h7$ #(~ׅ'hǚ $4"EZ9z}g 5ﵐ";Mg `"$,c'o $2ީf ԁHO%U|қQ̆yWD`Ds$%}') a8yJV,5㖫S! $=O\cd< Hx(JawZwEm/x Cvu1"1*+4'%ǵ-֚J U5ld/lSZpU@'|UJ)c6Cqav8#-PT?0 _Ktt>R)<8 'yyc;qd@.vnR(Ԏfk++Cbi}Ox%| r n yU?aXSz?.tRQES D}\z@&cLƽ짉;>7 wG | wKRW'؅ l(tr95Eh\c]Q^!J AS;a󤍣#1IզK ^ϙ6a6UE6PT=n!!!c_zpt EwWfP^7''լ 4nUGL5|7 #K;7fp+լH9JE!BV3>f~*XөoiQ;֠w﷊:Ȟ6ZDOofa B$ Zϰ/نTB?ֲ _|+@)ƲщO%#4%Y0k6(ڬL^l?oTњFP3wI%4ﲰWAJ~Yg&o@j73MTyA''νW?ިR[/ 39 (eM퉶 Bʌ=Bj 0k҂wa&P+UI#r՘!E(nGS(Z`^8S)l3F$rV"f2, neMv}@+Ϲ6~:m'{ɋ : aZ eS6}v_c.)X ,6gzC@RYHs v;G+YP kk7m7%RH? Ȼz8@Π3AW<-E>s5LDnmg@3KANJߛ}/nOakkfn`xylH3&g.p@=vKU[}B)/f 5hwtqU^ɔDf8?P`C@^٦^aS[H`_E\n_U9;ZDTKfYrl|eޘsn//xY"31F_EQ8jzIc]0`0eGeqR 4m#hڠU(1' D/+8~٢|#x\ͯ ckvT*Jh_1a; U@ME^>W"@桞:ƕA\н y@pf~STvMŽb7^_wBcޞI"ib:LE+AwVgR ׉2C:E1M$ƼyhlY+vڇs,NmoNRRXMXޒD/ƕ^g'URCxUw_?*6~ҐKs]u7fn錘i`=g R¯:_iƩ[)IH$2kՅMƷOut#<R7e|VvR2IbL^,bIљA8A(g( tdJgV88/U$n{L97Itّ bɾco'0UYD+;~vm$kv޴βEܽDάbP{>v&WwڢCڰ;)_hofNra|(B^)OR3gA-,k"́hwo;8yo]]-@${9`? WAxB֐y]ԑm]OkYu~.K-K-s;ίRF-;l.4.Ql9ؓdIA1-6b=]:)Y`q.>8ùg鑨.*\ ,0eR$c'e8dTAv!{Ȫ؇jq(Ҝ͜=)P)7b$sI ݢc2 H)#`!#g} u6ORNjS.<҅ƆB^Eaрz FĬy_Dk8EYP Ik^ܿYqDSgא<}R+RͥCp?"xL*:_' 㼑թYķE.A*l?3돊ص ,0i&r<74Y@.x_ rq0u]d^|x(2P5>_^řmy5^ 0XBjef0FZ@L|~4q[˜L*@M燐zB Ѻ{նyH&B`J_N 2X ;NYY5 Ad%v:d3/ A|'˿Dd(3"蛛ťRp|xq c6L^ F9o ޕ7Jy`R,sЅԛa̵R@ xjVgZyѲyŜ\a m"AN?uI湶IA|F(l)FćΪbla}x5p m06QahNmFP(w햞ĻNeHkpgW >0zϛl[)ӗQ'MKƁƒJ9/WT\l5V9ң@Jclnj4RgvxYȟ08?"h*{f\(v}PO~U׭ȳ>Pz,jo*^pSeb1__w,#1lvtF1z p ti~!q6@jMnj,4$R"๡w"5T6f~UlluubwkC:/NfWq¥U h42T2"1b:sL,BHl&VJ MBjh8JB.6| WdY]kO v\ⶌPirkY?{$;<֯f\z)wʍ:fBh ]3$5S[]l0>#o)-P1k${<K xl$#3݊ɗ*պ1<_Jg>uy7we؃~ĶCESJ NDo!^d) '5q1rbkX-&E"ڮ[RLl.Ռq^{ $^{ ;*}*TSg\AneJ]|HlϞRFYv XYs lECὍ=jl\fSG^c/hyNVEjg9נξaZ}.FP^3(a׽FNb_4ˌv0!Y8z2JB n'.߬,WF k?q鹾m Alu0_#k {^,N3mԩji/@ 59u#E@ K}0ڎٖI ͊0A#L FwzbDC|d)p2vIIcDzm76'0oFoG5 [$}Q*,x(ypy (رE3Qr, F03<(L~][_^TSIm!H|=rl m%wg^vqDre 3Gc&!mD+~ j 4l0^uJ!Ry@6𗀧]ƛߏH=2 o7faHf1ֳ = `w2BSsAUW6C(jihu~ئ䳠Ϫ&Z8ȏnu(ǂ{Wեؽ2-T q1۫ă֪0}bMImVAq\Q zg'z|NGZ_Cጺ}rq,kz$ zL]0I/Kh @ foxniOsm>YEM 0HÒOGh-i=ZU6;#\fFq7qaBJ.K=t XchɃ,#i@58^X] .'d>074TJMͲ=- #:8藠J 8&ge.ϿeD{J(1cUu)U{Ξùbп {iphTcILaPQdH)@6VIrGxHlWzMNێZ606@# oSC-p#)lM`˵L3ֺ.U@^?ʊBYmf:[/(ׂz(jP5ƩcjaKz] YPTQ;]dufu[a}ݷ~s QBUIVgvqvil3vD]Qzw3kDFb`CP.ue8GVm,||HU.،-5W%y*SH0[L&䀯Q||29DmZ8^ݛ^91ݴ?% Hbe23&aNWM}=?7RLCnn4fc.3w#c]"RVa0_ʤnMMAm.L2~rCU R^Q"Bi&~ae R O09M_2~lJgnJMɗ{hejx nb-1&\=EeOӔa_W֔]~"V/EV Йpai&IOLF2Si{i랦 S=DXY}ydoSe 3QtI|!XIYbOZ4/j. R [`;*{pO KkɆLf7VhֺUX51!Qm >IsUf1a g'u.a3Iƾ?n|ͅx;FڸQNNֺT tڄ1NSW<^~tũ,$2a pxO[]qh r Nߠ1ǚr}&A?C0oe~F]F(W[%xVҺWþY2C''rR~}3{_ {J̡ecKN l(Dr<84I%j5H8~Y Js '3*?xG1k׭;! G՝2φUdOɐ < 2$?zbUHH1ʘD -83潓PoݲQiA%9Ub~}kLP g<2k742QdF>^c%lj&~3K7~^EQ<¬dmx ^t Uz#w bWkD={Ui?j^5V푿M`mbE56W,`Z'-դh3޳FhPb XcfL\36ܲ"q`nݻ9kqy!%i f3:BD {8pjR9fd/M=H3p2bR䪨w-և?x-qG}>4$aɟs?OۇH}3>aVe% \?Ѻ#WPG|?P:  EƢ\Qh-9ՌOӢ)q.!A vʁ((qJlʥ,"KU_̜mT϶Paw8C݈͊9e8 Z ]HmйWq 1ucZ dQԲ9I4V`ef OiB>[LHit e_MN6dC{hLB#Ӧ2D_Z35 hw*(Enݟ΄~4^̲rDb7|d^(|cAN;_YR9׷1 #5,ʢ17׶mQ1IOذ=lϚ_nuTXפ<5 pO,`[~9g-RW8S4%{^yk𡃶3?xg4(3crCF%of cЖ% Nҧ?L .hZY" ȢkAY`GPdlM=a%ʉZH%dZcR2:AWET&* w͖E&ǔvap캓@lcEqϰV=zH+J62(Gl|BQϘ6ś=̖gRC/:RlRҥERC`f݃ 3GSZ%iWU⍹M"E;$Z<[Ϛ4ypڴtM}ɟ6&oNg#+nRT^?@-hN1S^x{f wl#?8ڋv@4H ƵTtQצ{_W3~ 2-=/YJL#2_)kַhp&kuIӃ $IˁB WO; <8/0uh{ࢁ(m`rov^tʋ`M#(g>sr&3Vȝ'58@3΁ޑ1ѽNm'p,|TD#hm5̂B5 &RnNӖW?ȟgQz<:}}G|^$osj15F. -@a!rn6񃓞WNchc7W53bYovoˈȕO?m!⟟`pO]/y`{[]ql3c/%I* QӜ?=ן?KXvW(SMQ;\$3b@1dpqzjT赔5\BE|A:Ga=}\k( jl}ZqphlDQ',aC ~Tr'khM$m980t$=+zS-pkA[Lo>~ c*e5SMxt+]/K)FqSpۿui/Q):T˰38mkU.|jwU(d3}1wyBq⍡6ݘ2Fy~7P}ddWҤBERۨMeڕ&ow&Ow{&*X-]Y*'?tSʩV)b{> Ktپ9&yȻ?/]9>yg#@0e@Į|ZIH&,Զ {}R&VpGXPIUnowPPQNod>Wx4S)a KTz1qR "DC^Ɍއ VbbQMov1uTK}(\mxY&o>h4ww5 +Lv+ Ho:fts[MjuxBT,ct4GwɸR1pAԔrV_I-!N.ϓ#I| [5 g'c=QFVybgRm̍Qz\iDLL6})K=h~!Sr>X璚CtЄx*sC3t͖[Q .i;(,Ak<& W|,UV[j'l`n/)cSR(rn(p[Λ8> =T@2պs_ }aP[JF3cZK59PH|7OR߳QXxr{3.qU` AIE_Ri8QC3=ѫ/蹤k{?U/ iյPワ?AGN`ԅxD[fǏu1l3T~7a)a+śn-sz9ܝ< `J EJzW"R8vK) wneB%&NbzX nڇL 2sw콁;3R{FZ1&t]aPT龓>Ow{< 3Lj1/GoZGnR]ԉP{IhQ:54Feiad#O->1KM?=@N:-Z)|~X$Cp&%|b:_"ڇn5V?ryyfoo3Vv' ;5uŘpsS.2I*oV5U;QZk( &H~If3fl4D1]R,.' ָؚ~85 2 XuYO54~YO<vp amp4cjcRFLqD쎧L $+vgd-"rn=oBJTC C6ns9n/G|}ݡ7恣m6`r$^< eolf e)y_yex)o&w>kg0B]*Z[i3sA=Ÿ]Ž_@$%g28md6rݗ19;xgEkۼO3@;u[\w}( X`ci#ʄ0C*Ճ*5Xn469DcӀ%B 9 Wʵδ:d͑i_my=f"$`[Ax()5rFeIeCE _gA5`s7l:ו0P0Gݮ}'iV:rҸ/aȎw2EGgۅЂ"1j] 9$9xrM$dKShg(o:7#*QZBi,9n7_v|h9F4(ds M+cᖦ-´70m~xw*H%`2*Me܃ћ׿x#t*bH`_.݇{Mzxk[5`/nAx~CL i'Ld jak{&yfp`!.K.MPr-kwW f^=/UnN) P莣a9|H?,^Epc}pqw25 X "PqqнQvCH}ꬖ3=|~7˱z0:1Df?غ ȴLO}_\@=֠J)/{&VwN0Ѱ__3ea}ּ;o qYQmҟel-T-_^Xms(fg8_ߠb֌[m}svHk^4UjI)sgqyn Xw'r{^❳% I*0d4GYH*~0M=e[Vb=O9NvZV s6- Qı}&M] %KջQx|B2^h ~|(IbQudGhS#;0T7McHix9hmHanD͐𱉈d'eR~kBSRqP:4OۆCB}nՏ,ۋqK5Ј-QsF C)Qe ewܫf/*UDV.yrDStDbtNb*6_a[nV/>ݭ3t /2jЧ~xd,1pø#sH 1 z&e:0:ezT*1wx/fPκ͞6&#LR ߭ 4%܉ƪoȷa0Pl[VZ(iDUn b4MY`Kb֥EiFyA)_@!; Z^\Z=mE@6 FΛS=Q(xj6;Y' E?z b))#7IzַO'Dcۜ(MnT@;LW,{)aj0 `B̺GIң%ʏ12z-ʿ3BMNHb(:KUYB ^g>ỒwNc;1؃f AP[^răz{ضz$6MZ#Ș#҉?ZZUK뚔<~&Nm|)61Mũ}Y;GZv˳cBQrϐBFH(e48eCO-)'kA0ldAb'ԘfjlJVw~*Owlabas!J Qyߘl[C]_ ElԜK{("pu|eͳҼo!{jL!: +{y;c0YQ6t nx aB ; my19=?3 iƃ.3SS)>8[= L }1g/Ua \36uoMDi|жʊJ r쾛aA̲K0 '._B*IvI[a&G}D$$Bh2FǦa4mI!1vߠȡ14|( #^,;iu/8XLp"Z]׊iuM(rg*Pik=Q.k$kXBM+v_ds9ʺc +hu ۯ/s˔\.ŌqJJQ]/OYRov14$dp @[߄b3IfRJr%I47;ҀNuCtcF) X*Xxϓtff(BU|[ELAl`gf}MZF1dן- 7/ͽLXz9kT$;X  ŕ} wr,?0M{Μzd_n^p4LH) أ1vzI/<_{ةO)y7(pgem ij:2;$J)wnzzMs* /gi|r8″thKϔ!c^f5no=)Q":J-mFSO[?ynXPxx2 шzۻzoOBo[ ͩ/z(S<| R즸 rV뒖{-E` ͧRjࡄw:!f -V_ob^CIZ޻`ȥk>n\\^Hq41Hwd0¯"F+fX|(c/bvA&obKiPb8,| x= >Iw@$0S&2oyo ru/>YM6F2yr:ss!\B&N`>՚C (jVC83E _:՛qh؇|rxj }n2ڱR?9@ů7k{D#c7^A:B;zxd3m.IS^.`uKO$}ZE8 Ik6ꮇPɅ`Ut7DaCWׁtP7<*[*a]AWi\% %g9ﰿVAl(ׇnTZu@JisH}#{h?^%$LĶ]Nn kH*,Z(ҒSZ̉:yVt5`}ۼ% -H`&f/j<&<>׸:4aZq銖-F|I&]1P 3 +y18ƕBk;Qf!VXiQxzݮW3a=w=$3;Dz橷k-̦sy:<ʹ \|)[X2U=oYآ5wnkMB5$3pƖ,5}t FI&F GoS\1 tcA%q,^);M'WtP8z+\Q@"jE!{a5뤺߀1ӱ ~ah a(\q0%dMA&_IR"NW74 }|ǘg'ò'=+R?=Y;(h 5ys~’G 0@A(]!\N= [»9rwooA,B.poVk9 KхˈyQv'\AMdnBn?Ƽq߾A< 9>R콬 l2NEHx̰k$IyJp/62,(Wk{~7= >uxb[zsG̙q8PWML}298\|O~X+XSKoCpɁFyiQH΄s%ZP:>r*~,FLJvt@ҕμ9Z.@q! O+@鵌& 4R$H˝TÙ(K9DnLF obfB3/͔(95G$y/*!5.}ɐ(gGaZM_rXoւC5hr8nńUɎ&{) p^^(Cޘf<\3վ 3*9O+k ,GD-Am.E[9{0C 2#`}/{^7Slb2;aKHo" PRE2ɧko 6S͕2F XLߡr6tu(h;_Pt` H"PФqo+|iB's@.S%`h ~5QGuq~򀐤Q%mɗ ,Nൺ۪wW}אbHK2!&A6])[N`̦%WS,5 KMHd52 o"֏@qpNU4!d$y Сz^gv-#*ￂoIW$7$i~иèF˛R-籱l FZc,e#/a n=hgGCw7I!FE-yO7AU"!n}7U&57fE5ƺDloD&g(ӊ-rVReЋ ::%K4/c[c6$L Dk;Rb<(4Ne{b%`i!ـ(+bX\ijMD~F#:wLT@rT+-p0+,VFꢿBYaT.`||H+zAr0.77cה(>O$8yB¦}'%Z&$QKuz/+pS6 OxFМL ̬f{;Zfw0g0ox]|S}Fۧf%X$> EȸDQz$ SԄA1YDϛVSp(=[M~ 58 yQ$d haEc`AG ={sQ0=x?d{ˌ B$2"@i@R[m4fsT_"0mΪdRuf }]aڤ"aɶaɥz ~0in_#P@:H5FjWjuAͅ0A4XPmGIHAy?8v=`:$>aؠmbk+-`Kz$Kk1`IRq\7ƪ&1#{';9Խ+c6Yt51 ds,M:'5q1y _\nmGGEt2 )7cHIQcaptűBG?4ȏϡT=BiK?w *vqwEtA[,0f)לD;'G&.JA`>,7rR=-{:/aA55P a 1ĎCU30jSHRt-k\6ǹiZSݹ-;%[C5&+{/vkj89t\x2&13䞋AZ%#tУ}kcc 3lj$O(3 L͜z>!lK >EWhV uh`8jAbzBW8! ݂[[EfD7č:W؁8 2]\cKt hWB54U+2&9B7Dg%&7cy측e#`HҿgIEbdD3ۦ5!X3J5~w&ו43CcAL-6:׍%N:2 WڠKX8!\Վ.ewt82uZ$x1rKʀ4@{5hmXc Qp1{}/_ɊUEtk_4mC>{n] } N6z`X4'֒I3 lPU/7(_@ZM¸@BN@?\檇F@:+q "}eUOI)f5. l`B:"äٔ|@_oye:%8b29(aha\[q~I 5k6"5gw SpNGͩ6~0u1ȺM"'}qeve]c)=CytgEwg:)xFP3= ènuNU _ v\%X3K} *Fk0M#"BuݲאZ(Zyx!aiHl] y^h)Rd/Q;SϞkj`0z|;!i%sAEVêplEDsY=Ff|jڎ}D eUzx!EU` yRYQj|`kHEF )db_.4('+Gy&sn*C s ^8"dxUhx};6,њ^ΕM3g Q'֓Cq_j" PkkYĖ9q z&W̘y ͒Ԗ"J1zT3c^-BCK 264h +%V[dVv_|/0DD^kTni`VVdcl~w(s͡zqjدh2;OOdK}sBqZ;zp/&jo\9#6uRZ){]5=ʏ3Ѭ,%^"D97R,]yX78pJx;.P,b)8w ę;|ق+ژ݄ʭ0`: AۦV<;2?;p&Yoh9=V5=Q|:8$0 gn̔e&#fz0asԉ F?&LvY8{%$} :EbӕVԡ!ZMTw>|@@fYB'`zݱ85 מv pxϨW#JfYRP (~m_͙őecI 0Cíj'J"5_p5ނ8bu9tF _5B\cu懧 &]` mCHu{ʳ uM P3O6ս@–Q{ђ|F(ک:)c<ONxtt ע u 4zQer]@/"JкPM&,wh¥ݢȪW$N0ù:|L[@$UÜ̚\ߦj;pfOLEmÞWj1PfR.cR~jz?JgY-z:yi 0m+"_OocOD)xQt 6{?`8e6pP,VxJ7k\ Vct`kQ@Zѫ\w)bEDqo0Y,L r~x||/~Z-S%yCas e6HA4ߟ*(`4b!)^jœ|OW%fxt-T_Ft6GQttO. -hHw{uv0q۳ݫx :&KVmtOdh hȟS_8HXk3msf9$}Qީ%P( u$Wt8m/+cn8T\KYr|p Z؀;<#,5hXHnů@QG"/wyl+]Ra4Aijo<=LJ R֏V/m۲}0(:EJ1½v\߾1Bd@ v2N /!Ge׫Cuq3w9Rj.x`g޷Z-?o8.ҧZ t[UEu)+q'4 4+c^Hx^, CWۚBsfYmy?!Ôܿ%OouŒ^t'㻍{1oFi!j "2v0sS˂šXX?zڼ[66KqUɟsP7t *3yz{8Cwށ͓z * 2wv}orfxÍa(fC۰%,ԴcCͳjKW_(\uj.Hbq#6ca/VE RA"qkԺ1߆Y|0 xzwҹ ~y&xfJu]ĉa(? /21uEhmgz$m0ɾ;r/R֨KlXdvsʅME jOk>Fu9[4@]9+!N X@h#vC ofX9`r$ F A-l1EhgF4 3u0N`!1+  `%h[KO! ^̷*.㨎HPzƪ |6t_^gЕ0Q:+$#m}%͞;&ǀ,yt>gƲXe#$lN_)`3 ?78f('./\j,THR_X]!; s(-}*\%NJ&|˼cc,BO'r%pAdy|oT^:pR,0IB&,@b/|n;Z |ǀ~roȍqɆ]jRb*䔏Zmy FoZ;`^6?A]ckQX+#"Pބ4W[lxYS!?PTNND-C9~ {,s&pk|/XK'j:Mdk"Gld ZMNr)N~?b7lm0'^Kr{y gԨ귒E`͚2B ŀ-cvHFxlRӠsc󵢽H?.']%y+o%47y^wO>_DB.-hB]jk vu)3;[[U-RCƵn9?^ 6 |oc07Z_qh n}|wgZ3^6s㯢(7A#]d}N#bߨ$]C,Tneȗ~jy9!TnqwmE@H( 'Ioj+%:: Ų}\I7'Fcaد}W?-h iG1K( x׹$V/jY 4!2*Bx;=Iz=†k['Ooq4F*.G!|%b/%iz396窧fh:{GKsz.6&E-|hdS H+y}p (! 1ѥ!Fܟ,A/Fwa.(0T9w q}3Iwg3 xXM+jGX`F]ªIق ehi4f: bT΃,kk/m2Wa&j^SH;58M"Ƨs:]ˎU1(h5~3ޓSU=6/fW?Mv1eZurG9{, 0x0.9i%OxK2ӾחDӫ>TxU Eꩺn~)Vw7)d5'3&e+c1:zɣePͳ"dL]`g6.~(_%0rYnTUTNP dA9kiy*ܦi /^Ƙ@9.AgMyܷ?x;/N|>4_ˊ4ߒ;~ձC.aުgwRi3CP?[lzLOpXīya?LBʕ*Z*F<{t y(˔ +fx5,l";a8< JjzS[M*` ٦fTԚ|c%)6q6QŜ*E%LlVKxs0aǿ(GWRl>Jw4Q!`t ٗ l-hWwu62gRjTl-7"to]f@yVG-@9!*=BU)0aLf^ CWׇbTZ\T 36@I [ܞD(Nj*q&#2p"G Rõ. YxhfP:$zS;P?{@?yAR=yLϟ$z !.R !nDqZƅBGlfSPD~ߕ+X·]x)Lo?FoH$VIbF>Z;@ENC k]Sy,C%𾢒g0{uHlQl0.$PƬ)O˝HwZݐCyyݡi- Թ4Z#;u(aC7̐&)Qam=c]PI{4H<փDֻ'़Y ԟ%9I 4l࿕f?ԝ UXN$/jAB<4Mۤ&n7 ;aʈT;UU~oke]<~paƳ @'DXJ[\(Hu,ZW5j",NFNUczBO-;ny '@CNwT@=wp3M+m`I**M8XR?a<1Iz]wׯ*IuF7[̪ccnPȩT&D|D6`2Fi5n (5TULL%yk`lS,$ಹc?7`D`YdӅ7|`&6J+د$L} -S| _qGs*zOO#Oo@=ZSQ"M<žUﯙhrwawCX`HT"Czt_zUy T$nX4b[BpnhWv~_)R 6Brl4 T'2Þ!25: %R'-~ה!}4|%2rwbEaTDHsbȢkcįg8!+d/mD29bc6֬@.٪LlfovCkR`*q2IX++Άju<]ӿowBk01Pל鱳߭ z\\NuL?JI#[BY]O:۫g/}*=$EHAo֥W48O@gz}N r] Oc3diBE.auz`*9BF$^ e˚ ոͨ럾8U'}Hŀ-4eRڇT=Z݈ANؤfZ|R];riR#UkqaB|NqB.1&aWAl85@C1N5} sBNrenLv~) } RVY7 :Yݴ\<\r% @|dV,LK讂Zdaɬ롾Vh[,-=9:8w@XR?63Pj RF.J#*&1@j;&mh+(,ꏞ͒HmKрA55t@3DTGZWN0kx#EpwՙDɦlNmM>bJӤZP0‚(Bm;/+c+)a#WX*6foEl涕ʼn/+aZ-GTb':3 Wtf/Ґ'~؝w1o)IМ!MEu*;Q*E*q:@诈gl3O J{ZEex!oɂvxUX'sA$H/JO^$5/I.nb5͵0RmT*ᘁqf8jbZ9z:jC<FQ*w7pĜwL[lng]' Wľ#gHx .`^Gٻ:Q|s$w*"x`󓃈gkI a;) %dWD*嫥/Z|pI b*P`k\ sUfSWSl(H"7Dݲ84؟vcØM}=B߾^Hw^90Ƭ$XC:[Wޜ1m=TU{*7lr YPLeoT^N~;² Q$S,g\naԧqDMvxil+'p7ɨu]: 㕽RFeL ) ^ 9kU6W^ʰAZ}X_wXTɃtniaܬ " R aW4-M?[ϠlwҌK6O*qug}ptaj2xfW_BhR|.i'r1bA^.-%COU +C" \}Zgܣ 3<b_iOsqCe%iJN13hB"s԰}ڵi$4'{6> <~?6_-H UK1{@J?2>~<8cC)oCROs]||$_!+1 ,qdp"f;0kl.LZ2 CI ruU{M@^k|ᚱ́ٓ;"DΊr+{ɋז iN!gjoPIr}c(F} V<]%9@t8?xwa-3lnC7C?MuҤ^Oj8]0.b6**-i"gjWfaa/? ֥ʪD/ t[)RRךlk.N`\ 3{ z)7cxM@yTd&ꂊ93O|ai&JZ'f~Ep%۬RXhVA0Mv,\rP~q۪,_=w,KĩMS\Z=2Sr(Ch@1 @N|&甕4t4Y[ث B^YKOG `}/x{y$aag~06Ǜ&[xqgSM+xm<YwB{%"@磪!ٹlCHoY~$ KԌUHput\$@N}EdžP|R*>R[6slKK_YF0c#s9\f01?Rb0hKix-;iЁ@u`$xxRCY3 5P B V*|.Ketgel b '[E:H1 udpt4=.?)jXS>GZY]T"_x/m,U@N~]MjL8ű.ΊmJ2_HFCZrNN4mvD-ߢ?. M1\4e"'@c^~R?跚'Zƫ7FReN475: %k7bR}]QAD xV<}gȇK ǜ^,=%+S^e5D5Ax/L4,/xבt94] 8upT] 0ia;EgK6:@" Ղ\r0a6?Cm]ͳ}%{aiyTɽYpVI"+|ђPH *2>2H\"ߢ5du =*MFN'#'Dhq[· DC *\j"h6:%G*T7Y9Pf :Qi<$τ)4ˁ]fZ|nv2ɜ>Hs7T$ N*>9},_ZɥQK|hK\QxM1#Oz{-PznNR傗zvz G8Q@giFG~gol,-e-(8{qjszx^{`J iEgonU<~ H%c*&%w vOG js[\r~J,sީl ݅QfD%zsCh`Ro{6NiLðXFdk;pqT]?fP: }XxLn)coa P|3,wΚ<NtZN/j|]8Wl0s+džP=;e|Tœ٬yC*~xkC14G#C)o*R*Rjuo# XAUNC "ib!E: 22Q#93iaAq7x#PΫ7'~[\!CNE?8%X{3_ٰI)!<(EPMn;8F16*p=2EI3<W) ? ;Ӏ{JH,=$&ٌ+D4Jļ, 0nKLF^atMME=C@,7фX@8oWcz0}84:HXHBu럅{ٱsZ`YiHW.va(6PcC KҷJj%# caPkCcqtnjbY6`H:oW,âfV#PgFU>TϗUGY-QP|qZ Mj"udKNR6Ib݀V#3nvAu+. tX{Xse$yAČ$B=Նߦ ݒ3CB;Ԇ_Hi!YJeN/Mw)ocE$$GRą@E+C~ 4aݜ `6.Wxd9͓)qۋf=8 Q,]CXS4 HC,Un׃C h|ЉIŃ/l$:r11;=5D+CǬr~#W3=8)oX>!"BI(ȉxUE7I&ZC3.<~l>ѹxN[fu 딶XA0?v̈́fotr֊``Ua{|Pot+gk͌g7|%HQ2e_L6W3ؕ`~r$Vbcrple7;AC_ŞP7\[nWD y1Nﾔ޸ҍO=i\i \nf|/m@S7~"^pK=ᧂ+_(CEg h>svC7äЊ]6n"ڝ@-ކ bzZJ!p?chVUr02m@f)< LǍuq<{5ٰ[I(#y{!}R5px7t`ʙI "%c部4oo@0ei4| D/L;@.I`UW 8xj7f,HBaXEBGn0@G,$]J;7]{Y $F˔s*lt_1FxbCmwj7n{B[YZȕn0)&R&Z>LtM9%#2bGhi*{ Oٳ6WbB,5f tۚx6nai~zG]l䵑{#{dk;J!M7ޜNѾoˠ(UPZCܰp 'P}-ޅdQ'cZbpe_y" ! Qߏ2:AI#Hà}6|ԯ<wV2Utz̺D&Ġ,413]RXٞC6׷it%B5$K+V$OpYydbJ@2trF2Ś|Xʄu/?3p*=n|C33קIj{Q; 1ѾuCX4Ialv1{hgg_n<#sʳ 0wѴ`o}\2-z Xs(4+]݊ڷڤ]X'm@wO|$^ʫYa'O@f8EO}x *h3f]-S6'A项3J*zc:qN/J̮۫;0ev'B}O%a^ɏ=\toDK~+o_({AgMù~ȘӶork^*]Nm{T~2-X[=<ǁ\[yfY;(7GX!9wf;~ȮHR%MȮ|2>%dB$;i%Ȱu*݌h aGbWe|\w+*ɝ`Ii>]ch.q/V)0In{4:E)<.I*#Q[s AV-;Rj.Dٺx6 RO=3g"Y? N͒'JNL}5lşHKoFDk"iƎO%Я*Iͤ jI&Vdtjfi{_4ݳ~3 XP##Z@Ta#)kp$IpG, "9p*jF`di2=^ubyӋxe?tM>i~|]CoBvU`@" H#$K|L5!6Is78ZDΩ%tr6X (zSؠH-OfIa'DS\*O0o!@z5kϑ~ޯӯLڬT]CW셴K<(8h{uQXsqASb.aq?B2%a:=l-NOS&IUf|PI2 Z_a@*+qk9 NyA0~1~ 2{0jP[x/J; P~Ka{% N8Q`LBWDRQ8ӈΫ24kл lA Lf=h(:zϴ7#] _CHZ7+ N!lg EC o]0 3{UZˇٜ 1tHc fDp]g;Vmw)|w*{*3?lS- ulj' ~1`Dw$ӳ4 ; ŵ=dL3k4~k{%YU(lso(yN@V_HBOkF}8'L*k/yhk.&?Yۂ%3P{c񏄌9u> H!B] zs ϲ\ZwnEJ/P:R߯*>(C  jfōbCzXr>< l~qu뜤DU"% eؗs\˴a|uK TAthbT9* 1chVs\0TVYQuSe >Bvn4GHm_t;1|^*/ul7 X)~7efwl0*:`O_ .tٻZvZ|_}u@ -PbAm7D$ᩍ݈Zxݤ$b' Xσ^PDޜ+&UV#97\Ը:~5a"T@gAuQ܈az%aS$ٙW<"EomK]R?@]7u{pUػE@Ul-r0P@lAu2om$ߢ5rup#dAF7,~.EW{KbȽ ,hP1"!洐)}'A-qCt,rY?2:=Zjn[h&Vd{@%aO0x h=wlA[Rґi`#>-x )+ 8!8.v4 NHo*"ZKR7ubF/fY"`wO3\A N'5h;;@L͝ʟJôA @Dq ay3"ad`bT-8~ߪ7ir.RuYFsũ?eeσ0xɇ`Å*pܧ:)Ijt-C7J/RxGhZP=a߄8c8p?ܮEиvgT*섄DHF *Z;Z.;0-Eg"ثjBÁGj!4fm˧L4~ UNh,;f%xQX@]!pacA(w>Pݺ{_-|n[J9 /KNJVDp/1s<~`bEoDvmVdTuKmvjB7N)P1&Z2HR}_{ NH0L_V62PI+G-On8+!>q5_23W}G4(tbn /Ce`I:\oӪ+MHJMo3ry6paK%XM/-/șc W -C\&cO_1>+4tArncs4}˻Pj)\9-D6>PTOSވQo%..~1 Ψ__f4]L%S7Ju6מ >+ P&ə+j E7=3㽦 Qk0 -ŨKGq׫ubtҒKXNN=v=S*qi)@2oPMg&=^e'fAC`&h269hU ZKlnWN.^>S 3P~.V >Bڄc,%\<B}v ٣ʷ l,EAsko% l(_U1d3A,nH(8@Yvb k֜0lu^a^"*h̼?2 en_\/Tz:JzZ!q#MBPC]L5 h] E cE!L,nhʡB*GJNgi!h@3|g]᳾Y}w%B*֘;@aK#qզAlxWPj?*LN1d&ΦF~;kˍIZ1&*roaAC RY`sіG39dc{ͨR*Xw"|EJ"Rsa#TA,dˆA;1|24ؔs6c 9 c!d]PFf#M_weBiA܅a."~Bkq _gU+]B78|d\#0q91:>8qx8^_|w3k9X2ZS諕lhѭR0܃L7-JeJhv\54r:d5%Σb ' `ZK "uN=4<"jA"R{qU%?F*E[|B$l gs4xB`{|U%0TI0v7 Ώ5ݜR%nc\E)K=K;;PYS%)9Jb6"!ᜱ$ 2[xYК9eu˪x}\d`]y7.Mb׷@{@&@vB&s]GJ3HI<uzL]d +7Wnpsߕ/"]ugu 'ZcnR "!;evIυbX(_=lxu f|\7l8?YL.n* &a|bB"[)n@t Aq39nJ9*1S,ʚ(9%JxTNV>P/BW'. rP$C%T K%$$*P|؍BcF+lbbzO1,s?H8V1=\sj^<:`IFM굆;0LФ0K~.inj$t33﵄_֚Ly3Cv31f`͹Lvƽɶx? y%}Nl3{AL@gA=hJfkPPHb~mdQ-Ǫ!~F_ |d5«gK4z޺wC'hxmPDk y+"P ClxtlY S}ዲD YGPL/y>qgP)g],Ժi#TfH-ó2r y#1؉cED+ Yi-H_GuES$*ro * =.B)Y|f̏U+z(s/}W:ه{nP=XFm:>W/(/ؓ0(҈'S3G5yI(uF]Fhf]hmC),4uA`Ѕ*|?~c'a=X<4kLw4ND}GG{p&is]$15c(!dq%v(SI>ZρGWa2l1>i a><q=+ܑOc\(S5VЋ%go1 ϚcyɿЕURf|  7O'tK Ys60K<4t>{, j0O…ѥz;S^VR&?,D&0$JByuJZۚOjpY[њQgD/YIJvPRg7ق-W#l z g/(T߾XfXu@lSpCA&^dBJ+ 2r  KX[ ]%VNh^R\5:(0a q0c‰ 'idê7ZԴw?[:%N!F{ PC:yb*]8Ϗ<愜4ǀ4VaҴTL7HD*)AqW1ifi?[Yգ(z b%刚EBʎ;E# SZQZb}@8ŶB?#ފ]s =;lMu5ase5Hpb&CP.5nKr]fmm2U!r={İdC'W ~'d.;E̥˫`a(R௧]QVQly&8e Ɓ?ͤKg%P'v@RkR" YY(w$٘r0@/+Է)!GBOO V w[ XbzTӾZ"tA 6uȄ,0QhtEj_/-f `qlmj GX,*A"활Ԅ[d^ #KXw-H(Vn <:|r5SeGdVe(}^uϣl38OCg.r*,-2G~yśV fYO㪴\D6S <-&pL•EYI͒ R4X#!_;K͊ ݲ-~8(k\*=az Z΁J+zG8ѭ/^dvjCG4?\=r4%z+:LR͢D&ǯzʡļg2wA,W.7ܼJuV J\@GR PQ= ){DQXb0G */d@v)"X<8A爥' @7,X(G2RIPڑRA$;>ױ]2wrw`;v%Yn7r !FCNKz7yԭR!0d [ Oge+` |:Zb(Iš ag9/OxxCvTǏ8)ĀCHjVFIOw(£`(-ͪ6@^UL_}X\rT3l:.WsaLE,&:z ~BqIl%oiy3Ixcġ/Qo<]iU0 + kXZҙtcoM^sgmactuX~"S4iTg'z$&):unssLs%Wr!KgzךH 3qluj=rbb=LI05 | K2}ߌd 3Lt$+=u0(@_'ߪ6C9oBSq&^m4BvGv? +S#:"Hħ_7F*:&';\+KfH9ؔ,&zAh_Jy$@M`F?%oLKI/^΂8(ԉRܵwNÙw5nA[=+J}P@&RF?:%YírƼg߾(%:eBZd j[9 ͇S{QJ:iwA?20qT@!YjgǪyd߭ (@yB}iB,Mhm ESȞ\f.2B=,vˤNOAU$? 慲bT~9/"f>7޸.tz.^UP_Wl;?|-;|Zu=\Vß)($6yթa%kP|>U6ׄ`xկ*t=ǻֳAzOb4(6c={6G(;7A2ؿ8\ -:=.F~o_ql+PtTSYzyS5R[JGu`Ip-u1]%aj2[@* Ҭ2WuI2#.פ78E_r;0?Y )k&=I(JⓋOB)IP|N IbqQ<:ku$ݯ Zu쇯1sj'[t'D9"8Jxh"IO!ǹhȦvVG$+EVW&ޒ>L \)?x]\sdR }N?OJmꋟt9&Xd#1u&^~RvaY_)12ZW~@w~5٦g90S.&?JEf1S UN.\;0O58W=")͉ k/ۏqL'$;O_rHGEYb}!V{$>ubONq=٭nIkJMտX]'-?!@{`yU״ 25/>,sNXCbQtY af{(b?~4gLl< rwZ{wb}\x{E)/Q: j[=N3e$ mXS; t }9Uγ+fɅBkhH~ 0c@V']}{pi۲ĵiPDžznQkK{zSjv6OIGJUBS:BEL#fU M/ ~U4bTwy<*jF3^?fY$(dDn8 SqNpHl{?VnrC?{F}p5M3_^,>N#2 E>SOvAt8kTx&gͼє*x MUnΤD1ʎˁ!.܉ |aW/~YɑV D5⿈+>#^ 9|4ŔݷQջ <$ ȱ[Z+܃ orJ |S' ) Ԉ攟.^AAemBC۱*ބcpV!*yVN6DԄ( w[![uB-PH+ 0s.oG)ִst8 c(O\I5u3_;t1-ѽMXq3Kx ǘ*n )f(J4QnVE# NZlCkco+KD[MI: ;6_Q@[7=yu=2vcJ"UT$9Rl\#vosz4:aHAZG۠:+^-n%OPƹϖVcˤMffMnv'eO\5ro{)1p'?GY &vMz?J_[#ȱX E\@: *ݿ lT0,bdXkQ8'cƵ VXUt F!{2ݴ^bV!Ec~x v!H-G^| DmTz,q DT&6\=5c:W#X 7oΰFT;ܒU.%m_;ӲQSt sH,|o=`vg4f4lm|`)ޟ2'7gTfFUSL 7x"Л[1 A100\sZ r9ߝ<AmM)\r}SM`Ćmn||.iPfϑcZ4 YlGƈTVHni_}}yj:5=UO0:Fht<+/#SY \/ft%4Z ē.DWc5}=ʀLHYt_;KPMRD  *_ie=W # >HbqG VMX; gkO޸qZDT6Z_CjeCln{ah<ϩwVr/mA!;ꖠ'rn͙U[o 5I(˼ۣ"Dn=.5o#cFfg2 &y`NYNЦh!BK l"Z"8=&,')ER`s rr Z` j,no3t,>³5X!~J>mS ϙϿ5[y{ob`h~^?^R.$<D\FҊQ3;2t.&nʅki+ f_厙p!Z<<ӕߠ BA;;-?#5W_DI| {s8]&QUK."j0J\rJ+kJd w3j1Q > lI(zsm}Zl t1_zno9^M M-S*2,8 TVoZD܇+'*}4J_"`Srkp69s $ -u&Bymj?8s7wqŢRTy,WR,_Y;$=sQV,z^БH59Y<0y 4[G꣆ qϰ*t5orE^ dG$|A 259,nFxV ۉFǷƅ%Ђ/.]T_zYۜS#UrL|σrh%컰96"GF@J?]gkռwejg#L+Hbq-e[2<`M9 oG\RD?@ZtqdIsK]|PCX*&WnDf Z l1^$T] pklW^"uh⛻jxuIB+d' Jk3W+xmX9h1}i~E[bV= }dO #֕CN^X@@.h~IZtG>vlD}L&{რә+8a LsA d4+}@NbH Y=¥aF=@?LK̈́k~$q-jEGS+g|Ό(] kojm'V4W~E=D>9+k㨾C;WeY+QWIjH?3X}Sjʑ3`<)~˳b n )s*%ǧO)]BI) ,WQujѩX7 gʆ5?-ǝ6 q\zf1@у'O7|2y|Q6Z#q1ݤ^f5+~*Pnla+ 8ކ:7nRVA/T.Rvi2&2!527=qz[6ќTzn /ضn@җdಖYjpdfm2d..Fr/v5lyeu'ʌد}qwYRF_6C/k@|(E9 7!WOfЕGG=c iHG>WH}Xx] ZVfznj,L ඳ@d>pD-Xhsg{ŷ(p6E;:h`2b8P cS)AQ-gcn2p8: Lon = Qa(|Vw ,:t)j}m{u0Ѓ>U sQyF5νH\FFz];Ł< 4hh8w9lZ3R1hBE]h*=L[,0zptr/KdPqO'!K%Z%*Lgfj3wd!2U6|55V,]͌UJYT:cL z/dc_(})oeǪf(r̢9sW$}b:XnBy, 5p e _nIaaͅu7X)RPxse!M{y=]'dVchd k8mzhH5/ ï뢅KڣyQgrw!E+dg? 2d)?n8~kިyiltej}7k` UAs녪=(gpq޳ce-Q3fJmߌey:rKT9 Ѿ&oEr #Qed5uIPPxtHT)M7tgLZ@{b'yC- +)\F¦41gzg7"ƶPU9!_gW^w>)T2``M'T3Wnp[Oc}V=4`,9m揅KhThЧP}F!26OE^ImZf܇xEjE'hYD]>7q`['b|-)>T۬dX(Fu[&ы/&S`&ӡ6DGo s2c`n6 o>R67 W(=ult>]葁 wuXR`vo!iQ+J r3MvۇMOUh&&y@vUW)/ [rݦeJ.s1HeCwF+ymBо5 $7tV|!\גy8k;rA}2~Xk1̢gd.PbwWdޖW=EɃvG'_/Pt.hʼn2_سoc|Q2Tj*.y( nEXQ׏N[lD2'бܙ`>:;W Owr7ITךh+"Fhd5눌83wNHTzhod>W њe) kVBX}jgYZ.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.stapsdt.base.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.PyRuntime.probes.bss.note.stapsdt.gnu_debuglink.gnu_debugdata 88$o``1( 4408o~~EoT((8^B`e`e "hc  nttdW dW z` ` )))),**tp/p/x/x///(; *00,008@000 Y3I3 [3K3[3K3[ K3HN34|N3p34%